Blast:Putative ferric-chelate reductase 1 homolog

Overview
NameBlast:Putative ferric-chelate reductase 1 homolog
Smed IDSMED30033204
Length (bp)1958
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Blast:Putative ferric-chelate reductase 1 homolog (SMED30033204) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Blast:Putative ferric-chelate reductase 1 homolog (SMED30033204) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033204

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30033204SMESG000005729.1 dd_Smed_v4_13311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Human
Match: FRRS1 (ferric chelate reductase 1 [Source:HGNC Symbol;Acc:HGNC:27622])

HSP 1 Score: 141.739 bits (356), Expect = 5.799e-35
Identity = 137/550 (24.91%), Postives = 241/550 (43.82%), Query Frame = 1
Query:  172 YPHHDTSYST--MVPQ---SNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINP-VGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITY--NGFNAQTP----LPNPTGPLDPNDSIT----IDGCGTTKNCLLYPLSCYDRR--NCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKA-GKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAKFTSEN 1752
            YP+   + S   M+P+   S  ++P+  + ++  T+R    IE+ +  +    +KG LL  + N ED+  P +G FT  +    +         S ++HRS A K  ++   + APS             +   ++W+ +   I    N F   TP    +P PT P  P   +T       CG  K C+  PL+C   +  +C ++  +R D ++V  E+ GP+KGY++ ALS+D  MGDD   +C +         QT Y    +  +L     P + ++     M +   +  + C FR   I +  VK     DL+ S YIF+A+G       Y  KHS  PLI+     +  +   I    ++    KVHG +M +++M    I +++   F+  +S   L G   WF VH +L     +++   ++     +    + A +H   G + + L+++  L+   RP L   RR  F W H++   A +I      +L      +NL ++ K       + W VG  ++  +  +   RK +   ++
Sbjct:   23 YPNGKVTQSCHGMIPEHGHSPQSVPVHDIYVSQMTFRPGDQIEVTLSGHP---FKGFLLEAR-NAEDLNGPPIGSFTLIDSEVSQLLTCEDIQGSAVSHRS-ASKKTEIKVYWNAPSSAPNHTQFLVTVVEKYKIYWVKIPGPIISQPNAFPFTTPKATVVPLPTLP--PVSHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTR-DDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHED-------QTVYI---QPSHLTGRSHPVMDSRDTLEDMAWRLADGVMQCSFR-RNITLPGVKNRF--DLNTSYYIFLADGAANDGRIY--KHSQQPLITYEKYDVTDSPKNIGGSHSV-LLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFTTTVLTCIAFVMPFIYRGGWSRHAGYHPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPGLNLPDSWKTYAMTGFVAWHVGTEVVLEVHAYRLSRKVEILDDD 548          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Human
Match: FRRS1 (ferric chelate reductase 1 [Source:HGNC Symbol;Acc:HGNC:27622])

HSP 1 Score: 140.969 bits (354), Expect = 1.349e-34
Identity = 137/545 (25.14%), Postives = 241/545 (44.22%), Query Frame = 1
Query:  172 YPHHDTSYST--MVPQ---SNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINP-VGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITY--NGFNAQTP----LPNPTGPLDPNDSIT----IDGCGTTKNCLLYPLSCYDRR--NCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKA-GKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVG-EFIIGGIFWFLRQRKA 1734
            YP+   + S   M+P+   S  ++P+  + ++  T+R    IE+ +  +    +KG LL  + N ED+  P +G FT  +    +         S ++HRS A K  ++   + APS             +   ++W+ +   I    N F   TP    +P PT P  P   +T       CG  K C+  PL+C   +  +C ++  +R D ++V  E+ GP+KGY++ ALS+D  MGDD   +C +         QT Y    +  +L     P + ++     M +   +  + C FR   I +  VK     DL+ S YIF+A+G       Y  KHS  PLI+     +  +   I    ++    KVHG +M +++M    I +++   F+  +S   L G   WF VH +L     +++   ++     +    + A +H   G + + L+++  L+   RP L   RR  F W H++   A +I      +L      +NL ++ K       + W VG E ++   +W + + ++
Sbjct:   23 YPNGKVTQSCHGMIPEHGHSPQSVPVHDIYVSQMTFRPGDQIEVTLSGHP---FKGFLLEAR-NAEDLNGPPIGSFTLIDSEVSQLLTCEDIQGSAVSHRS-ASKKTEIKVYWNAPSSAPNHTQFLVTVVEKYKIYWVKIPGPIISQPNAFPFTTPKATVVPLPTLP--PVSHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTR-DDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHED-------QTVYI---QPSHLTGRSHPVMDSRDTLEDMAWRLADGVMQCSFR-RNITLPGVKNRF--DLNTSYYIFLADGAANDGRIY--KHSQQPLITYEKYDVTDSPKNIGGSHSV-LLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFTTTVLTCIAFVMPFIYRGGWSRHAGYHPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPGLNLPDSWKTYAMTGFVAWHVGTEVVLELKYWMMTEFRS 543          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Human
Match: FRRS1L (ferric chelate reductase 1 like [Source:HGNC Symbol;Acc:HGNC:1362])

HSP 1 Score: 68.5514 bits (166), Expect = 9.687e-12
Identity = 56/194 (28.87%), Postives = 83/194 (42.78%), Query Frame = 1
Query:  616 PNPTGP-LDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHS-DPPLISLTSIILYSTKN 1191
            P PT P +DP   I +D CG TK C  Y     +   C Y +S R+ G +V+FEL     G++A+  S+D  MG D V+ C ++ N     +Q  Y         V      I    A     +   N + C+F+ P  +  P  E I  DL  S Y   A G     +  + +H  D P  S   + +Y  ++
Sbjct:  133 PFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRV-RIQHFYN--------VGQWAKEIQRNPARDEEGVFENNRVTCRFKRP--VNVPRDETI-VDLHLSWYYLFAWGPAIQGS--ITRHDIDSPPASERVVSIYKYED 312          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Celegans
Match: C05D12.1 (pep chromosome:WBcel235:II:11412232:11415820:-1 gene:WBGene00007339.1 transcript:C05D12.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D12.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.119e-9
Identity = 82/364 (22.53%), Postives = 142/364 (39.01%), Query Frame = 1
Query:  646 DSITIDGCGTTKNCLLYPLSCY--DRRNCKYMVSSRV---------DGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYT--------PSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRI---PRILVSPVKELIPKDL-SESLYIFIANGNTYHSTAYVKKHSDP-----PLISLTSIILYST---KNGIFYLQNLEYYKKV-----------HGTIMILSFMILQPIAIIIVLHFRHNFSY-RLKGRQLWFNVH-------VLLNLI--YFLMSLAGYIYMLCNKEIRFQD--AKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAM 1575
             S + + C  T++C  +P  C   +   C+  V  ++         + K  D +   P   Y A+  S +  M DD V  C   P++    +Q  +         P G    L             G  +++  +  L C  ++    R L+    + +  DL S S ++  A G+    T     HS       P +S   +    T      ++++  +     V           HG +++ ++ +L   AI+I  +F+  F   +L G  +WF +H       V++ +I   F+   AG+++  C+      D   K HGI G  A  L+L+  + GFLRP  TS  R  F W H+   M
Sbjct:   23 SSFSFEQCNVTRSCWFHPPECAADNLAACQSGVEWQMLPEGLFLQLEAKVHDLDQTRP--FYAALGFSFNQRMDDDTVFECVV-PHTGDGKVQISFNDETFNQVLPQGSSVLLT-----------EGTTSYV--DGVLTCSAKLLLDNRPLIDNDTQFMVHDLESGSYHLLFARGSANKYTLEKDIHSTNDGQQFPWMSDEQVSFCRTNCSSPNLYHIGEMRQTYNVSRYWRYRIAVWHGILLMFAWWVLASNAILISRYFKPLFPRNKLLGTAVWFQLHRDMMILSVVIQVICVLFIFYQAGWVWYQCSYMCTSDDFSKKMHGITGFTATVLALLQPVFGFLRPSPTSSIRPIFNWGHWLVGM 370          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Celegans
Match: C05D12.1 (pep chromosome:WBcel235:II:11412253:11415729:-1 gene:WBGene00007339.1 transcript:C05D12.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D12.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.119e-9
Identity = 82/364 (22.53%), Postives = 142/364 (39.01%), Query Frame = 1
Query:  646 DSITIDGCGTTKNCLLYPLSCY--DRRNCKYMVSSRV---------DGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYT--------PSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRI---PRILVSPVKELIPKDL-SESLYIFIANGNTYHSTAYVKKHSDP-----PLISLTSIILYST---KNGIFYLQNLEYYKKV-----------HGTIMILSFMILQPIAIIIVLHFRHNFSY-RLKGRQLWFNVH-------VLLNLI--YFLMSLAGYIYMLCNKEIRFQD--AKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAM 1575
             S + + C  T++C  +P  C   +   C+  V  ++         + K  D +   P   Y A+  S +  M DD V  C   P++    +Q  +         P G    L             G  +++  +  L C  ++    R L+    + +  DL S S ++  A G+    T     HS       P +S   +    T      ++++  +     V           HG +++ ++ +L   AI+I  +F+  F   +L G  +WF +H       V++ +I   F+   AG+++  C+      D   K HGI G  A  L+L+  + GFLRP  TS  R  F W H+   M
Sbjct:   23 SSFSFEQCNVTRSCWFHPPECAADNLAACQSGVEWQMLPEGLFLQLEAKVHDLDQTRP--FYAALGFSFNQRMDDDTVFECVV-PHTGDGKVQISFNDETFNQVLPQGSSVLLT-----------EGTTSYV--DGVLTCSAKLLLDNRPLIDNDTQFMVHDLESGSYHLLFARGSANKYTLEKDIHSTNDGQQFPWMSDEQVSFCRTNCSSPNLYHIGEMRQTYNVSRYWRYRIAVWHGILLMFAWWVLASNAILISRYFKPLFPRNKLLGTAVWFQLHRDMMILSVVIQVICVLFIFYQAGWVWYQCSYMCTSDDFSKKMHGITGFTATVLALLQPVFGFLRPSPTSSIRPIFNWGHWLVGM 370          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Celegans
Match: C05D12.1 (pep chromosome:WBcel235:II:11412253:11415772:-1 gene:WBGene00007339.1 transcript:C05D12.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D12.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.119e-9
Identity = 82/364 (22.53%), Postives = 142/364 (39.01%), Query Frame = 1
Query:  646 DSITIDGCGTTKNCLLYPLSCY--DRRNCKYMVSSRV---------DGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYT--------PSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRI---PRILVSPVKELIPKDL-SESLYIFIANGNTYHSTAYVKKHSDP-----PLISLTSIILYST---KNGIFYLQNLEYYKKV-----------HGTIMILSFMILQPIAIIIVLHFRHNFSY-RLKGRQLWFNVH-------VLLNLI--YFLMSLAGYIYMLCNKEIRFQD--AKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAM 1575
             S + + C  T++C  +P  C   +   C+  V  ++         + K  D +   P   Y A+  S +  M DD V  C   P++    +Q  +         P G    L             G  +++  +  L C  ++    R L+    + +  DL S S ++  A G+    T     HS       P +S   +    T      ++++  +     V           HG +++ ++ +L   AI+I  +F+  F   +L G  +WF +H       V++ +I   F+   AG+++  C+      D   K HGI G  A  L+L+  + GFLRP  TS  R  F W H+   M
Sbjct:   23 SSFSFEQCNVTRSCWFHPPECAADNLAACQSGVEWQMLPEGLFLQLEAKVHDLDQTRP--FYAALGFSFNQRMDDDTVFECVV-PHTGDGKVQISFNDETFNQVLPQGSSVLLT-----------EGTTSYV--DGVLTCSAKLLLDNRPLIDNDTQFMVHDLESGSYHLLFARGSANKYTLEKDIHSTNDGQQFPWMSDEQVSFCRTNCSSPNLYHIGEMRQTYNVSRYWRYRIAVWHGILLMFAWWVLASNAILISRYFKPLFPRNKLLGTAVWFQLHRDMMILSVVIQVICVLFIFYQAGWVWYQCSYMCTSDDFSKKMHGITGFTATVLALLQPVFGFLRPSPTSSIRPIFNWGHWLVGM 370          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Celegans
Match: C13B4.1 (pep chromosome:WBcel235:II:14470523:14479627:-1 gene:WBGene00007545.1 transcript:C13B4.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C13B4.1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.512e-8
Identity = 68/276 (24.64%), Postives = 118/276 (42.75%), Query Frame = 1
Query:  796 YIAMALSNDTIMGDDLVIVCANNPNSPTP---SLQTGYTP---SGKR----KYLVTT----VDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKE---LIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKF---HGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIH 1560
            Y A+  SND  M    VI C++  + P     S  +GY+    SG+     +Y+  T    VD  I+ K  G +      NA + K+       +P ++   +I K  +    +     N Y STA +       L  L +     + N +  L         H   M +++M + PIA+I     R ++ + +  G  +WF++H   NLI   + +A ++ +L +K+ +F    +   H I G +A+ L+ +   +  LR      RR  F +IH
Sbjct:  616 YTALGFSNDGKMNPANVIECSSLGSQPLSMKFSTNSGYSNDRISGEEAIRSQYITNTETSYVDGKIYCK--GTVRSDGNSNAAIFKY-------TPKQQYHLIIAKGTASPGGLGYHGTNRYISTARL-------LTDLGAGNESGSSNTLLIL---------HAMFMTIAWMTMVPIAVIFARVLRSSWPTTKPGGLLIWFHIHRGANLIGIALMIAAFVLILIHKDWKFTTIGWGGKHAIIGIIALCLAWLQPFISTLRCSPNDSRRPIFNYIH 866          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Celegans
Match: C13B4.1 (pep chromosome:WBcel235:II:14470383:14479627:-1 gene:WBGene00007545.1 transcript:C13B4.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C13B4.1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.512e-8
Identity = 68/276 (24.64%), Postives = 118/276 (42.75%), Query Frame = 1
Query:  796 YIAMALSNDTIMGDDLVIVCANNPNSPTP---SLQTGYTP---SGKR----KYLVTT----VDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKE---LIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKF---HGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIH 1560
            Y A+  SND  M    VI C++  + P     S  +GY+    SG+     +Y+  T    VD  I+ K  G +      NA + K+       +P ++   +I K  +    +     N Y STA +       L  L +     + N +  L         H   M +++M + PIA+I     R ++ + +  G  +WF++H   NLI   + +A ++ +L +K+ +F    +   H I G +A+ L+ +   +  LR      RR  F +IH
Sbjct:  616 YTALGFSNDGKMNPANVIECSSLGSQPLSMKFSTNSGYSNDRISGEEAIRSQYITNTETSYVDGKIYCK--GTVRSDGNSNAAIFKY-------TPKQQYHLIIAKGTASPGGLGYHGTNRYISTARL-------LTDLGAGNESGSSNTLLIL---------HAMFMTIAWMTMVPIAVIFARVLRSSWPTTKPGGLLIWFHIHRGANLIGIALMIAAFVLILIHKDWKFTTIGWGGKHAIIGIIALCLAWLQPFISTLRCSPNDSRRPIFNYIH 866          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Fly
Match: CG8399 (gene:FBgn0034067 transcript:FBtr0340018)

