SMED30033198
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30033198 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Alignments
SMED30033198 aligns in the following genomic locations:
Homology
BLAST of SMED30033198 vs. Planmine SMEST
Match: SMESG000066474.1 (SMESG000066474.1) HSP 1 Score: 47.7506 bits (112), Expect = 3.019e-11 Identity = 20/37 (54.05%), Postives = 27/37 (72.97%), Query Frame = 1 Query: 214 SYVDKLKLVFRKPMNLMEEISEALKNRQGEDSVYNFC 324 +Y+D+LK F+KPMN M ++ EA+K RQG DS FC Sbjct: 78 NYLDRLKETFKKPMNFMGDLQEAVKYRQGNDSANEFC 114 HSP 2 Score: 36.1946 bits (82), Expect = 3.019e-11 Identity = 19/43 (44.19%), Postives = 26/43 (60.47%), Query Frame = 2 Query: 26 MDVVNLQ----NQTTTIVKFFKASENLKMRADIEGFVEEAEIF 142 MDV+N + N TT+ F K EN ++ ADIE F++E E F Sbjct: 1 MDVINTKSNASNMATTLANFIKPPENYEIGADIEDFIQEFERF 43
BLAST of SMED30033198 vs. Planmine SMEST
Match: SMESG000063281.1 (SMESG000063281.1) HSP 1 Score: 47.7506 bits (112), Expect = 2.469e-8 Identity = 23/49 (46.94%), Postives = 34/49 (69.39%), Query Frame = 1 Query: 178 VINKYGNIKK*QSYVDKLKLVFRKPMNLMEEISEALKNRQGEDSVYNFC 324 V KY + +K +Y+++LK VF+KPM M+++ EALK R+G D V FC Sbjct: 20 VAKKYESTRKDINYLNRLKDVFKKPMKFMDDLQEALKYRKGNDLVNEFC 68
BLAST of SMED30033198 vs. Planmine SMEST
Match: SMESG000023258.1 (SMESG000023258.1) HSP 1 Score: 35.8094 bits (81), Expect = 1.102e-6 Identity = 22/54 (40.74%), Postives = 28/54 (51.85%), Query Frame = 2 Query: 2 GSYYYL---LVMDVVN----LQNQTTTIVKFFKASENLKMRADIEGFVEEAEIF 142 G+ YY LVMD +N + N TTI F K E M +D+E F+ E E F Sbjct: 1026 GTGYYRFSGLVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERF 1079 HSP 2 Score: 31.9574 bits (71), Expect = 1.102e-6 Identity = 13/36 (36.11%), Postives = 24/36 (66.67%), Query Frame = 1 Query: 217 YVDKLKLVFRKPMNLMEEISEALKNRQGEDSVYNFC 324 Y ++L+ F K +L+++++EAL RQG ++ FC Sbjct: 1115 YTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFC 1150
BLAST of SMED30033198 vs. Planmine SMEST
Match: SMESG000023258.1 (SMESG000023258.1) HSP 1 Score: 35.8094 bits (81), Expect = 1.119e-6 Identity = 22/54 (40.74%), Postives = 28/54 (51.85%), Query Frame = 2 Query: 2 GSYYYL---LVMDVVN----LQNQTTTIVKFFKASENLKMRADIEGFVEEAEIF 142 G+ YY LVMD +N + N TTI F K E M +D+E F+ E E F Sbjct: 1034 GTGYYRFSGLVMDSINTRSSVANMATTIANFIKPPETYDMDSDVEDFILETERF 1087 HSP 2 Score: 31.9574 bits (71), Expect = 1.119e-6 Identity = 13/36 (36.11%), Postives = 24/36 (66.67%), Query Frame = 1 Query: 217 YVDKLKLVFRKPMNLMEEISEALKNRQGEDSVYNFC 324 Y ++L+ F K +L+++++EAL RQG ++ FC Sbjct: 1123 YTERLRNAFSKNRSLIDDLNEALNYRQGNEAAEEFC 1158
BLAST of SMED30033198 vs. Planmine SMEST
Match: SMESG000021279.1 (SMESG000021279.1) HSP 1 Score: 44.2838 bits (103), Expect = 1.532e-6 Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 1 Query: 178 VINKYGNIKK*QSYVDKLKLVFRKPMNLMEEISEALKNRQGEDSVYNFC 324 INKY + +Y+D LK F+KP+N M++ EALK Q DS FC Sbjct: 32 AINKYEATSENSNYLDCLKEAFKKPLNFMDDFQEALKYYQRNDSANEFC 80 The following BLAST results are available for this feature:
BLAST of SMED30033198 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30033198 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30033198 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30033198 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30033198 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30033198 ID=SMED30033198|Name=SMED30033198|organism=Schmidtea mediterranea sexual|type=transcript|length=327bpback to top Annotated Terms
The following terms have been associated with this transcript:
|