Crooked neck pre-mRNA splicing factor 1

Overview
NameCrooked neck pre-mRNA splicing factor 1
Smed IDSMED30033191
Length (bp)2100
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Crooked neck pre-mRNA splicing factor 1 (SMED30033191) t-SNE clustered cells

Violin plots show distribution of expression levels for Crooked neck pre-mRNA splicing factor 1 (SMED30033191) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Crooked neck pre-mRNA splicing factor 1 (SMED30033191) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Crooked neck pre-mRNA splicing factor 1 (SMED30033191) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033191

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033191SMESG000006174.1 SmedASXL_011819SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033191SMESG000006174.1 SmedASXL_011819SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30033191SMESG000006174.1 dd_Smed_v4_4749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033191SMESG000006174.1 dd_Smed_v4_4749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033191SMESG000006174.1 dd_Smed_v4_4749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30033191SMESG000006174.1 dd_Smed_v4_4749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Human
Match: CRNKL1 (crooked neck pre-mRNA splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:15762])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 308/648 (47.53%), Postives = 447/648 (68.98%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PPQQKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+  AR++F+RWM W+P EQAWHS+IN E +Y E+++A  IY++FV VHPD KNWIK+A+FEE +   + AR V   A+ F+G ++   H+   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + +  + +RE+YERAIAN P I++K +W+RYIYLWI YA++EEL   + +R  +VY   L   PH+KFTFAK+WI  A+  IRQK+L+ AR+ LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P    +WI+FA  E  L   +R R IYE A+ +  LD P  +WKSYIDFE + +E E    L+RR+L++ +H  +W S+AQ +L              L + R+I+EEANK+++   E  +R MLL+ W+ FE+++GT    E V   +P+ + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:  180 KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAE-AEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGS-------LTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLL 819          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Human
Match: CRNKL1 (crooked neck pre-mRNA splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:15762])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 308/648 (47.53%), Postives = 447/648 (68.98%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PPQQKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+  AR++F+RWM W+P EQAWHS+IN E +Y E+++A  IY++FV VHPD KNWIK+A+FEE +   + AR V   A+ F+G ++   H+   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + +  + +RE+YERAIAN P I++K +W+RYIYLWI YA++EEL   + +R  +VY   L   PH+KFTFAK+WI  A+  IRQK+L+ AR+ LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P    +WI+FA  E  L   +R R IYE A+ +  LD P  +WKSYIDFE + +E E    L+RR+L++ +H  +W S+AQ +L              L + R+I+EEANK+++   E  +R MLL+ W+ FE+++GT    E V   +P+ + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:  168 KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAE-AEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGS-------LTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLL 807          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Human
Match: CRNKL1 (crooked neck pre-mRNA splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:15762])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 308/648 (47.53%), Postives = 447/648 (68.98%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PPQQKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+  AR++F+RWM W+P EQAWHS+IN E +Y E+++A  IY++FV VHPD KNWIK+A+FEE +   + AR V   A+ F+G ++   H+   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + +  + +RE+YERAIAN P I++K +W+RYIYLWI YA++EEL   + +R  +VY   L   PH+KFTFAK+WI  A+  IRQK+L+ AR+ LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P    +WI+FA  E  L   +R R IYE A+ +  LD P  +WKSYIDFE + +E E    L+RR+L++ +H  +W S+AQ +L              L + R+I+EEANK+++   E  +R MLL+ W+ FE+++GT    E V   +P+ + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:   19 KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAE-AEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGS-------LTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLL 658          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Human
Match: PRPF6 (pre-mRNA processing factor 6 [Source:HGNC Symbol;Acc:HGNC:15860])

HSP 1 Score: 60.077 bits (144), Expect = 1.253e-8
Identity = 85/439 (19.36%), Postives = 166/439 (37.81%), Query Frame = 1
Query:  325 ARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWM------AWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKN----WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCG-KNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAK 1608
            AR +  RA+      V +WL  A +E      ++AR +  +A   +P    +W     +EE   N     KI  R +        E   + W        + G +    A+ +  + +  +E++    W++ A     +N    AR++   AL  + S      +    A FE+     E ++ + + A+ + PK  +E ++    + +   GD    +  + +  Q         N +  + W + +K +E EN   +  R +  +A ++ P                  ++  E    NI  A ++  + L H       F K+W+ K +I  +++ +  AR+     + +C     L+    ++E  + +  R R +  K  +  P     W+E    EYR         +   AL+ E      +W   I  EA+
Sbjct:  419 ARIMLSRAVECCPTSVELWLALARLE----TYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKK---SVWLRAAYFEKNHGTRESLEALLQRAVAHCPK--AEVLWLMGAKSKWLAGDVPAARSILALAFQ--------ANPNSEEIWLAAVK-LESENDEYERARRLLAKARSSAP-----------TARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED----FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQ-ECPNSGILWSEAIFLEAR 823          

HSP 2 Score: 60.077 bits (144), Expect = 1.487e-8
Identity = 75/335 (22.39%), Postives = 135/335 (40.30%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIW 1275
             WM+ A   ++ N +  AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K     P  + ++K  K E   +    A+ +   AL  Y  D P   ++K   + EE++   E+ +E Y   L   P   S  ++      E+K G ++T    I+       EK   +N  +   W   +++  E    + +        IAN  L+ K         +    AIF E       ++++   +C  H PH     AK++
Sbjct:  542 TWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHY-EDFPKLWMMK--GQIEEQKEMMEKAREAYNQGLKKCPH--STPLWLLLSRLEEKIG-QLTRARAIL-------EKSRLKNPKNPGLWLESVRL--EYRAGLKN--------IANT-LMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKC-EHDPHVLLAVAKLF 851          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Human
Match: XAB2 (XPA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:14089])

HSP 1 Score: 56.225 bits (134), Expect = 2.113e-7
Identity = 74/347 (21.33%), Postives = 140/347 (40.35%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYG----SDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLS--ENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTC--GNIDRAIEVYSQCL-LHTPHRKFTFAKIW 1275
            W+ +A F     ++  AR + E+A  +++K+V    S+W +  E+EL+ +    A  L  +A  +  R  +    Y    E ++N     +++K         + W    +LE+  G  +   A+Y + + +     +  I +A F E +     +       +  +     SD    ++ K  A++  R+ E  R +++++ ALD  P   ++ +Y  Y + E+++G        +       YE+     E    YD +  YIK   E    +   R IY++AI                +       F ++ C  G IDRA  +YS C  +  P     F + W
Sbjct:  398 WVAFAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAE----YFDGSEPVQN-----RVYKSL-------KVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLE--RARDLFEQALDGCPPKYAKTLYLLYAQLEEEWG--------LARHAMAVYERATRAVEPAQQYDMFNIYIKRAAE-IYGVTHTRGIYQKAI----------EVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTW 707          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Celegans
Match: M03F8.3 (pep chromosome:WBcel235:V:5940024:5943362:1 gene:WBGene00019762.1 transcript:M03F8.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M03F8.3)