HSP 1 Score: 134.42 bits (337), Expect = 1.405e-32
Identity = 123/544 (22.61%), Postives = 230/544 (42.28%), Query Frame = 1
Query:   88 TLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEI-VIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKRE---ITYNGFNAQTPLP--NPTGP-------------LDPNDSITI------DGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELV---GPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINL 1632
            T  + + I+        +G+P+ VC    P H  S  +++PQ N   P  +  +  T  +  T+ + +  + + + + G ++  + N       +G+F       I+  N    VN+  TH SNA    ++I  +++P    G +  +A  A++   FW+ V  +   I     +A  PLP  +P+ P             + PN+ + +      +GCG +KNC  +P  C   ++C  +    V G   +FE+    G N  Y+A+ LS+D  MGDDL   C   P +   +L +  T +       + V  N+    A  ++    +  + C  R+ R  V+ V+       +   ++ +A+G++    + V  H    L S   I L   ++      +     ++HG  MI +++    + II   +F+  +   +  G   WF  H LL +  + +++A Y+ +    E++      H I G + + L  I  +    RP     +R YF W H+       I G +T   +F ++ L
Sbjct:   16 TALLAVAIWPDPGQSLPQGAPETVCDTMLPFH--SGGSVLPQ-NSVSPFSVETSSSTLGQGQTLRVDLTGVPAGLSFGGYMIQAR-NRNPPHQIIGQFGPARDGTIKLMNCENSVNNSATH-SNAGPKQQVILEWQSPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIVRRDLSAAPPLPTQSPSAPAGTTRAPYVPPSYVAPNNVVAVSSDPIYNGCGQSKNCFGFPDGCVATKSCTSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECV--PENGRVNLYSSLTSASP----YSAVRSNVNQNSARLLDASIVDGVIYC--RVQRDAVTNVQGRTFDLRNGKYHLLVASGSSLKENS-VGYHDIGRLPSAQPINLAEVQD---LSGSSRLLIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAYVLIWV--ELKQAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVT---IFFSVKL 537          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Fly
Match: CG8399 (gene:FBgn0034067 transcript:FBtr0087207)

HSP 1 Score: 133.65 bits (335), Expect = 2.128e-32
Identity = 123/544 (22.61%), Postives = 230/544 (42.28%), Query Frame = 1
Query:   88 TLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEI-VIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKRE---ITYNGFNAQTPLP--NPTGP-------------LDPNDSITI------DGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELV---GPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINL 1632
            T  + + I+        +G+P+ VC    P H  S  +++PQ N   P  +  +  T  +  T+ + +  + + + + G ++  + N       +G+F       I+  N    VN+  TH SNA    ++I  +++P    G +  +A  A++   FW+ V  +   I     +A  PLP  +P+ P             + PN+ + +      +GCG +KNC  +P  C   ++C  +    V G   +FE+    G N  Y+A+ LS+D  MGDDL   C   P +   +L +  T +       + V  N+    A  ++    +  + C  R+ R  V+ V+       +   ++ +A+G++    + V  H    L S   I L   ++      +     ++HG  MI +++    + II   +F+  +   +  G   WF  H LL +  + +++A Y+ +    E++      H I G + + L  I  +    RP     +R YF W H+       I G +T   +F ++ L
Sbjct:   16 TALLAVAIWPDPGQSLPQGAPETVCDTMLPFH--SGGSVLPQ-NSVSPFSVETSSSTLGQGQTLRVDLTGVPAGLSFGGYMIQAR-NRNPPHQIIGQFGPARDGTIKLMNCENSVNNSATH-SNAGPKQQVILEWQSPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIVRRDLSAAPPLPTQSPSAPAGTTRAPYVPPSYVAPNNVVAVSSDPIYNGCGQSKNCFGFPDGCVATKSCTSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECV--PENGRVNLYSSLTSASP----YSAVRSNVNQNSARLLDASIVDGVIYC--RVQRDAVTNVQGRTFDLRNGKYHLLVASGSSLKENS-VGYHDIGRLPSAQPINLAEVQD---LSGSSRLLIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAYVLIWV--ELKQAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVT---IFFSVKL 537          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Zebrafish
Match: frrs1a (ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-45])

HSP 1 Score: 141.739 bits (356), Expect = 2.646e-35
Identity = 125/512 (24.41%), Postives = 219/512 (42.77%), Query Frame = 1
Query:   79 MNKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPN------DSITIDGCGTTKNCLLYPLSCYDR--RNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKI 1587
            +   L I   +  +V  G+  G  Q  C    P H +  +T         P  LT+N   +     I + +  +    ++G L+  +  T      +G FT  N    +    +    S ++H S+  K  ++   ++APS +   +   A       +FW+ ++  +  +G     P P  T P+            + DGCG  K CLL P+ C      NC Y+  S   G+ V FEL GP +GY++ ALS+D  MGDD V +C  +      S++  YT    R Y   +    + +     + +   +  + CKF   R + +P ++     L+ S Y+FIA+G+  +    + +H+  PLIS    ++      I          K HG +M++++M+      ++  +F+ ++  + L G+++WF VH +L  +  L++  G+I     +      A  H   G   + L+    LM   RP   S RR  F W+H+    A +I
Sbjct:    4 LQTALVILAALCFTVINGYKNGKVQKACESMMPEHHSQPNTTAS------PYTLTVNASKFSPGDNIRVTLSGSEP--FEGFLIQARDATNLDGLAIGSFTLVNLKISQRLTCNGIEGSAVSHTSDV-KKREIEVIWKAPSNSPLAVQFLATVLAHYKVFWLKLRGPVITHGDATPAP-PQSTTPVCGKIQTTHLSQFSSDGCGRQKTCLLDPVGCNPSVDTNCFYLAYS-TSGQTVSFELSGPAQGYVSFALSSDKWMGDDDVYLCVYDGGR--VSVEAAYTTG--RTYPKVSSQSVLMD-----VGWRVSDGIIQCKFS--RSIYTP-QDPERFSLNNSYYLFIAHGSAEY--GMIHRHTRQPLISSHHQVIIGPPV-ILTGSRSPLLMKYHGALMLIAWMLAGSTGTLMAGYFKPDWPEQTLFGQKIWFQVHRMLMSLTVLLTSVGFIVPFIYRGKWSTRAGAHPYLGCTVMILAFCQPLMAAFRPAPDSPRRWIFNWLHWGVGNAAEI 489          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Zebrafish
Match: frrs1a (ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-45])

HSP 1 Score: 137.117 bits (344), Expect = 5.788e-34
Identity = 125/529 (23.63%), Postives = 222/529 (41.97%), Query Frame = 1
Query:   79 MNKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTP----------------LPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDR--RNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISL-------TSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKI 1587
            +   L I   +  +V  G+  G  Q  C    P H +  +T         P  LT+N   +     I + +  +    ++G L+  +  T      +G FT  N    +    +    S ++H S+  K  ++   ++APS +   +   A       +FW+ ++  +  +G     P                +P P          + DGCG  K CLL P+ C      NC Y+  S   G+ V FEL GP +GY++ ALS+D  MGDD V +C  +      S++  YT    R Y   +    + +     + +   +  + CKF   R + +P ++     L+ S Y+FIA+G+  +    + +H+  PLIS          +IL  +++ +          K HG +M++++M+      ++  +F+ ++  + L G+++WF VH +L  +  L++  G+I     +      A  H   G   + L+    LM   RP   S RR  F W+H+    A +I
Sbjct:    9 LQTALVILAALCFTVINGYKNGKVQKACESMMPEHHSQPNTTAS------PYTLTVNASKFSPGDNIRVTLSGSEP--FEGFLIQARDATNLDGLAIGSFTLVNLKISQRLTCNGIEGSAVSHTSDV-KKREIEVIWKAPSNSPLAVQFLATVLAHYKVFWLKLRGPVITHGDATPAPPQSTTVMSTHSSSTSIIPQP---------FSSDGCGRQKTCLLDPVGCNPSVDTNCFYLAYS-TSGQTVSFELSGPAQGYVSFALSSDKWMGDDDVYLCVYDGGR--VSVEAAYTTG--RTYPKVSSQSVLMD-----VGWRVSDGIIQCKFS--RSIYTP-QDPERFSLNNSYYLFIAHGSAEY--GMIHRHTRQPLISSHHQVIIGPPVILTGSRSPLLM--------KYHGALMLIAWMLAGSTGTLMAGYFKPDWPEQTLFGQKIWFQVHRMLMSLTVLLTSVGFIVPFIYRGKWSTRAGAHPYLGCTVMILAFCQPLMAAFRPAPDSPRRWIFNWLHWGVGNAAEI 496          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Zebrafish
Match: wu:fj05g07 (wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307])

HSP 1 Score: 120.168 bits (300), Expect = 4.650e-28
Identity = 123/510 (24.12%), Postives = 214/510 (41.96%), Query Frame = 1
Query:   85 KTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAP-SRNYGVLALSAVFAKTIGMFWINVKRE-ITYNGFNAQTPLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSC--YDRRNCKYM-VSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYT-PSGKRKYLVTTVD--PNIFNK-KAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIK 1584
            + L   +V+   +   +  G    VC    P+H  +  T  P      P  +T +  T++E   I++ +   +   ++G +L  +P      + +G F+    ++++  + +      ++H SNA K   +  T+ AP S   G +  S  F K+   FW+ VK   I YNG    T        +      +I GCG+TK C   P +C       C ++ V +  D   +  E+ G   GY+A+  S+D  MG+D V +C  + N    +LQ  +   SGK    + ++    NI      GK+N         C F   R  +S        +     ++ IA G++  +   ++ H++   +S T   L +    I   +      K HG +M++S+M    I +II  + +     +   G+  WF  HV L  +  + +   +I +  +       A  H + G L + LSLI  ++   R +   +RR  F W H  NA AIK
Sbjct:    9 QRLLFILVLCVGLVQSYKNGLVSEVCDSMMPNHGANAQTSSP------PFTVTADKTTFKEGDQIKVTLNSQTGYYFEGFMLQARPVGSS--STIGTFSVTG-NNVQVLSCNGMPGRAVSHTSNA-KTTSVQVTWTAPTSGQLGNIEFSVTFVKSTLTFWVQVKSSAIVYNGTITTTNTTTVAPTV-----ASIPGCGSTKVCFSEPNNCNPTTSNGCYFVAVQTSSDQSEMKIEMFGQADGYVAIGFSDDKEMGNDDVYICGKDNNG---NLQVQHAFNSGKSSPAILSLGNVSNIMTALTNGKIN---------CSFT-SRNTISTASRAASNN---EYHLMIAAGSS--NEGKIQFHTNK-YVSSTKANLLNPSVVITSEEEFPPIVKAHGCLMLISWMATGSIGMIIARYLKGVAKGQGCCGKDFWFVAHVSLMTLSVIATAIAFIIVFVSAGDWVGGA--HPVLGCLVMILSLIQPIVAAFRCEPQHERRFVFNWAHSCNAFAIK 482          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Zebrafish
Match: frrs1b (ferric-chelate reductase 1b [Source:ZFIN;Acc:ZDB-GENE-080917-44])

HSP 1 Score: 119.013 bits (297), Expect = 9.948e-28
Identity = 108/522 (20.69%), Postives = 209/522 (40.04%), Query Frame = 1
Query:   91 LFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEM---NSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPT--GPLDPNDSIT--------IDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWL 1611
            + + ++I++     +S G+    C    P H     T  P      P  +T +   +     +++ + M        +KG L+  + N  ++   VG F   +    +    + + +S ++H S   K    +     P     V  L  V A+ +  +W+ +   +     N   P P  T  G +    + +         DGCG  K+CL  P  C  + +   + +S R +  +V FEL GP +GY++ ALS D  M                                      N+   +A +++    +  + C FR  R +  P ++L    L +  Y+F+A+G          +H   PLIS +   +  +   I   ++     K HG +M++++       +I+  +F+ ++  + + G+++WF +H +L  +  L++L  ++     +    + A  H   G + + L+LI  +M   RP   + RR  F W+HF    A +I   +T +L
Sbjct:    6 VLLLLLIHSETVLCYSDGNVVVACEDMTPQHGYDPKTTDP------PFIITADKSQFSPGDEVKVTLAMGFSEGKKYFKGFLIEAR-NAGNLNEIVGSFKLISSDLSQLLTCNNKRDSAVSHTSGKHKTEVQVIWVAPPDSPSSVQFLVTV-AQGMHDYWVKIPGPLVSQ--NGAAPPPQTTFGGSIQSETTTSSTLSRSFTADGCGIEKSCLRDPEGCEPQNDAACHFLSFRAESNSVMFELSGPAEGYVSFALSLDKWM--------------------------------------NVLKDRAWRLS----DGVIQCSFR--RDVHQPPEDLNRFSLDQMYYLFMAHGRA--DDGRTHRHDRQPLISASQTDMTGSPKEIGGSRS-PLLMKFHGALMLIAWTSTVTAGVIMARYFKPDWPEQNILGQKVWFQLHRMLMSLTVLLTLVAFVLPFIYRGGWSKRAGIHPYLGCVVMALTLIQPVMALFRPAPDAARRYIFNWMHFGTGTAAQIVAVVTIFL 470          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Zebrafish
Match: frrs1l (ferric-chelate reductase 1-like [Source:ZFIN;Acc:ZDB-GENE-120827-1])

HSP 1 Score: 68.1662 bits (165), Expect = 4.961e-12
Identity = 55/198 (27.78%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  616 PNPTGP-LDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRK----YLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHS-DPPLISLTSIILYSTKN 1191
            P PT P +DP   I +  CG TK C+ Y     D  +C Y +S R  G +V+FE+     G++A+  S+D  MG D V+ C ++ N             G+ +    Y V      I    A     +   N + C+F+ P + V+  + L+  DL  S Y   A G     +  + +H  D P +S   I +Y  ++
Sbjct:   88 PFPTAPPVDPFARIKVSDCGVTKGCIRYGKPGCDAESCDYFLSFRRIGTDVEFEMSADTDGWVAVGFSSDKKMGGDDVMGCVHDDN-------------GRVRIHHFYNVGQWAKEIKRNPARDEEGIFENNRVTCRFKRP-LHVAREETLV--DLHLSWYYLFAWGPAIQGS--ITRHDIDSPPVSDRMISIYKYED 267          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Xenopus
Match: ENSXETT00000052073.1 (putative ferric-chelate reductase 1 [Source:NCBI gene;Acc:100489839])

HSP 1 Score: 126.716 bits (317), Expect = 4.148e-30
Identity = 132/526 (25.10%), Postives = 218/526 (41.44%), Query Frame = 1
Query:   79 MNKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCY-DRRNCKYMVSSRVDGKN-VDFELVGP--NKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALV-CKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNN 1641
            M   L +    Y +  + F  G     C    P H  S     PQ+  + P  +T++  T++    I + I+ NS   +KG LL       D +   G FT  N  D +  + S   NS ++H S++ K + +  ++ APS   G +   A   ++   FW         +G  +QT + +          I+   CGT K C   P +C  D   C +M  S V   N   FE+ GP     YIA+  S+D  MG+D   +CA N +    ++Q       +R +L     P   N         N+ N ++ C F    I  + +  L     S + YIF+A G T  +   +K+H+  PLI+   I L +                 HG +M++++M    I +++  + ++    +  G+ LWF +HV L  +  +++   +I +         D   H + G + + LS +      LRP  T  RR  F W H  NA+ IK+    T +L    ++   N
Sbjct:    1 MEARLLVLFSGYFASVFSFPSGQISASCDTMLPQHRGS----TPQTTAS-PYFITVSNTTFKSGDRITVTIQSNSGNTFKGFLLEALSVGGDTV--TGTFTITN-GDTQGLSCSAGPNSAVSHTSDSSK-SSITTSWTAPS-GAGPVRFRATVLQSFSTFW---------SGVESQTLMAS---------QISNITCGTGKFCFSDPANCNPDSSGCLFM--SVVPSSNGYVFEMSGPVSTLEYIAVGFSDDQKMGNDDDYICATNLSG---NVQI------QRVFLTGNNSPQSKNLIFSGSPVWNYGNGIMKCCF----IAQASISTLSRASASSTYYIFLATGPT-EANGQIKQHTKIPLITAAKIDLSAFSGNNKAASGESTLVLGHGALMLIAWMTTGTIGMLMARYMKNAAKEQYFGKGLWFLMHVFLMSLTVILTSIAFIMIFAEVSGWSSDTGAHPVLGCIVMILSFLQPFGAMLRPAPTHKRRFIFNWAHGLNALVIKVLAVATLFLGLQLVDTSTN 482          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 117.087 bits (292), Expect = 6.943e-27
Identity = 129/573 (22.51%), Postives = 236/573 (41.19%), Query Frame = 1
Query:   91 LFIFIVIYTSVAY----GFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPN-----PTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLIS--LTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLR-----NNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAKFTSEN 1752
            L IF++   + A     G+  G     C    P H  +     PQ+    PI  + ++   +     I++ +   S   + G L+  +       + VG F   +    +        NS ++H S   K  ++   + AP+ +   +   A   +   ++W+ +   I         P  N     P  P   +   +  GCG+TK C+  P+SC    N K + +S R DG++V  E+ GP +GYI+ ALS D  MGDD   +C          +   Y   G+    V++  P++    A ++     +  + C F+   I +   KE    DL  S YIF+A+G+       + +H   PL++  + +I  +    G           K HG +M +++M    I +II   F+  + +  L G ++WF +H  L +   +++   ++     +    + A +H   G   + L+++  ++   RP   + RR  F W H+    A +I   I    +FI ++L+     +     T +  +LW V   ++     F   +KAK   E+
Sbjct:    9 LVIFLIFLCTCALTPVTGYPSGKVTSACRSMRPDHGHA-----PQAE---PIHSINVDKTIFNPGDRIKVTL---SGSRFNGFLVQARDVENLDGSAVGSFALIDERVSQLLTCGGIQNSAVSHTSKERK-LQVEFFWIAPANSPKHVQFLATVVEKYKIYWVKIAGPIISQPNTPPIPSKNHSSMIPVVPPSLHKRFSPAGCGSTKFCIRNPVSCDPEHNPKCFFLSFRKDGQSVLVEMSGPGQGYISFALSYDHWMGDDDAYLCVKEDQG--VQINPAYI-RGRSHPEVSS--PDVLRDVAWRLE----DGVIQCSFKR-NIQIPASKERF--DLGGSYYIFLADGDA--KDGLLLRHQRQPLMTNRMYNISGFPEDVG---GSRSPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGYHPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARI---IAVTAMFIGMDLQALDLPDPWDTYTMVGFVLWHVFVDLLLEAHGFCLLKKAKTMEED 549          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 115.931 bits (289), Expect = 1.309e-26
Identity = 124/550 (22.55%), Postives = 227/550 (41.27%), Query Frame = 1
Query:   91 LFIFIVIYTSVAY----GFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPN-----PTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLIS--LTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLR-----NNLKLLTEIVIILWTV 1683
            L IF++   + A     G+  G     C    P H  +     PQ+    PI  + ++   +     I++ +   S   + G L+  +       + VG F   +    +        NS ++H S   K  ++   + AP+ +   +   A   +   ++W+ +   I         P  N     P  P   +   +  GCG+TK C+  P+SC    N K + +S R DG++V  E+ GP +GYI+ ALS D  MGDD   +C          +   Y   G+    V++  P++    A ++     +  + C F+   I +   KE    DL  S YIF+A+G+       + +H   PL++  + +I  +    G           K HG +M +++M    I +II   F+  + +  L G ++WF +H  L +   +++   ++     +    + A +H   G   + L+++  ++   RP   + RR  F W H+    A +I   I    +FI ++L+     +     T +  +LW V
Sbjct:    9 LVIFLIFLCTCALTPVTGYPSGKVTSACRSMRPDHGHA-----PQAE---PIHSINVDKTIFNPGDRIKVTL---SGSRFNGFLVQARDVENLDGSAVGSFALIDERVSQLLTCGGIQNSAVSHTSKERK-LQVEFFWIAPANSPKHVQFLATVVEKYKIYWVKIAGPIISQPNTPPIPSKNHSSMIPVVPPSLHKRFSPAGCGSTKFCIRNPVSCDPEHNPKCFFLSFRKDGQSVLVEMSGPGQGYISFALSYDHWMGDDDAYLCVKEDQG--VQINPAYI-RGRSHPEVSS--PDVLRDVAWRLE----DGVIQCSFKR-NIQIPASKERF--DLGGSYYIFLADGDA--KDGLLLRHQRQPLMTNRMYNISGFPEDVG---GSRSPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGYHPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARI---IAVTAMFIGMDLQALDLPDPWDTYTMVGFVLWHV 526          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 115.931 bits (289), Expect = 1.333e-26
Identity = 124/550 (22.55%), Postives = 227/550 (41.27%), Query Frame = 1
Query:   91 LFIFIVIYTSVAY----GFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPN-----PTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLIS--LTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLR-----NNLKLLTEIVIILWTV 1683
            L IF++   + A     G+  G     C    P H  +     PQ+    PI  + ++   +     I++ +   S   + G L+  +       + VG F   +    +        NS ++H S   K  ++   + AP+ +   +   A   +   ++W+ +   I         P  N     P  P   +   +  GCG+TK C+  P+SC    N K + +S R DG++V  E+ GP +GYI+ ALS D  MGDD   +C          +   Y   G+    V++  P++    A ++     +  + C F+   I +   KE    DL  S YIF+A+G+       + +H   PL++  + +I  +    G           K HG +M +++M    I +II   F+  + +  L G ++WF +H  L +   +++   ++     +    + A +H   G   + L+++  ++   RP   + RR  F W H+    A +I   I    +FI ++L+     +     T +  +LW V
Sbjct:    9 LVIFLIFLCTCALTPVTGYPSGKVTSACRSMRPDHGHA-----PQAE---PIHSINVDKTIFNPGDRIKVTL---SGSRFNGFLVQARDVENLDGSAVGSFALIDERVSQLLTCGGIQNSAVSHTSKERK-LQVEFFWIAPANSPKHVQFLATVVEKYKIYWVKIAGPIISQPNTPPIPSKNHSSMIPVVPPSLHKRFSPAGCGSTKFCIRNPVSCDPEHNPKCFFLSFRKDGQSVLVEMSGPGQGYISFALSYDHWMGDDDAYLCVKEDQG--VQINPAYI-RGRSHPEVSS--PDVLRDVAWRLE----DGVIQCSFKR-NIQIPASKERF--DLGGSYYIFLADGDA--KDGLLLRHQRQPLMTNRMYNISGFPEDVG---GSRSPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGYHPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARI---IAVTAMFIGMDLQALDLPDPWDTYTMVGFVLWHV 526          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 115.546 bits (288), Expect = 3.053e-26
Identity = 124/550 (22.55%), Postives = 227/550 (41.27%), Query Frame = 1
Query:   91 LFIFIVIYTSVAY----GFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPN-----PTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLIS--LTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLR-----NNLKLLTEIVIILWTV 1683
            L IF++   + A     G+  G     C    P H  +     PQ+    PI  + ++   +     I++ +   S   + G L+  +       + VG F   +    +        NS ++H S   K  ++   + AP+ +   +   A   +   ++W+ +   I         P  N     P  P   +   +  GCG+TK C+  P+SC    N K + +S R DG++V  E+ GP +GYI+ ALS D  MGDD   +C          +   Y   G+    V++  P++    A ++     +  + C F+   I +   KE    DL  S YIF+A+G+       + +H   PL++  + +I  +    G           K HG +M +++M    I +II   F+  + +  L G ++WF +H  L +   +++   ++     +    + A +H   G   + L+++  ++   RP   + RR  F W H+    A +I   I    +FI ++L+     +     T +  +LW V
Sbjct:    9 LVIFLIFLCTCALTPVTGYPSGKVTSACRSMRPDHGHA-----PQAE---PIHSINVDKTIFNPGDRIKVTL---SGSRFNGFLVQARDVENLDGSAVGSFALIDERVSQLLTCGGIQNSAVSHTSKERK-LQVEFFWIAPANSPKHVQFLATVVEKYKIYWVKIAGPIISQPNTPPIPSKNHSSMIPVVPPSLHKRFSPAGCGSTKFCIRNPVSCDPEHNPKCFFLSFRKDGQSVLVEMSGPGQGYISFALSYDHWMGDDDAYLCVKEDQG--VQINPAYI-RGRSHPEVSS--PDVLRDVAWRLE----DGVIQCSFKR-NIQIPASKERF--DLGGSYYIFLADGDA--KDGLLLRHQRQPLMTNRMYNISGFPEDVG---GSRSPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGYHPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARI---IAVTAMFIGMDLQALDLPDPWDTYTMVGFVLWHV 526          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Mouse
Match: Frrs1 (ferric-chelate reductase 1 [Source:MGI Symbol;Acc:MGI:108076])