HSP 1 Score: 530.406 bits (1365), Expect = 1.221e-179
Identity = 291/633 (45.97%), Postives = 428/633 (67.61%), Query Frame = 1
Query:  103 VQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHP-DEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQ--LLDFDTEEEERFPEVLARSREIFEEANKSLKKMESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDD 1986
            +QIT+EQLLREAKERELE  P  P+ KI+   E KEYQ +KR+++E+ IRK+++++ NW+KY  +E S  EI RAR+VFERA+++ ++ +SIWL+YAEME++CKQ+ HARN+++RA+ I+PRA Q W KY YMEE ++NI  AR+IF+RW+ WEPPEQAW ++IN E +Y EI++A ++Y++F+ VH  + +NWIK+AKFEE N     AR+    A+ ++G ++    +L  FA FEERQ+EHER + I+KY LDNLP   +E+I++ Y ++EKKFG+++ I++ I+ KR+  YEK++ EN ++YD WF Y++++E E  + +++ ++YERAIAN P   +K YWRRYIYLWI YA++EEL   + DRA +VY  C+   PH+ FTFAK+WI  A   IRQ DL  ARK +G AIG+C K+KL+R YI +E  L EFDR R LY KF+   P   Q WI+FA  E  L   +R R ++  A+ +  LD P  +WK+YIDFE   +E E    L+  +L++  H  +W S A+ +  + +F+             +R+ FE AN+SL+  E  +R MLL+ WK+ E   G  E+++ V   +P+ + +R++I  EDG+   W E     FP D
Sbjct:   31 LQITAEQLLREAKERELELIPPAPKTKITDPDELKEYQRKKRKEFEDGIRKNRMQLANWIKYGKWEESIGEIQRARSVFERALDVDHRSISIWLQYAEMEMRCKQINHARNVFDRAITIMPRAMQFWLKYSYMEEVIENIPGARQIFERWIEWEPPEQAWQTYINFELRYKEIDRARSVYQRFLHVHGINVQNWIKYAKFEERNGYIGNARAAYEKAMEYFGEEDINETVLVAFALFEERQKEHERARGIFKYGLDNLPSNRTEEIFKHYTQHEKKFGERVGIEDVIISKRKTQYEKMVEENGYNYDAWFDYLRLLENEETDREEVEDVYERAIANIPPHSEKRYWRRYIYLWINYALYEELVAKDFDRARQVYKACIDIIPHKTFTFAKVWIMFAHFEIRQLDLNAARKIMGVAIGKCPKDKLFRAYIDLELQLREFDRCRKLYEKFLESSPESSQTWIKFAELETLLGDTDRSRAVFTIAVQQPALDMPELLWKAYIDFEIACEEHEKARDLYETLLQRTNHIKVWISMAEFEQTIGNFEG------------ARKAFERANQSLENAEKEERLMLLEAWKECETKSGDQEALKRVETMMPRRVKKRRQIQTEDGVDAGWEEYFDYIFPQD 651          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Celegans
Match: M03F8.3 (pep chromosome:WBcel235:V:5940024:5943362:1 gene:WBGene00019762.1 transcript:M03F8.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M03F8.3)

HSP 1 Score: 526.939 bits (1356), Expect = 2.729e-178
Identity = 291/634 (45.90%), Postives = 427/634 (67.35%), Query Frame = 1
Query:  103 VQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHP-DEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKP---LIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKMESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDD 1986
            +QIT+EQLLREAKERELE  P  P+ KI+   E KEYQ +KR+++E+ IRK+++++ NW+KY  +E S  EI RAR+VFERA+++ ++ +SIWL+YAEME++CKQ+ HARN+++RA+ I+PRA Q W KY YMEE ++NI  AR+IF+RW+ WEPPEQAW ++IN E +Y EI++A ++Y++F+ VH  + +NWIK+AKFEE N     AR+    A+ ++G ++    +L  FA FEERQ+EHER + I+KY LDNLP   +E+I++ Y ++EKKFG+++ I++ I+ KR+  YEK++ EN ++YD WF Y++++E E  + +++ ++YERAIAN P     ++K YWRRYIYLWI YA++EEL   + DRA +VY  C+   PH+ FTFAK+WI  A   IRQ DL  ARK +G AIG+C K+KL+R YI +E  L EFDR R LY KF+   P   Q WI+FA  E  L   +R R ++  A+ +  LD P  +WK+YIDFE   +E E    L+  +L++  H  +W S A+ +    + E           +R+ FE AN+SL+  E  +R MLL+ WK+ E   G  E+++ V   +P+ + +R++I  EDG+   W E     FP D
Sbjct:   31 LQITAEQLLREAKERELELIPPAPKTKITDPDELKEYQRKKRKEFEDGIRKNRMQLANWIKYGKWEESIGEIQRARSVFERALDVDHRSISIWLQYAEMEMRCKQINHARNVFDRAITIMPRAMQFWLKYSYMEEVIENIPGARQIFERWIEWEPPEQAWQTYINFELRYKEIDRARSVYQRFLHVHGINVQNWIKYAKFEERNGYIGNARAAYEKAMEYFGEEDINETVLVAFALFEERQKEHERARGIFKYGLDNLPSNRTEEIFKHYTQHEKKFGERVGIEDVIISKRKTQYEKMVEENGYNYDAWFDYLRLLENEETDREEVEDVYERAIANIPPHSYFQEKRYWRRYIYLWINYALYEELVAKDFDRARQVYKACIDIIPHKTFTFAKVWIMFAHFEIRQLDLNAARKIMGVAIGKCPKDKLFRAYIDLELQLREFDRCRKLYEKFLESSPESSQTWIKFAELETLLGDTDRSRAVFTIAVQQPALDMPELLWKAYIDFEIACEEHEKARDLYETLLQRTNHIKVWISMAEFEQTIGNFE----------GARKAFERANQSLENAEKEERLMLLEAWKECETKSGDQEALKRVETMMPRRVKKRRQIQTEDGVDAGWEEYFDYIFPQD 654          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Celegans
Match: syf-1 (SYF pre-mRNA splicing factor homolog [Source:UniProtKB/TrEMBL;Acc:P91175])

HSP 1 Score: 53.5286 bits (127), Expect = 4.606e-7
Identity = 80/363 (22.04%), Postives = 140/363 (38.57%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEVS----IWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWI-KWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLS--ENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCL-LHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+  A       ++  AR  FE A+   +  VS    +W  YAEME++ K+ + A  + +RA C++P+               +N+ S +    R          W  + + E+  G +E    +Y K +++       I  +A F E N    +A       +  +              KF +R   ++ ER +++++  L+N P   ++ I+  Y + E++ G        +       Y +  S  +    +  +  YIK + +E   I   R I+ERAI+  P  E K       Y  +      E T G IDRA  +Y+    +  P     F   W       +   + AT R  L
Sbjct:  404 WIGLAKLYEDNGDLDAARKTFETAVISQFGGVSELANVWCAYAEMEMKHKRAKAALTVMQRA-CVVPKPGD-----------YENMQSVQARVHR------SPILWAMYADYEECCGTVESCRKVYDKMIELRVASPQMIMNYAMFLEENEYFELAFQAYEKGIALFKWPGVFDIWNTYLVKFIKRYGGKKLERARDLFEQCLENCPPTHAKYIFLLYAKLEEEHG--------LARHALSIYNRACSGVDRADMHSMYNIYIKKV-QEMYGIAQCRPIFERAISELP--EDKSRAMSLRYAQL------ETTVGEIDRARAIYAHAAEISDPKVHVKFWDTW---KNFEVAHGNEATVRDML 728          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Fly
Match: crn (gene:FBgn0000377 transcript:FBtr0070418)

HSP 1 Score: 522.702 bits (1345), Expect = 3.653e-177
Identity = 294/650 (45.23%), Postives = 443/650 (68.15%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYA--QLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKER+LE  P PP+QKIS   E  +YQ +KR+ +E+N+RK+++ + +W+KYA +E  Q EI RAR+++ERA++  ++ V++WLKYAEME++ KQV HARNL++RA+ I+PR NQ WYKY YMEE L+N+  AR++F+RWM W+P EQAW +++N E +Y EI++A  IY++FV VHPD KNWIK+A+FEE++     +R V   A+ F+G D     +   FA+FEE Q+EH+R + IYKYALD+LPK  ++++++AY ++EKK+GD+  I++ IV KR++ YE+ ++ N  +YD WF Y++++E E    D IRE YERAI+N P   +K +WRRYIYLWI YA++EEL   + +R  ++Y  CL   PH++FTF+K+W+  A+  IR K+L  ARK LG AIG C ++KL+R YI +E  L EF+R R LY KF+ F P     W++FA  E  L   +R R I+E A+ +  LD P  +WK+YIDFE  + E E   +L+ R+LE+ +H  +W S+A  ++ L   D+  +      LAR   I+E AN+ L+++ +   R +LL+ W+ FE D    + ++ V +K+P+ I +R++I +++G+   W E     FP+D     N+ ++
Sbjct:   14 KNKAPAEVQITAEQLLREAKERDLEILPPPPKQKISDPAELADYQQRKRKTFEDNLRKNRMVVSHWIKYAQWEEQQQEIQRARSIWERALDNEHRNVTLWLKYAEMEMKNKQVNHARNLWDRAVTIMPRVNQFWYKYTYMEEMLENVAGARQVFERWMEWQPEEQAWQTYVNFELRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESHGFIHGSRRVFERAVEFFGDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLPKDRTQELFKAYTKHEKKYGDRAGIEDVIVSKRKYQYEQEVAANPTNYDAWFDYLRLIEAEGDR-DQIRETYERAISNVPPANEKNFWRRYIYLWINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRCKELQRARKALGLAIGMCPRDKLFRGYIDLEIQLREFERCRMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAIFELAVQQPRLDMPELLWKAYIDFEVALGETELARQLYERLLERTQHVKVWMSFAKFEMGLSHGDSGPDAELNVQLARR--IYERANEMLRQLGDKESRVLLLEAWRDFERDASDSQEMQKVMDKMPRRIKKRQKIVSDNGVEEGWEEVFDYIFPEDEMARPNLKLL 660          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Fly
Match: CG6841 (gene:FBgn0036828 transcript:FBtr0346816)

HSP 1 Score: 54.299 bits (129), Expect = 3.813e-7
Identity = 54/218 (24.77%), Postives = 87/218 (39.91%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEK 924
             W+  A F   +N    AR V+  A+ I   + SIWL+ A  E      +    L +RA+   P++  LW      +    ++ +AR I        P  E  W + + LE +  E E+A  +  K     P  +  +K A+ E    +   A  +L  A+  +  D P   ++K   + EE+QR  +     Y   L   P  +   I  A  E  K
Sbjct:  532 TWIDDAEFCAKENAFECARAVYAHALQIFPSKKSIWLRAAYFEKNHGTRESLEALLQRAVAHCPKSEILWLMGAKSKWMAGDVPAARGILSLAFQANPNSEDIWLAAVKLESENSEYERARRLLAKARGSAPTPRVMMKSARLEWALEKFDEALRLLEEAVEVF-PDFPKLWMMK--GQIEEQQRRTDDAAATYTLGLKKCPTSIPLWILSANLEERK 746          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Fly
Match: CG6841 (gene:FBgn0036828 transcript:FBtr0075068)

HSP 1 Score: 54.299 bits (129), Expect = 3.813e-7
Identity = 54/218 (24.77%), Postives = 87/218 (39.91%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEK 924
             W+  A F   +N    AR V+  A+ I   + SIWL+ A  E      +    L +RA+   P++  LW      +    ++ +AR I        P  E  W + + LE +  E E+A  +  K     P  +  +K A+ E    +   A  +L  A+  +  D P   ++K   + EE+QR  +     Y   L   P  +   I  A  E  K
Sbjct:  532 TWIDDAEFCAKENAFECARAVYAHALQIFPSKKSIWLRAAYFEKNHGTRESLEALLQRAVAHCPKSEILWLMGAKSKWMAGDVPAARGILSLAFQANPNSEDIWLAAVKLESENSEYERARRLLAKARGSAPTPRVMMKSARLEWALEKFDEALRLLEEAVEVF-PDFPKLWMMK--GQIEEQQRRTDDAAATYTLGLKKCPTSIPLWILSANLEERK 746          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Fly
Match: fand (gene:FBgn0033859 transcript:FBtr0087623)

HSP 1 Score: 51.2174 bits (121), Expect = 3.375e-6
Identity = 71/322 (22.05%), Postives = 132/322 (40.99%), Query Frame = 1
Query:  172 PQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCI-----------------LPRANQLWYKYVYMEEKLKNIDSARKIFKRWM-------------------------------------AWEPPEQAWHSFIN--LEKKYG-EIEKAHAIYKKFVQVHPDEKN---WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQRE---HERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGD 936
            P + IST TE  +  +Q +Q         KL  + W+++A F  +  ++  AR VFER   + Y +V    ++W ++AEMEL+ +Q + A  L +RA  +                 L R+ ++W  Y  +EE      + + +++R +                                      W      W+S++   LE+  G ++E+A  ++++ +   P E     ++ +AK EE +     A SV   A      D     +   +  F ++  E     R +EIY+ A+++LP+     +   + E E K G+
Sbjct:  370 PAEIISTYTEAVQ-TVQPKQAV------GKLHTL-WVEFAKFYEANGQVEDARVVFERGTEVEYVKVEDLAAVWCEWAEMELRQQQFEAALKLMQRATAMPKRKIAYYDDTETVQARLHRSLKVWSMYADLEESFGTFKTCKAVYERIIDLKICTPQIIINYGMFLEEHNYFEEAYRAYEKGISLFKWPNVYDIWNSYLTKFLERYGGTKLERARDLFEQCLDQCPPEHAKYFYLLYAKLEEEHGLARHAMSVYDRATSAVKEDE----MFDMYNIFIKKAAEIYGLPRTREIYEKAIESLPEQNMRHMCVKFAELETKLGE 679          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Zebrafish
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-040426-694])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 306/648 (47.22%), Postives = 449/648 (69.29%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+ + E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  E+ R+R+++ERA+++ ++ +++WLKYAEME++ +QV HARN+++RA+ ILPR NQ WYKY YMEE L NI   R++F+RWM WEP EQAWHS+IN E +Y E++KA +IY+ FV VHP+ KNWIK+A FEE +   +  R V   A+ F+G +    ++   FA+FEE+Q+E ERV+ IYKYALD +PK  ++++++ Y  +EK+FGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++ E + + D +RE+YERAIAN P I++K +WRRYIYLWI YA++EEL   + +R  +VY  CL   PH+KFTFAKIW+   +  IRQK+L  AR+ LG AIG+C KNKL++ YI++E  L EFDR R LY K++ F P     WI+FA  E  L   +R R I+E A+ +  LD P  +WKSYIDFE + +E++N   L++R+L++ +H  +W SYAQ + L  DTE+       + R R+++EEANK ++   E  +R MLL+ W+ +E+++G+    E V   LP+ + +R++I  EDG    W E     FP+D     N+ ++
Sbjct:   18 KNKAPAEVQITAEQLLREAKERELELLPPPPKQKITDKEELNDYKLKKRKGFEDNIRKNRTVISNWIKYAQWEESLQEVQRSRSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEEMLGNIAGCRQVFERWMEWEPEEQAWHSYINFELRYKEVDKARSIYENFVMVHPEVKNWIKYAHFEEKHGYVARGRKVFERAVEFFGEEQVSENLYVAFARFEEKQKEFERVRVIYKYALDRIPKQQAQELFKNYTVFEKRFGDRRGIEDVIVSKRRFQYEEEVKANPHNYDAWFDYLRLV-ESDADADTVREVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYKACLELIPHKKFTFAKIWLLYGQFEIRQKNLQNARRGLGTAIGKCPKNKLFKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDTDRSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEYDNTRGLYKRLLQRTQHVKVWISYAQFE-LSIDTEDR------VQRCRQVYEEANKGMQNCEEKEERLMLLESWRDYEEEFGSFTHKERVRKLLPEKVKKRRKITAEDGSDAGWEEYYDYIFPEDAANQPNLKLL 657          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Zebrafish
Match: xab2 (XPA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-685])