HSP 1 Score: 127.487 bits (319), Expect = 2.188e-30
Identity = 121/534 (22.66%), Postives = 227/534 (42.51%), Query Frame = 1
Query:  190 SYSTMVPQSN---DNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINP-VGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREI-------TYNGFNAQT-PLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRN--CKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQ-LWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAK 1737
            S   M+PQ N    + PI ++T++  T++    I++ +   S   ++G LL  + + E++  P +G FT  +  + +    + +V       + + K  ++   ++APS     +   A   +   ++W+ +   +        +    A T PL  P          +   CG  K C+  PL+C   +   C ++  +R D ++V  E+ GP+ GY++ A S+D  MGDD   +C       T  +Q+ Y     R Y V      + +     M +   ++ + C FR    L       +   L+ES YIF A G ++    +  +HS  PLI+     +  T   +   ++     K HG +M +++M    I +++   FR  +S     R+  WF VH +L +   L++   ++     +      A +H   G   + L+++  L+   RP L   RR  F W H++   A +I      +L      +NL +  K    +  ++W +G  +I  I  +   RK +
Sbjct:   31 SCGGMIPQHNHSPQSEPIHQITVSQTTFKPGDQIKVTL---SGPPFRGFLLEAR-DAENLSGPPIGSFTLIDSEESQLLTCT-DVQGLAVSHTRSSKKTEIKVYWDAPSPAPDHIRFLATVVQKFKIYWVKIPSPVISQPNAPPFTTPKATTQPLTTPPSVSHLTKPFSAFECGNKKFCVRSPLNCDPEKEPACVFLSFTR-DNQSVMVEMSGPSDGYVSFAFSHDQWMGDDDAYLCIREDQ--TVDIQSSYL--TGRSYPVMDSRGTLED-----MAWRLADSVIQCSFRRNITLPEAKNRFV---LNESYYIFFAEGPSHDGRIF--RHSQQPLITYEKYNVTDTPKSVGGSRSSPLL-KAHGALMFVAWMTTVSIGVLVARFFRSVWSKAFFLREAAWFQVHRMLMVATSLLTCVAFVLPFVYRGGWSWRAGYHPYLGCTVMTLAVLQPLLATFRPPLHDPRRQVFNWTHWSVGTAARIIAVAAMFLGMDLPGLNLPSPQKTYAMMGFVVWHIGTEVILEIHAYRLSRKVE 543          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Mouse
Match: Frrs1 (ferric-chelate reductase 1 [Source:MGI Symbol;Acc:MGI:108076])

HSP 1 Score: 127.487 bits (319), Expect = 2.188e-30
Identity = 121/534 (22.66%), Postives = 227/534 (42.51%), Query Frame = 1
Query:  190 SYSTMVPQSN---DNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINP-VGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREI-------TYNGFNAQT-PLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRN--CKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQ-LWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAK 1737
            S   M+PQ N    + PI ++T++  T++    I++ +   S   ++G LL  + + E++  P +G FT  +  + +    + +V       + + K  ++   ++APS     +   A   +   ++W+ +   +        +    A T PL  P          +   CG  K C+  PL+C   +   C ++  +R D ++V  E+ GP+ GY++ A S+D  MGDD   +C       T  +Q+ Y     R Y V      + +     M +   ++ + C FR    L       +   L+ES YIF A G ++    +  +HS  PLI+     +  T   +   ++     K HG +M +++M    I +++   FR  +S     R+  WF VH +L +   L++   ++     +      A +H   G   + L+++  L+   RP L   RR  F W H++   A +I      +L      +NL +  K    +  ++W +G  +I  I  +   RK +
Sbjct:   31 SCGGMIPQHNHSPQSEPIHQITVSQTTFKPGDQIKVTL---SGPPFRGFLLEAR-DAENLSGPPIGSFTLIDSEESQLLTCT-DVQGLAVSHTRSSKKTEIKVYWDAPSPAPDHIRFLATVVQKFKIYWVKIPSPVISQPNAPPFTTPKATTQPLTTPPSVSHLTKPFSAFECGNKKFCVRSPLNCDPEKEPACVFLSFTR-DNQSVMVEMSGPSDGYVSFAFSHDQWMGDDDAYLCIREDQ--TVDIQSSYL--TGRSYPVMDSRGTLED-----MAWRLADSVIQCSFRRNITLPEAKNRFV---LNESYYIFFAEGPSHDGRIF--RHSQQPLITYEKYNVTDTPKSVGGSRSSPLL-KAHGALMFVAWMTTVSIGVLVARFFRSVWSKAFFLREAAWFQVHRMLMVATSLLTCVAFVLPFVYRGGWSWRAGYHPYLGCTVMTLAVLQPLLATFRPPLHDPRRQVFNWTHWSVGTAARIIAVAAMFLGMDLPGLNLPSPQKTYAMMGFVVWHIGTEVILEIHAYRLSRKVE 543          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Mouse
Match: Frrs1l (ferric-chelate reductase 1 like [Source:MGI Symbol;Acc:MGI:2442704])