HSP 1 Score: 63.5438 bits (153), Expect = 6.358e-10
Identity = 84/361 (23.27%), Postives = 149/361 (41.27%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCL-LHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+ +A F     +I  AR +FE+A  ++YK+V    ++W +Y EMEL+ +    A  +  +A  I  R  +    Y    E ++N     +++K         + W    +LE+  G  +   A+Y + + +     +  I +A F E +N    +       +  +   N          KF +R   ++ ER +++++ ALD  P   ++ IY  Y + E+++G  +      V +R      V +E  H   + F+       E   +   R IY++AI   P    +    R+  +        E   G IDRA  +YS C  +  P     F + W    E  IR  +  T R+ L
Sbjct:  393 WVSFAKFYEDNEQIDDARTIFEKATKVNYKQVDDLAAVWCEYGEMELRHENYDQALRILRKATAIPARKAE----YFDSSEPVQN-----RVYKSL-------KVWSMLADLEESLGTFQSTKAVYDRIIDLRIATPQIIINYAMFLEEHNYFEESFKAYERGIALFKWPNVHDIWNTYLTKFIDRYGGKKLERARDLFEQALDGCPAKYAKTIYLLYAKLEEEYG--LARHAMAVYERAT--AAVEAEERH---QMFNIYIKRAAEIYGVTHTRAIYQKAIEVLPDEHARDMCLRFADM--------ESKLGEIDRARAIYSYCSQICDPRVTAHFWQTW---KEFEIRHGNEDTIREML 719          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Zebrafish
Match: prpf6 (PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-2575])

HSP 1 Score: 61.2326 bits (147), Expect = 3.482e-9
Identity = 73/335 (21.79%), Postives = 133/335 (39.70%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIW 1275
             WM+ A   +S   +  AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K     P  + ++K  + E        A  + T AL  Y  D P   +++   + EE+    +R +E Y   L   P  +S  ++      E+K G ++T    I+       EK   +N    + W   +++  E    + +        IAN  L+ K         +    A+F E       ++++   +C  H PH     AK++
Sbjct:  545 TWMEDADSCVSHGALECARAIYAHALQVFPSKKSVWLRAAYFEKNNGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVRLEWVLGNIEAAHELCTEALKHY-EDFPKLWMMR--GQIEEQSESIDRAREAYNQGLKKCPHSMS--LWLLLSRLEEKVG-QLTRARAIL-------EKARLKNPQSPELWLESVRL--EYRAGLKN--------IANT-LMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKC-EHDPHVLLAVAKLF 854          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Zebrafish
Match: prpf6 (PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-2575])

HSP 1 Score: 61.2326 bits (147), Expect = 3.610e-9
Identity = 73/335 (21.79%), Postives = 133/335 (39.70%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIW 1275
             WM+ A   +S   +  AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K     P  + ++K  + E        A  + T AL  Y  D P   +++   + EE+    +R +E Y   L   P  +S  ++      E+K G ++T    I+       EK   +N    + W   +++  E    + +        IAN  L+ K         +    A+F E       ++++   +C  H PH     AK++
Sbjct:  575 TWMEDADSCVSHGALECARAIYAHALQVFPSKKSVWLRAAYFEKNNGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVRLEWVLGNIEAAHELCTEALKHY-EDFPKLWMMR--GQIEEQSESIDRAREAYNQGLKKCPHSMS--LWLLLSRLEEKVG-QLTRARAIL-------EKARLKNPQSPELWLESVRL--EYRAGLKN--------IANT-LMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKC-EHDPHVLLAVAKLF 884          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Zebrafish
Match: pdcd11 (programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE-030131-4076])