HSP 1 Score: 66.6254 bits (161), Expect = 1.974e-11
Identity = 56/193 (29.02%), Postives = 82/193 (42.49%), Query Frame = 1
Query:  616 PNPTGP-LDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKN 1191
            P PT P +DP   I ++ CG TK C  Y     +   C Y +S R+ G +V+FEL     G++A+  S+D  MG D V+ C ++ N     +Q  Y      K     V  N    + G        N + C+F+ P  +  P  E I  DL  S Y   A G      A  +   D P  S   + +Y  ++
Sbjct:   82 PFPTAPPVDPFAKIKVEDCGRTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRV-RIQHFYNVGQWAK----EVQRNPARDEEGVFE----NNRVTCRFKRP--VNVPRDETI-VDLHLSWYYLFAWGPAIQG-AITRHDIDSPPASERVVSIYKYED 261          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. UniProt/SwissProt
Match: sp|Q6ZNA5|FRRS1_HUMAN (Ferric-chelate reductase 1 OS=Homo sapiens OX=9606 GN=FRRS1 PE=2 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 2.785e-34
Identity = 137/550 (24.91%), Postives = 241/550 (43.82%), Query Frame = 1
Query:  172 YPHHDTSYST--MVPQ---SNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINP-VGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITY--NGFNAQTP----LPNPTGPLDPNDSIT----IDGCGTTKNCLLYPLSCYDRR--NCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKA-GKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAKFTSEN 1752
            YP+   + S   M+P+   S  ++P+  + ++  T+R    IE+ +  +    +KG LL  + N ED+  P +G FT  +    +         S ++HRS A K  ++   + APS             +   ++W+ +   I    N F   TP    +P PT P  P   +T       CG  K C+  PL+C   +  +C ++  +R D ++V  E+ GP+KGY++ ALS+D  MGDD   +C +         QT Y    +  +L     P + ++     M +   +  + C FR   I +  VK     DL+ S YIF+A+G       Y  KHS  PLI+     +  +   I    ++    KVHG +M +++M    I +++   F+  +S   L G   WF VH +L     +++   ++     +    + A +H   G + + L+++  L+   RP L   RR  F W H++   A +I      +L      +NL ++ K       + W VG  ++  +  +   RK +   ++
Sbjct:   23 YPNGKVTQSCHGMIPEHGHSPQSVPVHDIYVSQMTFRPGDQIEVTLSGHP---FKGFLLEAR-NAEDLNGPPIGSFTLIDSEVSQLLTCEDIQGSAVSHRS-ASKKTEIKVYWNAPSSAPNHTQFLVTVVEKYKIYWVKIPGPIISQPNAFPFTTPKATVVPLPTLP--PVSHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTR-DDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHED-------QTVYI---QPSHLTGRSHPVMDSRDTLEDMAWRLADGVMQCSFR-RNITLPGVKNRF--DLNTSYYIFLADGAANDGRIY--KHSQQPLITYEKYDVTDSPKNIGGSHSV-LLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFTTTVLTCIAFVMPFIYRGGWSRHAGYHPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPGLNLPDSWKTYAMTGFVAWHVGTEVVLEVHAYRLSRKVEILDDD 548          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. UniProt/SwissProt
Match: sp|Q8MSU3|FRRS1_DROME (Putative ferric-chelate reductase 1 homolog OS=Drosophila melanogaster OX=7227 GN=CG8399 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.133e-31
Identity = 123/544 (22.61%), Postives = 230/544 (42.28%), Query Frame = 1
Query:   88 TLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEI-VIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKRE---ITYNGFNAQTPLP--NPTGP-------------LDPNDSITI------DGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELV---GPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINL 1632
            T  + + I+        +G+P+ VC    P H  S  +++PQ N   P  +  +  T  +  T+ + +  + + + + G ++  + N       +G+F       I+  N    VN+  TH SNA    ++I  +++P    G +  +A  A++   FW+ V  +   I     +A  PLP  +P+ P             + PN+ + +      +GCG +KNC  +P  C   ++C  +    V G   +FE+    G N  Y+A+ LS+D  MGDDL   C   P +   +L +  T +       + V  N+    A  ++    +  + C  R+ R  V+ V+       +   ++ +A+G++    + V  H    L S   I L   ++      +     ++HG  MI +++    + II   +F+  +   +  G   WF  H LL +  + +++A Y+ +    E++      H I G + + L  I  +    RP     +R YF W H+       I G +T   +F ++ L
Sbjct:   16 TALLAVAIWPDPGQSLPQGAPETVCDTMLPFH--SGGSVLPQ-NSVSPFSVETSSSTLGQGQTLRVDLTGVPAGLSFGGYMIQAR-NRNPPHQIIGQFGPARDGTIKLMNCENSVNNSATH-SNAGPKQQVILEWQSPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIVRRDLSAAPPLPTQSPSAPAGTTRAPYVPPSYVAPNNVVAVSSDPIYNGCGQSKNCFGFPDGCVATKSCTSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECV--PENGRVNLYSSLTSASP----YSAVRSNVNQNSARLLDASIVDGVIYC--RVQRDAVTNVQGRTFDLRNGKYHLLVASGSSLKENS-VGYHDIGRLPSAQPINLAEVQD---LSGSSRLLIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAYVLIWV--ELKQAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVT---IFFSVKL 537          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. UniProt/SwissProt
Match: sp|A2VE04|FRRS1_BOVIN (Ferric-chelate reductase 1 OS=Bos taurus OX=9913 GN=FRRS1 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.491e-31
Identity = 139/564 (24.65%), Postives = 232/564 (41.13%), Query Frame = 1
Query:  103 IVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYN------GFNAQTPLPNPTGPLDPN--DSITIDGCGTTKNCLLYPLSC--YDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVC--ANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAKFTSEN 1752
            ++++ S    +  G     C    P H  +     PQS+      ++++ +T+R    I++ +   S   +KG LL  +        PVG FT  + H  +         S ++HRS + K  ++   ++APS     +   A   +   ++W+ +   +              T  P PT P   +   S     CG  K C+  PL+C     R C  +  +R D ++V  E+ GP+KGY+++A S+D  MGDD   VC   +      PS  TG      R + +       F      M +   +  + C FR   I +  VK     DL+ S YIF+A+G        + KHS  PLI+     +      I    +L    KVHG +M +++M    + ++I   F+  +S  L G   WF VH  L L    ++   ++     +      A +H   G + + L+++ +L+   RP L   RR  F W H++   A +I      +L      +NL    K    I  + W VG  II  I  +   RK +   ++
Sbjct:   13 LLLHVSFVANYPSGKVTKSCGGMIPEHGHT-----PQSHPAH--NISVSQKTFRPGDQIKVTL---SGPPFKGFLLEARDAENLSGPPVGSFTLIDSHVSQLLTCEDVQGSAVSHRSPS-KKTEIKVFWDAPSGAPNHITFLATVVEKYKIYWVKIPGPVISQPNVPPFTTPEATIAPMPTVPSVSHLTRSFNASDCGNKKFCIRSPLNCDPEKERACVLLSFTR-DDQSVMVEMSGPSKGYLSVAFSHDRWMGDDDAYVCILEDQIVHIQPSHLTG------RSHPIMD-----FGDPLEDMAWRLVDGVMQCSFRR-NITLPGVKNRF--DLNASYYIFVADGAAV--DGRIHKHSQQPLITYEKYNVTGDPKNIGGSHSL-LLLKVHGALMFVAWMTTVSVGVLIARFFKPVWSKALFGDAAWFQVHRTLMLTTSALTFIAFLLPFIYRGGWNWHAGYHPYLGFIVMVLAVLQLLLAAFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPGLNLPGPWKTYAMIGFVAWHVGTEIILEIHAYRLSRKVEILDDD 547          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. UniProt/SwissProt
Match: sp|Q8K385|FRRS1_MOUSE (Ferric-chelate reductase 1 OS=Mus musculus OX=10090 GN=FRRS1 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 4.545e-30
Identity = 123/536 (22.95%), Postives = 226/536 (42.16%), Query Frame = 1
Query:  190 SYSTMVPQSN---DNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINP-VGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREI-------TYNGFNAQT-PLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRN--CKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSP--TPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQ-LWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAK 1737
            S   M+PQ N    + PI ++T++  T++    IE+ +   S   ++G LL  + + E++  P +G FT  +  + +    + +V       + + K  ++   ++APS     +   A   +   ++W+ +   +        +    A T PL  P          +   CG  K C+  PL+C   +   C ++  +R D ++V  E+ GP+ GY++ A S+D  MGDD   +C     +    PS  TG      R Y V      + +     M +   +  + C FR    L       +   L+ES YIF A G ++    +  +HS  PLI+     +  T   +   ++     K HG +M +++M    I +++   FR  +S     R+  WF VH +L +   L++   ++     +      A +H   G   + L+++  L+   RP L   RR  F W H++   A +I      +L      +NL +  K    +  ++W +G  +I  I  +   RK +
Sbjct:   31 SCGGMIPQHNHSPQSEPIHQITVSQTTFKPGDQIEVTL---SGPPFRGFLLEAR-DAENLSGPPIGSFTLIDSEESQLLTCT-DVQGLAVSHTRSSKKTEIKVYWDAPSPAPDHIRFLATVVQKFKIYWVKIPSPVISQPNAPPFTTPKATTQPLTTPPSVSHLTKPFSAFECGNKKFCVRSPLNCDPEKEPACVFLSFTR-DNQSVMVEMSGPSDGYVSFAFSHDQWMGDDDAYLCIREDQTVDIQPSYLTG------RSYPVMDSRGTLED-----MAWRLADGVIQCSFRRNITLPEAKNRFV---LNESYYIFFAEGPSHDGRIF--RHSQQPLITYEKYNVTDTPKSVGGSRSSPLL-KAHGALMFVAWMTTVSIGVLVARFFRSVWSKAFFLREAAWFQVHRMLMVATSLLTCVAFVLPFVYRGGWSWRAGYHPYLGCTVMTLAVLQPLLATFRPPLHDPRRQVFNWTHWSVGTAARIIAVAAMFLGMDLPGLNLPSPQKTYAMMGFVVWHIGTEVILEIHAYRLSRKVE 543          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. UniProt/SwissProt
Match: sp|Q6INU7|FRRS1_XENLA (Putative ferric-chelate reductase 1 OS=Xenopus laevis OX=8355 GN=frrs1 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.657e-29
Identity = 130/577 (22.53%), Postives = 243/577 (42.11%), Query Frame = 1
Query:   79 MNKTLFIFIVIYTSV---AYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPI-KLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYN--GFNAQTPLPNPTGPLDPNDSITID------GCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPK---DLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLV--FITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAKFTSEN 1752
            MN      I +YT       G+  G     C    P H  +     PQS    PI  + +    ++    I++ +   S   + G L+  +       + VG F+  +    +        NS ++H S   K  ++   + AP+ +   +   A   +   ++W+ +   I       +    +P+ T P+ P  S+++       GCG++K C+  P+SC    N + + +S R DG++V  E+ GP +GYI+ ALS+D  MGDD   +C    +     +   Y   G+    V+++D  +    A ++     +  + C FR  R +  P    IPK   DL  S +IF+A+G+      Y  +H   PL++     +      +   ++     K+HG +M +++M    I +II   F+  + +  L G ++WF +H  L +    +++  ++     +    + A +H   G   + L+++  ++   RP   + RR  F W H+    A +I      +L      ++L +     T I  +LW V   ++     F   +KAK   E+
Sbjct:    1 MNPLGLFLIYLYTCALTPVSGYPNGKVTSACRSMRPDHGHA-----PQSE---PIHSINVEKTIFKPGDRIKVTL---SGSRFDGFLVQARDAENLEGSAVGSFSLTDERISQLLTCDGIQNSAVSHTSKERK-LQVELFWIAPANSPKHIQFLATVVEKYKIYWVKIPGPIISQPKAPSIAPKIPSSTIPVVPPPSLSLHKRFNSAGCGSSKFCIRNPVSCDPEHNPECFFLSFRKDGQSVLVEMSGPGQGYISFALSHDQWMGDDDAYLCVKEDDG--VQINPAYI-RGRSHPEVSSMD--VLRDVAWRLE----DGVIQCSFR--RNIQIP----IPKERFDLGRSYFIFLADGDAKDGLLY--RHHRQPLMTNRKYCITDFPEDVGGSRS-PLIIKLHGAMMFIAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVFLTVVAFVLPFIYRGYFSKRAGYHPHLGVTVMILTVLQPVLAVFRPPPQTHRRGIFNWTHWATGTAARIIAVAAMFLGMDLQALDLPDPWDTYTMIGFVLWHVFVDLLLEAHGFCLLKKAKTMEED 547          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. TrEMBL
Match: A0A1S3KC61 (ferric-chelate reductase 1 OS=Lingula unguis OX=7574 GN=LOC106180693 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.708e-47
Identity = 154/585 (26.32%), Postives = 258/585 (44.10%), Query Frame = 1
Query:   82 NKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYP-HHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVL-YKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLP-NPTGP----LDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILV-------------SPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTEIVIILWTV--GEFIIGGIFW--FLRQRKAKFTSENPRNL 1764
             + L IF  ++    + +  G     C+   P HH T+      Q     P  L++  +TY+     +I IE+ S  + ++G  + +     D    +G FT  +     F  +S  +N CLTH  N  K  K+   ++AP  + G L + A F K    FW N       +   A+ P+  N T P    +D       + CG TK C+ +P  C    +C  +V  + +G ++DFE+ G  + Y+++A S+D  MG D  I C    +     +Q GY P    + +  TV  N+   + G+  +        C+FR P                 +P+K  I  DLS+   +F+  G+ Y  T  V  H + PLI+ + +   ST   + Y Q L    + HGT+M ++++ L   A+++  H+R+ F     G +LWF +H L+ ++    + AG + +        + A  H  FG   +G+ L+ ++M F RPD  + RR  F W H       +I G ++  +  + + L  NL LL E      TV  G ++I  I W   L   K +  + + R +
Sbjct:    8 GRILTIFFGLFLQ-GFSYPNGGILKTCVNLLPKHHGTN------QQTGKAPYTLSVAKDTYKPGE--DIAIELKSQKIPFRGFQIMVHRREGDTEELIGNFTEFSTDSKPFKWYSENIN-CLTHSDNEDK-TKVQFKWKAPGVSEGDLIVRAAFVKDFEHFWAN-----ETHVLRAEVPVVVNETFPWRVSMDFKPMRVREECGVTKGCVKWPRLCQGE-DCDVLVMYKTEGDHIDFEMFGKAEAYLSLAFSDDKKMGKDETITCMYKES--VIQIQHGYNPMYFNERIRNTVLSNVEMMRDGERMY--------CRFRRPLSFTPDLWLSLANKYPPTPIKA-ITFDLSKPWILFLGWGHLYTGTDVVGHHKELPLITSSPVDFQST--AVHYGQTLSVEVQAHGTLMTVAWVALAGFAMVVARHYRNAFGNNCCGIKLWFQIHRLIMILVAGCTAAGIVLIFVYVGDWREVATLHAGFGLAVMGIVLLQMIMAFCRPDPDASRRRVFNWAH-------RIFGKLSHVVAVVALFLGVNLSLLPEKFRFNQTVVLGVWVITQILWEVILEIMKCRREASDKREI 555          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. TrEMBL
Match: A0A267DH51 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025356g2 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.254e-40
Identity = 131/512 (25.59%), Postives = 234/512 (45.70%), Query Frame = 1
Query:   85 KTLFIFIVIYTSV--AYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRF-YNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPNDSIT-IDG-CGTTKNCLLYPLSCYDRRNCKYMVS-SRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIP-----RILVSPVKELIPK-----DLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQ----DAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIH 1560
            + L   +V+ + V  +  F  G+P + C    P H     T  P      P +LT +P+ Y    T+++ +   S   + G  L+ +  ++D    VG F         F Y+ +  + +CLTH  +    +++   + AP R+ G +  +    ++   FW NV   +     +++ P   P  PL   +S   ++G CGT   C+  P  C D  NC+ +V    ++ +N    LV     ++++ LS+D  MGDDL + C         S+Q GY P  +R       + + +     K   L     + C F +P     R  ++P +   P      DL    Y+F+A GNTY  ++ V++H++ P IS + + L S ++G +    +   ++ HG++M+ ++  L P+   + L +R  F       QLWF++H    +  F  SL G + +    + +++    + + HG  G   + L+++ ILMG LRPD  S +R +FK  H
Sbjct:   13 QMLLSAVVLLSGVHLSAAFPDGAPNHRCSNLVPMHGFQPQTSAP------PYELTFSPDRYSPGQTVQVTLRGTSGQSFLGFALAARRVSDDTEELVGGFEVPTGAVGGFWYSQNASLPNCLTH--SGLPQSEITARWTAPPRSVGDVVFTTPVVQSFSTFWSNVTSSVLTAVLSSEDP---PFPPLTIGESPNPLEGACGTEFGCVRSPALC-DTANCEILVKFLYLEAENRLRLLVHAVGNFVSLGLSDDDKMGDDLTLTCTGGQGGY--SMQLGYNPKYRRLN-----ERHRWTPMQNKYIELLDTGRIRCDFTLPWTVNIRTYLNPRQSSEPPVLRSFDLRTPRYVFVAYGNTYRDSSSVQQHTEMPAISTSQVNLQS-RDG-YSAHRISGLRRAHGSLMLTAWQFLMPLGANLALFYRCLFMKSYGNVQLWFHLHRGFMVTGFCASLIGVLLIFAEFDWKWRSMYSNTQSHGAMGLTIVCLTVVQILMGALRPDKDSPKRPWFKIAH 503          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. TrEMBL
Match: A0A2C9JVV9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106070202 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.292e-40
Identity = 138/559 (24.69%), Postives = 241/559 (43.11%), Query Frame = 1
Query:  133 FSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIR-FYNFSREVNSCLTHRSNAFKPN-KMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREI-TYNGFNAQTPLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSR--VDGKNVDFELVGPNK-GYIAMALSNDTIMGDDLVIVC-ANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPR----ILVSPVKELIPK-----DLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGY--IYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAKFTSEN 1752
            +S G+P   C   YP H T+  T  P      P  + ++P  Y+   TI + +       +KG+ ++    T +    +G+F       I+ F       N+ +TH++   KP   +   + AP  N G +       +   +FW+++K ++   N  N                 I    CG TK CLLYP +C    +C   V+     D  N  FEL+  N+  Y+++  S+D +MG D V++C + N N    ++Q G+ PS   +  +T        +   +      +  L C+F +PR    + V+   +++       D SE  Y+ IA G    ++  + KH + P +S   I L   KN IF   +  Y  + H T+MI++++ L  I  +I  H+R      R  G ++WF +H  L +    +++  +  ++     EIR + +  H   G   + L ++ ++ G LRP      RVYF W H      I +   +T +L F       N+K     V+ +W VG+     IF  ++ +  +  S +
Sbjct:   24 YSVGAPSGTCFTRYPKHKTAAQTSAP------PYDIQVSPNQYKAGDTITLTVVSKDGATFKGLQMAAFRATGNDEEILGQFIEFPEDKIKSFTCVGSYKNNMITHKNE--KPAWNVTVKWRAPETNVGDILFKTSLVQVYDLFWVDLKTDLLALNHSNIVESSYKAIKATQLISEINFSECGETKGCLLYPATC-SGTDCVAAVTFHYDTDSGNYQFELMSSNQQDYVSLGFSDDNLMGKDEVVLCISKNGN---LNIQHGWNPSYHYERKLT--------RFLSQAEIRASDGRLQCRFMLPRFSSVVTVNQEADVLEYFNQTFDHSERWYLQIAWGKVIPASDVISKHEESPAVSYQKIDL--KKNEIFTGSSYGYLVQAHATLMIVAWIFLTGIVTVISRHYRDWMPRTRWFGTKVWFQIHRALAIGVVSLTVIAFTCVFSQFGLEIR-KSSVPHSYVGLTVLTLVILQLIFGMLRPGPDDQVRVYFNWGHQVLGQIIHLLAAVTMFLGFNMKQTVYNVKSFGTTVLCVWLVGQLAWHIIFEIIKCKGKRQESSS 559          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. TrEMBL
Match: A0A267GG52 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003117g1 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.026e-38
Identity = 130/512 (25.39%), Postives = 233/512 (45.51%), Query Frame = 1
Query:   85 KTLFIFIVIYTSV--AYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRF-YNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPNDSIT-IDG-CGTTKNCLLYPLSCYDRRNCKYMVS-SRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRIL-----VSPVKELIPK-----DLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQ----DAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIH 1560
            + L   +V+ + V  +  F  G+P + C    P H     T  P      P +LT +P+ Y    T+++ +   S   + G  L+ +  + D    VG F         F Y+ +  + +CLTH       +++   + AP R+ G +  +    ++   FW NV   +     +++ P   P  PL   +S   ++G CGT   C+  P  C D  NC+ +V    ++ +N    LV     ++++ LS+D  MGDDL + C         S+Q GY P  +R       + + +     K   L     + C+F +P  +     ++P +   P      DL    Y+F+A GNTY  ++ V++H++ P IS + + L S ++G +    +   ++ HG++M+ ++  L P+   + L +R  F       QLWF++H    +  F  SL G + +    + +++    + + HG  G   + L+++ ILMG LRPD  S +R +FK  H
Sbjct:   13 QMLLSAVVLLSGVHLSAAFPDGAPNHRCSNLVPMHGFQPQTSAP------PYELTFSPDRYSPGQTVQVTLRGTSGQSFLGFALAARRVSGDTEELVGGFEVPTGAVGGFWYSQNASLPNCLTH--GGLPQSEITARWTAPPRSVGDVVFTTPVVQSFSTFWSNVTSSVLTAVQSSEDP---PFPPLTIGESPNPLEGACGTEFGCVRSPALC-DTANCEILVKFLYLEAENRLRLLVHAVGNFVSLGLSDDDKMGDDLTLTCTGGQGGY--SMQLGYNPKYRRLN-----ERHRWTPMQNKYIELLDTGRIRCEFTLPWTVNISTYLNPRQSSEPPVLRSFDLRTPRYVFVAYGNTYRDSSSVQQHTEMPAISTSQVNLQS-RDG-YSAHRISGLRRAHGSLMLTAWQFLMPLGANLALFYRCLFMKTYGNVQLWFHLHRGFMVTGFCASLIGVLLIFAEFDWKWRSMYSNTQSHGAMGLTIVCLTVVQILMGALRPDKDSPKRPWFKIAH 503          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. TrEMBL
Match: A0A3B3T0U3 (Ferric-chelate reductase 1a OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.076e-38
Identity = 146/556 (26.26%), Postives = 239/556 (42.99%), Query Frame = 1
Query:  133 FSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREI-TYNGFNAQTPLPNPT---GPLDPNDSITIDGCGTTKNCLLYPLSCYDRRN--CKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLIS--LTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTE------IVIILWTVGEFIIGGIFWFLRQRKAKFTSENP 1755
            +  G     C    P+H  + S     SN   P  +T++  T+     I++   + S   + G L+  +  T+   NPVG FT  N    +  N      S ++  S A +  ++  T+ AP      +       ++  +FW+ V  ++ +  G + QTP P  T   G + P    +  GCG+T +CL YP+ C  + +  C Y+ S   +G+ V F+L GP  GY++ ALS D  MG+D V +C  N N     ++     +  R Y      P + N     M +      + C F   R +  P  +    +L+ES YIFIANG        + KH   PL+S  L SI         F         K HG +M+++++ +    II+   F+  + S  L G+++WF VH  L  +  L+S  G+I     ++    DA  H   G + + L+++  +    RP   + RR  F W+HF   +  +I    T   +F+ +  +  L L T         II W     + G +    R+   KF  E+P
Sbjct:   23 YPNGQVTMACASMMPNHGQTAS-----SNSPSPYAVTVDKTTFSPGDKIKVT--LTSSATFMGFLIQARATTQLSGNPVGTFTLLNPSQSQLLNCGSTQGSAVSQTSPA-QLRQIQVTWNAPKAAPSAVQFLVTVVQSFYVFWVKVPSQVASLTGASPQTPAPGMTVTPGSMLPAP-FSAAGCGSTMSCLRYPVGCDPQSDPQCFYL-SFASNGQAVQFQLSGPAPGYVSFALSLDQWMGNDDVYLCVQNGNL----VEISAAYAKGRTYPEPASMPVLSN-----MAWRLSNGVVQCSFL--RNISIPADQ-TRFNLNESYYIFIANGGADFGA--ISKHDLQPLVSNGLKSITGLPEN---FSGSRSSLLIKFHGALMLIAWLTMVTTGIIVARFFKAEWPSNTLFGQKVWFQVHRGLMTLTVLLSCIGFILPFIYRKGWSDDAGAHPYLGCIVLALAILQPVGATCRPHPNAPRRYIFNWLHFGGGITAQILAVAT---IFLGVQ-QQTLLLPTASSNGVLAGIICWAA---LTGLVLEVHRRGLIKFGRESP 544          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Cavefish
Match: frrs1b (ferric chelate reductase 1 [Source:NCBI gene;Acc:103030884])