HSP 1 Score: 58.9214 bits (141), Expect = 2.261e-8
Identity = 58/261 (22.22%), Postives = 116/261 (44.44%), Query Frame = 1
Query:  337 FERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERAL-CILPRANQ----LWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQ-VHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAI 1101
            FER +        +WL+Y    LQ  Q++ AR + ERAL  I  R  Q    +W   + +E      DS +K+F+R + +  P   +    ++  K  +I++A ++YK  V+    D+  ++ +  F     ++  A ++L  AL    S      ++  FA+ E +    E+ K ++   L   PK    D++  + +   K G +  ++E  +  R  H    + +    +  +  Y    E++N   + I+ + ++A+
Sbjct: 1553 FERLLLSSPDSSLLWLQYMAFHLQATQIEQARAVAERALKTISFREEQEKLNIWVAMLNLENMYGTPDSLQKVFERAIQYCEPLLVYQQLADIYAKSEKIKEAESLYKSMVKRFRQDKAVYLSYGTFLLRQRQSDAANALLQRALQSLSSKE-HVDLIARFARLEFQFGNSEKAKSMFDKVLTTYPK--RTDLWSVFIDLMVKHGSQKEVRE--LFDRVIHLSVSVKKIKFFFKRYLEY----EKKNGTPETIQVVKQKAL 1804          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Xenopus
Match: serpinb1 (serpin family B member 1 [Source:Xenbase;Acc:XB-GENE-1217264])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 307/648 (47.38%), Postives = 450/648 (69.44%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+   R++F+RWM W+P EQAWHS+IN E +Y E+++A +IY++FV VHPD KNWIK+A+FEE +   + AR V   ++ F+G D+   ++   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKK+GD+  I++ IV KR+  YE+ +  N H+YD WF Y++++ E + + D +RE+YERAIAN P  ++K +W+RYIYLWI YA++EEL   + +R  +VY  CL   PH+KFTFAKIW+  ++  +RQK+L  AR+ LG +IG+  KNKL++ YI++E  L EFDR R LY KF+ F P     WI+F+  E  L   ER R IYE A+ +  LD P  +WKSYIDFE + +EFE    L+RR+L++ +H  +W S+AQ +L   +        + L + R+I+EEANKSL+   E  +R MLL+ W+ FE+++GT+ + E VA  +P+ + +R+++  EDG    W E     FP+D     N+ ++
Sbjct:   18 KNKAPAEVQITAEQLLREAKERELELLPPPPKQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKSRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGTRQVFERWMEWQPEEQAWHSYINFELRYKEVDRARSIYERFVIVHPDVKNWIKYARFEEKHGYIAHARKVYERSVEFFGEDHMDENLYVSFAKFEEHQKEFERVRVIYKYALDRISKQQAQELFKNYTIFEKKYGDRRGIEDIIVNKRRFQYEEEVKANPHNYDAWFDYLRLV-ESDADPDTVREVYERAIANVPPTKEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQACLELIPHKKFTFAKIWLMYSQFEVRQKNLPFARRALGTSIGKSPKNKLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTTWIKFSELETILGDAERARAIYELAIGQPRLDMPEVLWKSYIDFEIEQEEFEKTRTLYRRLLQRTQHVKVWISFAQFELTSSNE-------DTLGKCRQIYEEANKSLRNCEEKEERLMLLESWRNFEEEFGTESTKERVAKLMPEKVKKRRKLQGEDGSDAGWEEYYDYIFPEDAANQPNLKLL 657          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Xenopus
Match: serpinb1 (serpin family B member 1 [Source:Xenbase;Acc:XB-GENE-1217264])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 300/648 (46.30%), Postives = 445/648 (68.67%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+   R++F+RWM W+P EQAWHS+IN E +Y E+++A +IY++++       NWIK+A+FEE +   + AR V   ++ F+G D+   ++   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKK+GD+  I++ IV KR+  YE+ +  N H+YD WF Y++++ E + + D +RE+YERAIAN P  ++K +W+RYIYLWI YA++EEL   + +R  +VY  CL   PH+KFTFAKIW+  ++  +RQK+L  AR+ LG +IG+  KNKL++ YI++E  L EFDR R LY KF+ F P     WI+F+  E  L   ER R IYE A+ +  LD P  +WKSYIDFE + +EFE    L+RR+L++ +H  +W S+AQ +L   +        + L + R+I+EEANKSL+   E  +R MLL+ W+ FE+++GT+ + E VA  +P+ + +R+++  EDG    W E     FP+D     N+ ++
Sbjct:    7 KNKAPAEVQITAEQLLREAKERELELLPPPPKQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKSRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGTRQVFERWMEWQPEEQAWHSYINFELRYKEVDRARSIYERYILC-----NWIKYARFEEKHGYIAHARKVYERSVEFFGEDHMDENLYVSFAKFEEHQKEFERVRVIYKYALDRISKQQAQELFKNYTIFEKKYGDRRGIEDIIVNKRRFQYEEEVKANPHNYDAWFDYLRLV-ESDADPDTVREVYERAIANVPPTKEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQACLELIPHKKFTFAKIWLMYSQFEVRQKNLPFARRALGTSIGKSPKNKLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTTWIKFSELETILGDAERARAIYELAIGQPRLDMPEVLWKSYIDFEIEQEEFEKTRTLYRRLLQRTQHVKVWISFAQFELTSSNE-------DTLGKCRQIYEEANKSLRNCEEKEERLMLLESWRNFEEEFGTESTKERVAKLMPEKVKKRRKLQGEDGSDAGWEEYYDYIFPEDAANQPNLKLL 641          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Xenopus
Match: serpinb1 (serpin family B member 1 [Source:Xenbase;Acc:XB-GENE-1217264])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 300/648 (46.30%), Postives = 445/648 (68.67%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+   R++F+RWM W+P EQAWHS+IN E +Y E+++A +IY++++       NWIK+A+FEE +   + AR V   ++ F+G D+   ++   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKK+GD+  I++ IV KR+  YE+ +  N H+YD WF Y++++ E + + D +RE+YERAIAN P  ++K +W+RYIYLWI YA++EEL   + +R  +VY  CL   PH+KFTFAKIW+  ++  +RQK+L  AR+ LG +IG+  KNKL++ YI++E  L EFDR R LY KF+ F P     WI+F+  E  L   ER R IYE A+ +  LD P  +WKSYIDFE + +EFE    L+RR+L++ +H  +W S+AQ +L   +        + L + R+I+EEANKSL+   E  +R MLL+ W+ FE+++GT+ + E VA  +P+ + +R+++  EDG    W E     FP+D     N+ ++
Sbjct:    8 KNKAPAEVQITAEQLLREAKERELELLPPPPKQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKSRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGTRQVFERWMEWQPEEQAWHSYINFELRYKEVDRARSIYERYILC-----NWIKYARFEEKHGYIAHARKVYERSVEFFGEDHMDENLYVSFAKFEEHQKEFERVRVIYKYALDRISKQQAQELFKNYTIFEKKYGDRRGIEDIIVNKRRFQYEEEVKANPHNYDAWFDYLRLV-ESDADPDTVREVYERAIANVPPTKEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQACLELIPHKKFTFAKIWLMYSQFEVRQKNLPFARRALGTSIGKSPKNKLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTTWIKFSELETILGDAERARAIYELAIGQPRLDMPEVLWKSYIDFEIEQEEFEKTRTLYRRLLQRTQHVKVWISFAQFELTSSNE-------DTLGKCRQIYEEANKSLRNCEEKEERLMLLESWRNFEEEFGTESTKERVAKLMPEKVKKRRKLQGEDGSDAGWEEYYDYIFPEDAANQPNLKLL 642          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Xenopus
Match: adgrb1 (adhesion G protein-coupled receptor B1 [Source:Xenbase;Acc:XB-GENE-985157])

HSP 1 Score: 65.4698 bits (158), Expect = 2.456e-10
Identity = 81/364 (22.25%), Postives = 150/364 (41.21%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLS--ENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTC--GNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+ +A F     +I  AR + +RA  + Y  V    S+W ++ EMEL+ +  + A N+  +A  +  R  +    Y    E ++N     +++K         + W    +LE+  G  +   A+Y + + +     +  I +A F E +N    +       +  +   N         +KF  R   ++ ER +++++ +LD  P+  +++I+  Y + E++ G        +       YE+     E    Y+ +  YIK    E   +   R IYERAI  + L +++               F ++ C  G IDRA  +YS C      R   F + W    +  +R  +  T R+ L
Sbjct:  380 WVAFAKFYEDNGQIEDARAILQRATLVQYTHVDELASVWCQFGEMELRHENYEQALNILRKATAVPARKAE----YFDSSEPVQN-----RLYKSL-------RVWSMLADLEESLGTFKSTKAVYDRIIDLRIATPQIIINYALFLEEHNYFEESFKAYERGIALFRWPNVYDIWSTYLSKFIARYGGKKLERARDLFEQSLDGCPRKFAKNIFLLYAKLEEEHG--------LARHAMALYERATQAVETGEQYEMFNIYIKRA-AEIYGVTHTRSIYERAI--ELLTDEQSREMCLR--------FADMECKLGEIDRARAIYSYCSQMCDPRVTGFWQTW---RDFEVRHGNEDTLREML 705          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Xenopus
Match: adgrb1 (adhesion G protein-coupled receptor B1 [Source:Xenbase;Acc:XB-GENE-985157])

HSP 1 Score: 64.3142 bits (155), Expect = 5.097e-10
Identity = 81/365 (22.19%), Postives = 151/365 (41.37%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLS--ENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTC--GNIDRAIEVYSQCL-LHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+ +A F     +I  AR + +RA  + Y  V    S+W ++ EMEL+ +  + A N+  +A  +  R  +    Y    E ++N     +++K         + W    +LE+  G  +   A+Y + + +     +  I +A F E +N    +       +  +   N         +KF  R   ++ ER +++++ +LD  P+  +++I+  Y + E++ G        +       YE+     E    Y+ +  YIK   E    +   R IYERAI  + L +++               F ++ C  G IDRA  +YS C  +  P     F + W    +  +R  +  T R+ L
Sbjct:  367 WVAFAKFYEDNGQIEDARAILQRATLVQYTHVDELASVWCQFGEMELRHENYEQALNILRKATAVPARKAE----YFDSSEPVQN-----RLYKSL-------RVWSMLADLEESLGTFKSTKAVYDRIIDLRIATPQIIINYALFLEEHNYFEESFKAYERGIALFRWPNVYDIWSTYLSKFIARYGGKKLERARDLFEQSLDGCPRKFAKNIFLLYAKLEEEHG--------LARHAMALYERATQAVETGEQYEMFNIYIKRAAE-IYGVTHTRSIYERAI--ELLTDEQSREMCLR--------FADMECKLGEIDRARAIYSYCSQMCDPRLTAGFWQTW---RDFEVRHGNEDTLREML 693          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Mouse
Match: Crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:MGI Symbol;Acc:MGI:1914127])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 309/648 (47.69%), Postives = 447/648 (68.98%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PPQQKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+  AR++F+RWM W+P EQAWHS+IN E +Y E+E+A  IY++FV VHP  KNWIK+A+FEE +   + AR V   A+ F+G ++   H+   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + +  D +RE+YERAIAN P I++K +W+RYIYLW+ YA++EEL   + +R  +VY   L   PH+KFTFAK+W+Y A+  IRQK+L  AR+ LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P    +WI+FA  E  L   ER R IYE A+ +  LD P  +WKSYIDFE + +E E    L+R++L++ +H  +W S+AQ +L              +A+ R+I+EEANK+++   E  +R MLL+ W+ FED++GT    E V   +P+ + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:   19 KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVERARTIYERFVLVHPAVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQEAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAE-ADTVREVYERAIANVPPIQEKRHWKRYIYLWVNYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWLYYAQFEIRQKNLPFARRALGTSIGKCPKNKLFKGYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIERARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRQLLQRTQHVKVWISFAQFELSSGKEGS-------VAKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEDEFGTVSDKERVDKLMPEKVKKRRKVQADDGSDAGWEEYYDYIFPEDAANQPNLKLL 658          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Mouse
Match: Prpf6 (pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:MGI:1922946])

HSP 1 Score: 65.4698 bits (158), Expect = 2.098e-10
Identity = 86/439 (19.59%), Postives = 166/439 (37.81%), Query Frame = 1
Query:  325 ARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWM------AWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKN----WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCG-KNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAK 1608
            AR +  RA+      V +WL  A +E      ++AR +  +A   +P    +W     +EE   N     KI  R +        E   + W        + G +    A+ +  + +  +E++    W++ A     +N    AR++   AL  + S      +    A FE+     E ++ + + A+ + PK  +E ++    + +   GD    +  + +  Q         N +  + W + +K +E EN   +  R +  +A ++ P                  ++  E   GNI  A E+  + L H       F K+W+ K +I  + + +  AR+     + +C     L+    ++E  + +  R R +  K  +  P     W+E    EYR         +   AL+ E      +W   +  EA+
Sbjct:  419 ARIMLSRAVECCPTSVELWLALARLE----TYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKK---SVWLRAAYFEKNHGTRESLEALLQRAVAHCPK--AEVLWLMGAKSKWLAGDVPAARSILALAFQ--------ANPNSEEIWLAAVK-LESENNEYERARRLLAKARSSAP-----------TARVFMKSVKLEWVLGNISAAQELCEEALRHYED----FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQ-ECPNSGILWSEAVFLEAR 823          

HSP 2 Score: 59.6918 bits (143), Expect = 1.286e-8
Identity = 75/335 (22.39%), Postives = 134/335 (40.00%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIW 1275
             WM+ A   ++ N +  AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K     P  + ++K  K E      S A+ +   AL  Y  D P   ++K   + EE+    E+ +E Y   L   P   S  ++      E+K G ++T    I+       EK   +N  +   W   +++  E    + +        IAN  L+ K         +    A+F E       ++++   +C  H PH     AK++
Sbjct:  542 TWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHY-EDFPKLWMMK--GQIEEQGELMEKAREAYNQGLKKCPH--STPLWLLLSRLEEKIG-QLTRARAIL-------EKSRLKNPKNPGLWLESVRL--EYRAGLKN--------IANT-LMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKC-EHDPHVLLAVAKLF 851          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Mouse
Match: Prpf6 (pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:MGI:1922946])

HSP 1 Score: 65.4698 bits (158), Expect = 2.098e-10
Identity = 86/439 (19.59%), Postives = 166/439 (37.81%), Query Frame = 1
Query:  325 ARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWM------AWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKN----WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCG-KNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAK 1608
            AR +  RA+      V +WL  A +E      ++AR +  +A   +P    +W     +EE   N     KI  R +        E   + W        + G +    A+ +  + +  +E++    W++ A     +N    AR++   AL  + S      +    A FE+     E ++ + + A+ + PK  +E ++    + +   GD    +  + +  Q         N +  + W + +K +E EN   +  R +  +A ++ P                  ++  E   GNI  A E+  + L H       F K+W+ K +I  + + +  AR+     + +C     L+    ++E  + +  R R +  K  +  P     W+E    EYR         +   AL+ E      +W   +  EA+
Sbjct:  419 ARIMLSRAVECCPTSVELWLALARLE----TYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKK---SVWLRAAYFEKNHGTRESLEALLQRAVAHCPK--AEVLWLMGAKSKWLAGDVPAARSILALAFQ--------ANPNSEEIWLAAVK-LESENNEYERARRLLAKARSSAP-----------TARVFMKSVKLEWVLGNISAAQELCEEALRHYED----FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQ-ECPNSGILWSEAVFLEAR 823          

HSP 2 Score: 59.6918 bits (143), Expect = 1.286e-8
Identity = 75/335 (22.39%), Postives = 134/335 (40.00%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIW 1275
             WM+ A   ++ N +  AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K     P  + ++K  K E      S A+ +   AL  Y  D P   ++K   + EE+    E+ +E Y   L   P   S  ++      E+K G ++T    I+       EK   +N  +   W   +++  E    + +        IAN  L+ K         +    A+F E       ++++   +C  H PH     AK++
Sbjct:  542 TWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHY-EDFPKLWMMK--GQIEEQGELMEKAREAYNQGLKKCPH--STPLWLLLSRLEEKIG-QLTRARAIL-------EKSRLKNPKNPGLWLESVRL--EYRAGLKN--------IANT-LMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKC-EHDPHVLLAVAKLF 851          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Mouse
Match: Xab2 (XPA binding protein 2 [Source:MGI Symbol;Acc:MGI:1914689])

HSP 1 Score: 55.8398 bits (133), Expect = 1.649e-7
Identity = 78/363 (21.49%), Postives = 143/363 (39.39%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTC--GNIDRAIEVYSQCL-LHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+ +A F     ++  AR + E+A  +++K+V    S+W +  E+EL+ +    A  L  +A  +  R  +    Y    E ++N     +++K         + W    +LE+  G  +   A+Y + + +     +  I +A F E +     +       +  +   N          KF  R   R+ ER +++++ ALD  P   ++ +Y  Y + E+++G  +      V  R         E    YD +  YIK   E    +   R IY++AI                +       F ++ C  G IDRA  +YS C  +  P     F + W    +  +R  +  T R+ L
Sbjct:  398 WVAFAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALKLLRKATALPARRAE----YFDGSEPVQN-----RVYKSL-------KVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFISRYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWG--LARHAMAVYDRATR----AVEPAQQYDMFNIYIKRAAE-IYGVTHTRGIYQKAI----------EVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTW---KDFEVRHGNEDTIREML 724          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Mouse
Match: Pdcd11 (programmed cell death 11 [Source:MGI Symbol;Acc:MGI:1341788])