HSP 1 Score: 152.91 bits (385), Expect = 6.919e-39
Identity = 142/566 (25.09%), Postives = 235/566 (41.52%), Query Frame = 1
Query:   91 LFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVL------YKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPNDS---------------ITIDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFL 1719
            + +FIVI  SV   FS G     C    P H  +       S D  P  LT++  T+R    I++     S VL      +KG L+  +   +     VG FT  N    +  N      S ++H S++ K    +     P     V  L  V  K   ++W+ V   +        +PLP    PL                    IT DGCG TK+CL  P +C  + +   Y +S   +  +V FEL GP  GY++ ALS D  MG+D V +C N  +    S+   Y   G+   ++ +   N+     G++     +  + C+FR  R++  P       +L E+ Y+F+A+G   +   +  +H   PLIS   + +  +   +   ++     K H   M++++M      +II  +F+ N+    L G+++WF  H  L L+  L++  G+I     +    + A  H   G   + L+LI  +M   RP   S RR  F W+H       ++       +V + + +     LL       W+ G  + G + WF+
Sbjct:   11 VVLFIVILRSVVC-FSNGKVSQACGDMVPMHGYT------PSPDPPPGSLTVDKTTFRPGDQIKVTF---SSVLSDKKGHFKGFLIEARNARDPDAGAVGSFTLLNPAISQLLNCGDGEGSAVSHTSDSSKTEVQVMWTAPPDPPPNVQFLVTVVQK-YNLYWVRVPGPVVT--LYGASPLP----PLSTAGQATSKTTTSSGTMPRPITSDGCGITKSCLREPAACDPQNDALCYFLSFAKEDDSVVFELSGPAPGYVSFALSTDKWMGEDDVYLCINEGSQ--VSINAAYV-QGRTHPVIAS--ENVLRDTEGRL----VDGVIQCRFR--RVVRIPAPNQNRSNLDEAHYLFMAHGRAENGRTH--RHDRQPLISSNPVFITGSPEDLTGSRS-PLLIKFHAVFMLIAWMTTVSTGVIIARYFKPNWPDTTLCGQRVWFQFHRALMLVTVLLTGIGFILPFIYRGGWSKRAGSHPYLGCTVMALALIQPIMALFRPAPDSSRRYIFNWLHLGTGTIAQVIA-----VVAVCLGIHQQALLLPAP----WSTG-IVAGYVIWFV 535          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Cavefish
Match: frrs1a (ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-45])

HSP 1 Score: 142.895 bits (359), Expect = 1.643e-35
Identity = 151/607 (24.88%), Postives = 251/607 (41.35%), Query Frame = 1
Query:   70 NDF-MNKTLFIFIVIYTSV-----AYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIIN-PVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKRE-ITYNGF-----------NAQTP----LPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNK-KAGKMNFLNFENALVCKFRIPRILVSPVKELIPKD-----LSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTEIVIILWTVGEF-------IIGGIFWFLRQRK-AKFTSENPRNLAFI 1773
            +DF M +T     V++T++       G+  G  +  C    P H    +T         P  L +  +T++    I++   ++    ++G L+  + +TED     VG FT  +    +         S ++H SN  K  ++   + AP+     +   A        FW+ +    IT +G            +A T     LP P          + DGCG  K+CLL P+ C    +   + +S R +G +V FEL GP  GY++ ALS D  MG+D V +C N+          G   S +  Y      P I +K +   + +   +  + C+FR  R +       IP+D     L+ S Y+FIA+G        + KH   PLIS     +      I          K HG +M+ ++M+L    I +   F+ ++  + L G+++WF VH  L ++  + +  G+I     +    + A  H   G   + L++I  +M F RP   S RR  F W+H       +  G     L  ITI+   + + L  ++   WT G F       I+  +  F+ +R   K  +E P  LA +
Sbjct:   21 SDFQMARTHQAATVLWTALLVSWTVTGYKNGKVEKACDTMVPGHGGHPNTTTS------PYTLNVGTKTFKSGDHIKV--NLSGLQHFEGFLIEAR-DTEDPAGLAVGSFTLISPEISQLLQCHSIKGSAVSHTSNT-KLTEVGVVWTAPADAPPTVHFLATVVAHYSNFWVKIPSPVITQDGVTPNPTTPTTFTSASTETTAVLPQP---------FSSDGCGQEKSCLLDPVHCNPATDTHCFFLSYRTEGSSVQFELSGPAPGYVSFALSEDKWMGNDDVYLCVND----------GGRVSVEAAYATGRTHPEIADKAELSDVGWRVADGVIQCRFR--RAIS------IPEDPQRFSLNHSYYLFIAHGAA--EDGLIHKHKRQPLISAQRQAITGPPE-IATGSRSPLMMKYHGALMLFAWMVLGSTGIFMAGFFKPDWPEKTLFGQRIWFMVHHSLMMLTVIFTFVGFILPFIYRGHWSRGASAHAGLGCTVMSLTVIQPIMAFFRPSPDSSRRWIFNWMH-------RGVGKTAELLAGITISYGMHQQSL--LLPFPWTTGVFVGFIILVILSKVILFVYRRNICKPGAERPDELAIL 578          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Cavefish
Match: wu:fj05g07 (wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307])

HSP 1 Score: 98.2117 bits (243), Expect = 4.279e-21
Identity = 115/513 (22.42%), Postives = 197/513 (38.40%), Query Frame = 1
Query:   91 LFIFIVIYTSV--AYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTR-CNWHDIRFYNFSREVNS-------CLTHRSNAFKPNKMICTYEAP-SRNYGVLALSAVFAKTIGMFWINVKRE-ITYNGFNAQTPLPNPTGPLDPNDSI-TIDGCGTTKNCLLYPLSCYDRRNCK-YMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIK 1584
            + +++V+ + V    G+  G     C    P H  SY     Q+    P  +T N  TY +   I   +  ++D                  +  G F+  C+ H + F   +  V S        ++H S   K +++   ++AP S N   +   A   + +  FW+ VK   ++Y   +  +   +P+     N  I ++ GCG+TK C   P  C    +   Y +SS   G    FE+VGP+ GY+A+  S+DT MG+D + +C  N +S +  LQ  ++         TT   +I       ++       + C F     + +            S YIF+A G T                                 QN        G +M++++M    + ++I  + +      R  G+  WF  HV L ++    ++  +I +    +     A  H + G L + LSL   +    R     +RR  F W H  NA+AIK
Sbjct:    9 MLVWLVLLSCVWAVQGYGNGMVSASCSDMTPKHK-SYVAQTSQA----PFTITANNSTYTDAQEITGTLHYHTD------------------SSAGCFSMICSSHSLPFIFNNTYVGSVVWFQSAAVSHTSAVLK-SQIQSKWKAPASANSKSIEFRATVVQDVSTFWVGVKSSALSYTAPSGGSSTQSPSSSATVNTYIHSLTGCGSTKTCFSNPSDCDPSTDSSCYFMSSTPSGSQHRFEIVGPSSGYVAIGFSDDTEMGNDDIYICGKN-SSGSIQLQHAFSTG-------TTTPTSIDLGSVSDISVSTLNGVISCSFTSANSISTTRSSS----TGSSYYIFLAYGPT---------------------------------QN--------GCLMLIAWMTTGSVGMLIARYLKKTAKGTRCCGKDFWFVAHVFLMILSVAATIIAFILVFSYAKDWAGGA--HPVLGVLVMILSLAQPIAALFRCGPQDERRYIFNWAHSINALAIK 442          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Cavefish
Match: wu:fj05g07 (putative ferric-chelate reductase 1 [Source:NCBI gene;Acc:103033089])