HSP 1 Score: 54.299 bits (129), Expect = 5.993e-7
Identity = 38/164 (23.17%), Postives = 85/164 (51.83%), Query Frame = 1
Query:  184 ISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAIN-IHYKE-VSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKR--WMAWEPPEQA--WHSFINLEKKYGEIEKAHAIYKKFVQ 657
            I T++EK +   +  + Y   +++ + +   W+KY +F + +++   +  V +RA+  +  KE V + +K+A++E Q   V+ A+ ++E  L   P+   +W  Y+ M  K  +  + R IF+R   ++  P      +  +++ EK++G  +   A+  K ++
Sbjct: 1691 IYTKSEKYK---EAGELYNRMLKRFRQEKAVWIKYGAFVLGRSQAGASHRVLQRALECLPAKEHVDVIVKFAQLEFQLGDVERAKAIFENTLSTYPKRTDVWSVYIDMTIKHGSQTAVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALE 1851          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. UniProt/SwissProt
Match: sp|P63155|CRNL1_RAT (Crooked neck-like protein 1 OS=Rattus norvegicus OX=10116 GN=Crnkl1 PE=2 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 309/648 (47.69%), Postives = 447/648 (68.98%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PPQQKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+  AR++F+RWM W+P EQAWHS+IN E +Y E+E+A  IY++FV VHP  KNWIK+A+FEE +   + AR V   A+ F+G ++   H+   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + +  D +RE+YERAIAN P I++K +W+RYIYLW+ YA++EEL   + +R  +VY   L   PH+KFTFAK+W+Y A+  IRQK+L  AR+ LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P    +WI+FA  E  L   ER R IYE A+ +  LD P  +WKSYIDFE + +E E    L+R++L++ +H  +W S+AQ +L              +A+ R+I+EEANK+++   E  +R MLL+ W+ FED++GT    E V   +P+ + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:   19 KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVERARTIYERFVLVHPAVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQEAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAE-ADTVREVYERAIANVPPIQEKRHWKRYIYLWVNYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWLYYAQFEIRQKNLPFARRALGTSIGKCPKNKLFKGYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIERARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRQLLQRTQHVKVWISFAQFELSSGKEGS-------VAKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEDEFGTVSDKERVDKLMPEKVKKRRKVQADDGSDAGWEEYYDYIFPEDAANQPNLKLL 658          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. UniProt/SwissProt
Match: sp|P63154|CRNL1_MOUSE (Crooked neck-like protein 1 OS=Mus musculus OX=10090 GN=Crnkl1 PE=1 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 309/648 (47.69%), Postives = 447/648 (68.98%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PPQQKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+  AR++F+RWM W+P EQAWHS+IN E +Y E+E+A  IY++FV VHP  KNWIK+A+FEE +   + AR V   A+ F+G ++   H+   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + +  D +RE+YERAIAN P I++K +W+RYIYLW+ YA++EEL   + +R  +VY   L   PH+KFTFAK+W+Y A+  IRQK+L  AR+ LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P    +WI+FA  E  L   ER R IYE A+ +  LD P  +WKSYIDFE + +E E    L+R++L++ +H  +W S+AQ +L              +A+ R+I+EEANK+++   E  +R MLL+ W+ FED++GT    E V   +P+ + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:   19 KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVERARTIYERFVLVHPAVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQEAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAE-ADTVREVYERAIANVPPIQEKRHWKRYIYLWVNYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWLYYAQFEIRQKNLPFARRALGTSIGKCPKNKLFKGYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIERARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRQLLQRTQHVKVWISFAQFELSSGKEGS-------VAKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEDEFGTVSDKERVDKLMPEKVKKRRKVQADDGSDAGWEEYYDYIFPEDAANQPNLKLL 658          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. UniProt/SwissProt
Match: sp|Q9BZJ0|CRNL1_HUMAN (Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 PE=1 SV=4)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 308/648 (47.53%), Postives = 447/648 (68.98%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PPQQKI+ E E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E S  EI RAR+++ERA+++ Y+ +++WLKYAEME++ +QV HARN+++RA+  LPR NQ WYKY YMEE L N+  AR++F+RWM W+P EQAWHS+IN E +Y E+++A  IY++FV VHPD KNWIK+A+FEE +   + AR V   A+ F+G ++   H+   FAKFEE Q+E ERV+ IYKYALD + K  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + +  + +RE+YERAIAN P I++K +W+RYIYLWI YA++EEL   + +R  +VY   L   PH+KFTFAK+WI  A+  IRQK+L+ AR+ LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P    +WI+FA  E  L   +R R IYE A+ +  LD P  +WKSYIDFE + +E E    L+RR+L++ +H  +W S+AQ +L              L + R+I+EEANK+++   E  +R MLL+ W+ FE+++GT    E V   +P+ + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:  180 KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAE-AEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGS-------LTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLL 819          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. UniProt/SwissProt
Match: sp|P17886|CRN_DROME (Protein crooked neck OS=Drosophila melanogaster OX=7227 GN=crn PE=2 SV=2)

HSP 1 Score: 522.702 bits (1345), Expect = 3.662e-176
Identity = 294/650 (45.23%), Postives = 443/650 (68.15%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYA--QLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKER+LE  P PP+QKIS   E  +YQ +KR+ +E+N+RK+++ + +W+KYA +E  Q EI RAR+++ERA++  ++ V++WLKYAEME++ KQV HARNL++RA+ I+PR NQ WYKY YMEE L+N+  AR++F+RWM W+P EQAW +++N E +Y EI++A  IY++FV VHPD KNWIK+A+FEE++     +R V   A+ F+G D     +   FA+FEE Q+EH+R + IYKYALD+LPK  ++++++AY ++EKK+GD+  I++ IV KR++ YE+ ++ N  +YD WF Y++++E E    D IRE YERAI+N P   +K +WRRYIYLWI YA++EEL   + +R  ++Y  CL   PH++FTF+K+W+  A+  IR K+L  ARK LG AIG C ++KL+R YI +E  L EF+R R LY KF+ F P     W++FA  E  L   +R R I+E A+ +  LD P  +WK+YIDFE  + E E   +L+ R+LE+ +H  +W S+A  ++ L   D+  +      LAR   I+E AN+ L+++ +   R +LL+ W+ FE D    + ++ V +K+P+ I +R++I +++G+   W E     FP+D     N+ ++
Sbjct:   14 KNKAPAEVQITAEQLLREAKERDLEILPPPPKQKISDPAELADYQQRKRKTFEDNLRKNRMVVSHWIKYAQWEEQQQEIQRARSIWERALDNEHRNVTLWLKYAEMEMKNKQVNHARNLWDRAVTIMPRVNQFWYKYTYMEEMLENVAGARQVFERWMEWQPEEQAWQTYVNFELRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESHGFIHGSRRVFERAVEFFGDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLPKDRTQELFKAYTKHEKKYGDRAGIEDVIVSKRKYQYEQEVAANPTNYDAWFDYLRLIEAEGDR-DQIRETYERAISNVPPANEKNFWRRYIYLWINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRCKELQRARKALGLAIGMCPRDKLFRGYIDLEIQLREFERCRMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAIFELAVQQPRLDMPELLWKAYIDFEVALGETELARQLYERLLERTQHVKVWMSFAKFEMGLSHGDSGPDAELNVQLARR--IYERANEMLRQLGDKESRVLLLEAWRDFERDASDSQEMQKVMDKMPRRIKKRQKIVSDNGVEEGWEEVFDYIFPEDEMARPNLKLL 660          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. UniProt/SwissProt
Match: sp|Q5BDX1|CLF1_EMENI (Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=clf1 PE=3 SV=2)