HSP 1 Score: 80.4925 bits (197), Expect = 8.873e-16
Identity = 72/317 (22.71%), Postives = 137/317 (43.22%), Query Frame = 1
Query:  649 SITIDGCGTTKNCLLYPLSCYDRRN--CKYM-VSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYR-LKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKI 1587
            SI+  GCGT K C   P  C    +  C +M V++      +  EL G  +GYI+   S+D  MG+D + +C  + N  T  +Q  ++    R  +V     N+ +  A        +  + C F    I  +P+      + + + ++  A G+T      ++ H     IS + + + + +  I    +     K HG++M++++M    + +I   + +     +    + +WF  HV  +L+ F + +    ++L    I+      H + G L + LSLI  +    R     ++R  F W+H   A+ IK+
Sbjct:   20 SISSAGCGTEKVCFSQPPDCDPAADPSCYFMAVTALPTASGISVELQGRAEGYISFGFSDDQRMGNDDIYICGTDSNG-TVQVQHAFSTGRSRPTIVPL--GNVSDITASMS-----DGVIGCSF----ISRNPISAGGMTEQNSTYFLLYAYGSTID--GLIQFHGTNRFISDSRVDVLNPQ--IVKRAHHPSASKAHGSLMLIAWMTTSSVGMITARYLKAVGKGKGCSSKDVWFLAHV--SLMSFTVIITAIAFILEFAHIKGWAGGVHPVLGCLVMILSLIQPVAAAFRCSPQHEKRFVFNWMHGIMALVIKV 318          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Cavefish
Match: frrs1l (ferric chelate reductase 1 like [Source:NCBI gene;Acc:103029610])

HSP 1 Score: 67.3958 bits (163), Expect = 7.311e-12
Identity = 56/198 (28.28%), Postives = 85/198 (42.93%), Query Frame = 1
Query:  616 PNPTGP-LDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRK----YLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHS-DPPLISLTSIILYSTKN 1191
            P PT P +DP   I +  CG TK C+ Y     D   C Y +S R  G +V+FE+     G++A+  S+D  MG D V+ C ++ N             G+ +    Y V      I    A     +   N + C+F+ P  L  P +E +  DL  S Y   A G     +  + +H  D P +S   I +Y  ++
Sbjct:   68 PFPTAPPVDPFARIKVSDCGITKGCIRYGKPGCDAETCDYFLSFRRIGTDVEFEMSADTDGWVAVGFSSDKKMGGDDVMGCVHDDN-------------GRVRIHHFYNVGQWAKEIKRNPARDEEGIFENNRVTCRFKRP--LHVPREETL-VDLHLSWYYLFAWGPAIQGS--ITRHDIDNPPVSDRMISIYKYED 247          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Nematostella
Match: EDO34476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP71])

HSP 1 Score: 86.6557 bits (213), Expect = 1.209e-17
Identity = 76/340 (22.35%), Postives = 147/340 (43.24%), Query Frame = 1
Query:  616 PNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLV-TTVDPNIFNKK-----AGKMNFLNFENALVCKFRIPRILVSPV-----------KELIPKDLSESLYIFIANGNTYHSTAYVKKHS--------DPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIH 1560
            P P+    P+D IT  GCG TK C+  P +C    +C+Y+++  V+  +V F +   + G+ A+  ++   M D   ++C+    S        Y  +G  K +  T V  N +N       AG   +L    +L     + + L  P            + L   DL++ +Y+  A G    +   +++HS        DP  +++TS+       G    ++L   +  H  +M +++++   +++ +  + R  +   + G + WF VH  L ++  + S+ G +          +    H + G + + L+ I  +M + RP   +D+RV F W H
Sbjct:  342 PQPSA--SPSDKITKVGCGKTKACVSEPKNCRTSSDCQYLMTYTVENDDVIFHM-STSLGWSAIGFNSKPRMDDTDALICSRTATSGDSVGVAHYEITGYGKPVKNTQVYHNTYNSHRLLLIAGVSQYLQ-RPSLAAYAGVSQYLQQPSLAAYCRFSRKKQSLGMMDLNKKVYLIFARGQI-SAQGDLRQHSPREKSYTTDP--VAITSLTDLKVTEG----KDLSLLRG-HAILMSIAWLVCASLSMFVARYMREVWG-EIFGLKAWFQVHRGLMVLTLVFSVVGIVLAFVYAGGWSETKIAHPLIGMIVLALACIQPVMAYFRPKPGTDKRVVFNWAH 668          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Nematostella
Match: EDO34492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP75])

HSP 1 Score: 77.0258 bits (188), Expect = 1.157e-14
Identity = 68/273 (24.91%), Postives = 119/273 (43.59%), Query Frame = 1
Query:  622 PTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGK-NVDFELVGPNKGYIAMALS--NDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPN-IFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNF-SYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKE 1425
            PT P    D +   GCG TK C   P  C D  +CKY+V+ + +G  N++FEL   N  ++A+  S  N  + G D  +VCA                S   K  +   D + +F  + G        ++  CKF      +SP    + + L    ++   +G    S   V+KH+  P+ S + I L  +   I   + +    K HG +M ++++    +AI +  + +  +   ++ G+ +WF VH    ++  L+S  G I +  + E
Sbjct:  325 PTAPAQ-GDKVNTAGCGETKGCYAEPQGCKDHTDCKYLVTYKTNGAGNIEFELTAKND-WVAIGFSYKNKGMDGID-TMVCATVAGKVELHHYALKGYSLPEKTTLNAGDTSLVFGVREG--------DSTRCKFLRK---ISPGTANL-RALDRKWHLVFGDGPVSGS---VQKHTKTPIFSKSKIDLRVSAI-IRETEGISALVKAHGCVMSIAWLAFATVAIFMARYMKSAWKGEKIFGKLIWFQVHRAFMMVVVLLSCVGLILIFLHVE 578          

HSP 2 Score: 62.3882 bits (150), Expect = 3.892e-10
Identity = 36/123 (29.27%), Postives = 64/123 (52.03%), Query Frame = 1
Query:  484 TYEAP-SRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIM--GDDL 843
            T++AP S + G +   A        FW N+K ++             P+ P++P+ +IT  GC TTK+C+  P +C D ++C+Y++   + G N+  E+   NK Y+++  +    M  GDD+
Sbjct:   99 TWKAPVSVSSGNIRFWATIVHDFSTFWSNIKSDL----IRGPAITLRPSVPVEPDFTITKAGCNTTKSCVSIPSNCSDSKDCEYLLVYSISGSNITIEMSARNK-YVSVGFNTVPAMNKGDDV 216          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Nematostella
Match: EDO43912 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX71])

HSP 1 Score: 58.5362 bits (140), Expect = 4.522e-9
Identity = 67/322 (20.81%), Postives = 132/322 (40.99%), Query Frame = 1
Query:  652 ITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDT--IMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNT------YHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFS-YRLKGRQLWFNVH----VLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMA 1578
            I+  GC  TK C+ +P  C    +C Y+V+      +V FE+   +  ++++  + D   ++G D  I+C+   +  +  +   Y  S     + T     +FN  +G+ N       + C F   ++  S +K     DLS   Y+  A G        YHS    K  S   +  L +    S K  +            HG +M+++++    + +    + R  +   ++    +WF +H    V++ L   + ++  ++Y+    EI       H   G   + L+++  ++   RP    D+  +  WI F+NA+ 
Sbjct:   24 ISKSGCKETKGCVSFPYDCKGSSDCNYLVTYVAGKDSVYFEMSAKDD-WVSIGFNQDKAGMVGTD-AIICSRPASGSSILIGHYYLSSKNTPTITTPTPTGLFN-TSGEFN----GGIIRCSFTRNKVPSSNMK----YDLSNKQYLVYARGEVASGILQYHSW---KSSSSNKVDVLATTGAESRKRALLL---------THGALMLIAWVGFATVGMATARYMRTFWGDSKIMSLLVWFQIHRSCMVIVVLSTIISTILVFVYVGGWSEI-----GAHAYIGIAVLVLAVLQPMIAVFRPHPGDDKSHFPNWIWFSNAVG 317          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Medaka
Match: frrs1l (ferric chelate reductase 1 like [Source:NCBI gene;Acc:101166823])

HSP 1 Score: 68.9366 bits (167), Expect = 2.298e-12
Identity = 55/198 (27.78%), Postives = 86/198 (43.43%), Query Frame = 1
Query:  616 PNPTGP-LDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRK----YLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHS-DPPLISLTSIILYSTKN 1191
            P PT P +DP   I +  CG TK C+ Y     D   C+Y +S R  G +V++E+     G++A+  S+D  MG D V+ C ++ N             G+ +    Y V      I    A     +   N + C+F+ P  L  P +E +  DL  S Y   A G     +  + +H  D P +S   I +Y  ++
Sbjct:   73 PFPTAPPVDPFAKIKVSDCGVTKGCIRYGKPGCDAETCEYFLSYRRIGTDVEYEMSADTDGWVAVGFSSDKKMGGDDVMGCVHDDN-------------GRVRIHHFYNVGQWAKEIKRNPARDEEGIFENNRVTCRFKRP--LYVPREETL-VDLHLSWYYLFAWGPAIQGS--ITRHDIDSPPVSDRMISIYKYED 252          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Planmine SMEST
Match: SMESG000005729.1 (SMESG000005729.1)

HSP 1 Score: 1166.37 bits (3016), Expect = 0.000e+0
Identity = 567/576 (98.44%), Postives = 571/576 (99.13%), Query Frame = 1
Query:   79 MNKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKAKFTSENPRNLAFIHHVNNCGLVAY 1806
            MNKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTI MFWINVKREITYNGFNAQTPLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSS+VDG NVDFELVG NKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPK+LSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNL+YFLMSLAGYIY+LCNKEI FQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRK KFTSENPRNLAFIHHVNNCGLVAY
Sbjct:    1 MNKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNLPIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKFTRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALSAVFAKTIDMFWINVKREITYNGFNAQTPLPNPTGPLDPNDSITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSKVDGNNVDFELVGLNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIPKNLSESLYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLLYFLMSLAGYIYILCNKEILFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYITFWLVFITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQRKVKFTSENPRNLAFIHHVNNCGLVAY 576          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Planmine SMEST
Match: SMESG000061404.1 (SMESG000061404.1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.844e-17
Identity = 100/391 (25.58%), Postives = 159/391 (40.66%), Query Frame = 1
Query:  649 SITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSRVDGKN----VDFELVG---PNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKR-----------KYLVTTVDPNIFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIP-KDLSES--LYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTK-NGIFYLQNLEY-YKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYF----------LMSLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHF------------TNAMAIKISG------YITF--WLVFITINLRNNLKLLTEI 1662
             ++   C  +K C     +C + + C Y+V+ +    N    ++ E+ G      GYIA+  S D +MGDD V+ C  +P +   ++  GY    KR           K  + T  PN         NF      L C+F     LV+P K     KDLS+    Y+ IA G+        K      ++S TSI   S   N +     +     K HG IMI+++M    IA+ I  +++  ++        WFN H  L    F          ++ + GY       ++    +K H IFG + I L LIN  +   R  +    R  F WIHF            T  + +K+ G      ++ F  W++FI +  +  L+++ EI
Sbjct:   19 QVSFQKCAVSKACFKSTKACSEDQ-CDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTTGPNYGG------NFNRDIRRLSCRF---LRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFVLIVIALIIIIVHVGGY------SKLMEYPSKLHPIFGFIVIILFLINPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEI 393          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Planmine SMEST
Match: SMESG000021389.1 (SMESG000021389.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.340e-10
Identity = 78/346 (22.54%), Postives = 140/346 (40.46%), Query Frame = 1
Query:  637 DPNDSITIDGCGTTKNCLLYPLSC-YDRRNCKYMVS----SRVDGKNVDFELVGP---NKGYIAMALSNDTIMGDDLVIVC---ANNPNSPTPSLQTGYTPSGKRKYL--VTTVDPNIFNKKAGKMNFLNFENALVCKF---RIPRILVSPVKELIPKDLSESLYIFIANGN----------TYHSTAYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQL-WFNVH-------VLLNLIYFLM---SLAGYIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHF 1563
            D  +S++   C + K C      C YD  +C + +S    S ++   ++FE+VG    +  Y+ +  S+DT +G+D  + C   +          + G TP    K+   V+ +  N   +  G  N       L C+F     P+   +  K+L    L    Y+F A GN          T  S  + K   D    S   +I  S++           + K HG +M+++++    + +I+  +++  + Y    +++ WF  H       VLL  + F++   S+ GY       ++       H I G +   L+ +N L+   R    S  R +F W HF
Sbjct:   16 DALESMSFQTCESEKACFKSSKYCTYD--SCDFAISWKPFSYMNNDYIEFEMVGTVFGDNSYMLVGFSDDTSLGNDGFVSCHVESKKVKVVAGFYEVGDTPESNIKFSNDVSLLVANSDKRYGGVYN--EDTKRLTCRFLRQTRPQNANNQYKDL---SLGNEYYLFTARGNEASQYGYGPPTAGSLIFSKHPIDFSRGSFHGVIGESSRVD-------SSFAKTHGILMVIAWVFCSSVGVILARYYKEMWPYTGIAKEMVWFQFHRSLQGTCVLLTTVAFILIFASVGGY------SKLDRSPYVAHPILGIIVFILAFLNPLVALCRCRPNSKDRPWFNWFHF 341          
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Planmine SMEST
Match: SMESG000042103.1 (SMESG000042103.1)

HSP 1 Score: 62.003 bits (149), Expect = 7.271e-10
Identity = 84/340 (24.71%), Postives = 141/340 (41.47%), Query Frame = 1
Query:  667 CGTTKNCLLYPLSCYDRRNCKYMVSSRV----DGKNVDFELVG---PNKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLV---TTVDPNIFNKKAGKMNFLNFE---NALVCKFRIPRILVSPVKELIP-KDLSESLY-------IFIANGNTYHST--AYVKKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLK--GRQLWFNVHVLLNLIYFLMSLAG----YIYMLCNKEIRFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMAIKISGYI 1599
            CG +K+CL +  SC    NC+Y  S ++      K ++ EL+G    +  Y+A+  S    M D+ V+ C    +  T  +  GY  +G  K+      ++D N F K+   +    +    N L C+F     LV P   +I  KDLS + Y        F+ +  TYHS    Y +   +  L  + S+I           +N     K H  +MI  ++      III  +F  N+  +    G ++WF +H L+  I  +   +G    +IY+     +       H + G +A G  L N +M   R       R  F  +H    + + ++ Y+
Sbjct:   28 CGKSKSCLTWS-SCI-WPNCEYAFSWKIKTFNSTKYLEIELIGRLTSSDAYLALGFSTVPKMKDNAVVACYKETD--TTGILAGY--NGDHKFYSLNDDSLDSNFFVKQMDDLYGAQYNATINVLQCRFLR---LVQPTINVIKLKDLSVTKYYLLSAKSAFLKHNLTYHSENKRYSQYSYNLTLDWVNSVI-----------RNSNLLVKFHACLMIFGWVFCSTNGIIIA-NFYKNYWSKTSWFGEKVWFQLHRLIQTICVICVSSGFIIIFIYVGGYSALSSLPYSAHPVMGIVATGFMLSNPIMALFRCAPNHPSRKIFNRLH----LLVGVTAYV 342          
The following BLAST results are available for this feature:
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FRRS15.799e-3524.91ferric chelate reductase 1 [Source:HGNC Symbol;Acc... [more]
FRRS11.349e-3425.14ferric chelate reductase 1 [Source:HGNC Symbol;Acc... [more]
FRRS1L9.687e-1228.87ferric chelate reductase 1 like [Source:HGNC Symbo... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C05D12.11.119e-922.53pep chromosome:WBcel235:II:11412232:11415820:-1 ge... [more]
C05D12.11.119e-922.53pep chromosome:WBcel235:II:11412253:11415729:-1 ge... [more]
C05D12.11.119e-922.53pep chromosome:WBcel235:II:11412253:11415772:-1 ge... [more]
C13B4.19.512e-824.64pep chromosome:WBcel235:II:14470523:14479627:-1 ge... [more]
C13B4.19.512e-824.64pep chromosome:WBcel235:II:14470383:14479627:-1 ge... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG83991.405e-3222.61gene:FBgn0034067 transcript:FBtr0340018[more]
CG83992.128e-3222.61gene:FBgn0034067 transcript:FBtr0087207[more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frrs1a2.646e-3524.41ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-G... [more]
frrs1a5.788e-3423.63ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-G... [more]
wu:fj05g074.650e-2824.12wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307][more]
frrs1b9.948e-2820.69ferric-chelate reductase 1b [Source:ZFIN;Acc:ZDB-G... [more]
frrs1l4.961e-1227.78ferric-chelate reductase 1-like [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000052073.14.148e-3025.10putative ferric-chelate reductase 1 [Source:NCBI g... [more]
FRRS16.943e-2722.51ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
FRRS11.309e-2622.55ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
FRRS11.333e-2622.55ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
FRRS13.053e-2622.55ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Frrs12.188e-3022.66ferric-chelate reductase 1 [Source:MGI Symbol;Acc:... [more]
Frrs12.188e-3022.66ferric-chelate reductase 1 [Source:MGI Symbol;Acc:... [more]
Frrs1l1.974e-1129.02ferric-chelate reductase 1 like [Source:MGI Symbol... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZNA5|FRRS1_HUMAN2.785e-3424.91Ferric-chelate reductase 1 OS=Homo sapiens OX=9606... [more]
sp|Q8MSU3|FRRS1_DROME2.133e-3122.61Putative ferric-chelate reductase 1 homolog OS=Dro... [more]
sp|A2VE04|FRRS1_BOVIN2.491e-3124.65Ferric-chelate reductase 1 OS=Bos taurus OX=9913 G... [more]
sp|Q8K385|FRRS1_MOUSE4.545e-3022.95Ferric-chelate reductase 1 OS=Mus musculus OX=1009... [more]
sp|Q6INU7|FRRS1_XENLA2.657e-2922.53Putative ferric-chelate reductase 1 OS=Xenopus lae... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KC611.708e-4726.32ferric-chelate reductase 1 OS=Lingula unguis OX=75... [more]
A0A267DH512.254e-4025.59Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9JVV94.292e-4024.69Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A267GG521.026e-3825.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3B3T0U31.076e-3826.26Ferric-chelate reductase 1a OS=Paramormyrops kings... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frrs1b6.919e-3925.09ferric chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
frrs1a1.643e-3524.88ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-G... [more]
wu:fj05g074.279e-2122.42wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307][more]
wu:fj05g078.873e-1622.71putative ferric-chelate reductase 1 [Source:NCBI g... [more]
frrs1l7.311e-1228.28ferric chelate reductase 1 like [Source:NCBI gene;... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO344761.209e-1722.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344921.157e-1424.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439124.522e-920.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
frrs1l2.298e-1227.78ferric chelate reductase 1 like [Source:NCBI gene;... [more]
back to top
BLAST of Blast:Putative ferric-chelate reductase 1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000005729.10.000e+098.44SMESG000005729.1[more]
SMESG000061404.13.844e-1725.58SMESG000061404.1[more]
SMESG000021389.11.340e-1022.54SMESG000021389.1[more]
SMESG000042103.17.271e-1024.71SMESG000042103.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033204 ID=SMED30033204|Name=Blast:Putative ferric-chelate reductase 1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1958bp
AAATGAAATCGACAAACATTGACCTCGATTTATAGTTTCACTTTTAATGA
TGTTACATTATTTCAAATAAACGATTTCATGAATAAAACTTTATTCATTT
TCATTGTGATTTATACATCTGTTGCTTATGGATTTTCCAAGGGTTCACCC
CAATACGTCTGTCTTGTCCCTTATCCCCACCACGATACAAGCTATTCTAC
GATGGTTCCTCAGTCTAATGATAATTTGCCTATTAAATTAACAATAAATC
CAGAAACGTACCGAGAAAATTCTACAATAGAAATTGTTATTGAAATGAAT
TCAGATGTTTTATATAAAGGGATTTTGCTATCCATAAAACCAAATACCGA
AGACATCATAAATCCGGTGGGAAAATTCACGCGGTGTAATTGGCATGACA
TTCGATTCTATAACTTCAGTAGAGAAGTCAACTCATGCTTGACTCACAGG
AGTAATGCTTTTAAGCCAAACAAAATGATATGCACTTATGAAGCCCCTTC
AAGAAATTATGGGGTACTAGCACTGTCTGCAGTATTCGCTAAAACTATTG
GCATGTTTTGGATAAATGTGAAAAGAGAAATAACATACAATGGATTCAAT
GCTCAAACCCCTTTACCAAATCCAACTGGTCCATTAGACCCAAACGACAG
TATAACAATTGATGGATGCGGAACAACAAAGAACTGCCTGCTTTATCCTC
TGTCTTGTTACGATAGACGAAACTGCAAGTACATGGTATCATCAAGGGTT
GACGGAAAAAATGTGGATTTTGAGCTGGTTGGTCCTAATAAAGGTTATAT
TGCAATGGCTTTGTCAAATGATACAATAATGGGAGACGATTTAGTCATTG
TTTGCGCAAACAATCCTAATTCCCCAACTCCATCCTTGCAAACTGGATAC
ACTCCGAGTGGCAAACGGAAATATCTCGTCACAACTGTTGATCCAAATAT
TTTCAATAAAAAAGCAGGAAAAATGAACTTTTTAAACTTTGAGAATGCAT
TGGTTTGCAAATTCCGAATTCCGAGGATTTTAGTTAGTCCAGTCAAGGAA
CTGATTCCAAAGGATTTATCCGAGTCCTTGTATATATTTATTGCTAACGG
AAATACATATCATAGCACTGCCTATGTTAAGAAGCACAGTGATCCTCCTC
TGATATCGTTAACATCAATTATTCTATATTCAACTAAAAATGGCATTTTC
TATTTACAAAATCTCGAATATTATAAAAAAGTTCATGGAACTATTATGAT
ATTAAGCTTCATGATACTGCAACCAATTGCTATCATTATTGTCTTGCATT
TTAGACATAATTTTTCATACAGGTTGAAAGGGCGGCAACTCTGGTTTAAT
GTTCACGTTCTTTTGAATTTAATTTATTTTTTGATGTCATTAGCTGGTTA
TATTTATATGTTGTGCAATAAAGAAATCCGTTTTCAGGACGCAAAATTCC
ATGGAATTTTCGGAACGCTGGCTATAGGACTTTCTTTGATTAATATCTTA
ATGGGCTTTCTCAGACCAGATTTGACTAGTGACAGAAGAGTGTATTTCAA
ATGGATCCATTTCACAAATGCCATGGCAATAAAAATATCTGGATATATTA
CATTTTGGCTAGTTTTCATAACAATTAACCTAAGAAATAATTTGAAATTG
TTGACGGAAATTGTAATAATCTTATGGACCGTCGGCGAATTCATTATTGG
AGGAATCTTTTGGTTTTTACGTCAAAGAAAAGCAAAATTCACTAGCGAAA
ATCCCCGAAATTTAGCCTTTATCCACCATGTCAACAATTGTGGCCTCGTA
GCTTATATTTCTTTTCTTTCCATAATGTCTTCATTATTAATTGTGGGGCT
CTGGATTCTGTGAATTATATTGATATTGTGGCGTCATTTTCATGGATAAG
TTATATTATTTAAAATTAAACTTTTTTCGTCTTTTCGCATGCATTTTTTA
TATTTTAC
back to top

protein sequence of SMED30033204-orf-1

>SMED30033204-orf-1 ID=SMED30033204-orf-1|Name=SMED30033204-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=595bp
MNKTLFIFIVIYTSVAYGFSKGSPQYVCLVPYPHHDTSYSTMVPQSNDNL
PIKLTINPETYRENSTIEIVIEMNSDVLYKGILLSIKPNTEDIINPVGKF
TRCNWHDIRFYNFSREVNSCLTHRSNAFKPNKMICTYEAPSRNYGVLALS
AVFAKTIGMFWINVKREITYNGFNAQTPLPNPTGPLDPNDSITIDGCGTT
KNCLLYPLSCYDRRNCKYMVSSRVDGKNVDFELVGPNKGYIAMALSNDTI
MGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTTVDPNIFNKKAGKMN
FLNFENALVCKFRIPRILVSPVKELIPKDLSESLYIFIANGNTYHSTAYV
KKHSDPPLISLTSIILYSTKNGIFYLQNLEYYKKVHGTIMILSFMILQPI
AIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLIYFLMSLAGYIYMLCNKEI
RFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHFTNAMA
IKISGYITFWLVFITINLRNNLKLLTEIVIILWTVGEFIIGGIFWFLRQR
KAKFTSENPRNLAFIHHVNNCGLVAYISFLSIMSSLLIVGLWIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002861Reeler_dom
IPR006593Cyt_b561/ferric_Rdtase_TM
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006593Cytochrome b561/ferric reductase transmembraneSMARTSM00665561_7coord: 385..513
e-value: 1.2E-7
score: 41.5
IPR006593Cytochrome b561/ferric reductase transmembranePFAMPF03188Cytochrom_B561coord: 385..509
e-value: 2.9E-6
score: 27.5
IPR006593Cytochrome b561/ferric reductase transmembranePROSITEPS50939CYTOCHROME_B561coord: 350..550
score: 18.899
IPR002861Reeler domainPFAMPF02014Reelercoord: 33..162
e-value: 9.8E-9
score: 36.0
NoneNo IPR availablePANTHERPTHR45828FAMILY NOT NAMEDcoord: 6..559
NoneNo IPR availablePANTHERPTHR45828:SF3FERRIC-CHELATE REDUCTASE 1coord: 6..559
NoneNo IPR availableCDDcd08760Cyt_b561_FRRS1_likecoord: 382..516
e-value: 5.19195E-20
score: 86.2446
NoneNo IPR availableCDDcd09628DOMON_SDR_2_likecoord: 191..366
e-value: 8.30209E-30
score: 113.292
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.665
NoneNo IPR availableTMHMMTMhelixcoord: 524..546
NoneNo IPR availableTMHMMTMhelixcoord: 492..514
NoneNo IPR availableTMHMMTMhelixcoord: 386..408
NoneNo IPR availableTMHMMTMhelixcoord: 421..443
NoneNo IPR availableTMHMMTMhelixcoord: 458..480
NoneNo IPR availableTMHMMTMhelixcoord: 571..593