HSP 1 Score: 503.827 bits (1296), Expect = 4.408e-169
Identity = 279/663 (42.08%), Postives = 427/663 (64.40%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERF------PEVLARSREIFEEANKSLKKME-SSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVIDDFLKNVQNW 2046
            +NK PAPVQI S + L        E + + P Q+ +   E  EYQ +KR+++E+ +R++++ + NWM+YA++E+ Q E  RAR++FERA+++    V +W++Y E E++ + + HARNL +RA+ ILPR ++LWYKYVYMEE L NI   R++F+RWM+WEP E AW ++I LEK+Y E E+A AI+++F  VHP+ +NWIKWA+FEE    + + R V   A+   G D     +   +A+FE + +E+ER + IYKYALD LP+  S  +++AY  +EK+FGD+  ++  I+ KR+  YE+ L EN  +YD WF + + +EE++ + + +R++YERAIA  P  ++K +WRRYIYLWI YA++EE+   +IDRA +VY++CL   PH+KFTFAK+W+ KA+  +RQ +L  ARKTLG AIG C K+KL+R YI +E  L EF R RTLY K I + P+  Q+WI++A  E  L   ER R IYE  + +  LD P  VWK+YIDFE    E+E   +L+ R+L++ +H  +W +YA+ ++   D EEEE         E   R+R +FE A++  K+ E   +R  LL  W+ FE  +G+ E I+ +  ++P+ + +R+++D++     + E     FP D Q   N+S +   L+    W
Sbjct:   11 KNKAPAPVQI-SAEQLLREAVDRQEPSLQAPTQRFADLEELHEYQGRKRKEFEDYVRRNRINMNNWMRYAAWELEQKEFRRARSIFERALDVDSTSVPLWIRYIESEMRNRNINHARNLLDRAVTILPRVDKLWYKYVYMEETLGNIPGTRQVFERWMSWEPDEGAWSAYIKLEKRYNEFERARAIFQRFTIVHPEPRNWIKWARFEEEYGTSDLVREVYGLAVETLGEDFMDEKLFIAYARFETKLKEYERARAIYKYALDRLPRSKSITLHKAYTTFEKQFGDREGVENVILAKRRVQYEEQLKENLRNYDVWFDFAR-LEEQSGDPERVRDVYERAIAQIPPSQEKRHWRRYIYLWIFYALWEEMEAKDIDRARQVYTECLKLIPHKKFTFAKVWLMKAQFEVRQLNLQAARKTLGQAIGMCPKDKLFRGYIDLERQLFEFVRCRTLYEKQIEWNPSNSQSWIQYAELERGLDDTERARAIYELGIDQPTLDMPELVWKAYIDFEDDEGEYERERQLYERLLQKTDHVKVWINYARFEINVPDEEEEEEEEERPISDEAKRRARAVFERAHRVFKEKELKEERVELLNAWRAFEHTHGSPEDIDKIEKQMPRRVKKRRKLDDD----RYEEYMDYVFPADDQSAANLSKL---LRMAHQW 664          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. TrEMBL
Match: A0A4S2LQG4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005583 PE=4 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 330/674 (48.96%), Postives = 462/674 (68.55%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDT---------------------------EEEERFPEVLARSREIFEEANKSLKKMESS-QREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA +QIT+EQLLREAKERELE TPK PQQKI++ +E +++QL+KR+DYE+NIRK++L + NW+KYA FE SQ EI RAR++FERA+++ Y+ V +WLKYAEME++ KQV HARNL++RA+ ++PRANQ WYKY YMEE L NI  AR++F+RWM W+P EQAWH++IN E +Y E+++A  IY++FV VHP+ +NW+K+AKFEE N   +  R V   A+ F+G+DNP   +L EFA+FEERQ+EHER + IYKYALDNLPK   ++IY+AY  +EKK+GD++ I++ I+ KR+  YE+ +  N H+YD WF Y+++MEEE  ++D  REIYERA+AN P I++K YWRRYIYLW+ YA++EELT  N++R  +VY  CL   PHR+FTFAK+W+Y A+  IRQK L  ARK LG AIG C K+KL+R YI++E  L EFDR R LY KF+ F P     W+ +A  E  L + +R R IYE A+ +  LD P  +WK+YIDFE +  ++E+   L+RR+L++ +H  +W S+A  +L   +T                             E    + + R+R ++ EANK+L+  E   QR  LL+ WK+FED+YG  ES   +A   P+ +V+ +R+ +E     W E     FPD   +  N  ++
Sbjct:   25 KNKMPAAIQITAEQLLREAKERELEVTPKAPQQKITSLSELRDFQLRKRKDYEDNIRKNRLAMQNWIKYAKFEESQGEIQRARSIFERALDVDYRNVGLWLKYAEMEMRNKQVNHARNLWDRAVVLMPRANQFWYKYTYMEEMLGNIAGARQVFERWMEWQPEEQAWHAYINFELRYKELDQARMIYERFVLVHPEPRNWVKYAKFEERNGFVNSCRQVFERAVEFFGTDNPQARLLIEFARFEERQKEHERARVIYKYALDNLPKEECQEIYKAYTLHEKKYGDRLAIEDVILSKRKFQYEEEVQANPHNYDVWFDYVRLMEEEG-SVDQTREIYERAVANVPPIKEKRYWRRYIYLWLNYALYEELTVENMERTRQVYRFCLKLIPHRRFTFAKMWLYAAKFEIRQKSLTDARKLLGAAIGMCPKDKLFRGYIELEIQLREFDRCRKLYEKFLEFSPENCTTWMRYAELESLLGEVDRARAIYELAINRPLLDMPELLWKAYIDFEIEQYDWEHARALYRRLLKRTQHVKVWISFANFELCAHNTLTLDDLDDGVEAHLKSANVDKETIIREHNENEVQKGVLRTRAVYREANKALRTCEDKEQRVRLLEAWKEFEDEYGDAESQREIAKLQPQKVVRSRRLGDERS--GWEEFVEYIFPDTDAEKPNQKLL 695          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. TrEMBL
Match: A0A0R3UJ63 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7525 PE=4 SV=2)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 324/660 (49.09%), Postives = 458/660 (69.39%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAE-LDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFD-TEEEERFPEVLA------------RSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVI 2016
            +NKTPAPVQIT+EQ+LREAK RELE  P  P QKI+   E +++QL+KR+DYE+NIRK++L + NW+KYA FE SQ E+ RAR++FERA+++ ++ + +WLKYA+ME++ KQV HARNL++RA+ ++PRANQ WYKY YMEE+L NI  AR++F+RWM WEP EQAWH++IN E +Y E+++A  IY++FV V+P+ KNW+K+AKFEE NN  + AR V   A+ FYG+DNP   +  EFA+FEERQ+EH+R + IYKYALDNLP     +IY+A+  +EKK+GD++ I+  I+ KR+  YE  +  N H+YD WF Y+++MEEE  +++  RE+YERA+AN P I++K YWRRYIYLWI YA++EELT G+++R  EVY+  L   PHR+FTFAK+W+Y A+  IRQK L TARK LG A+G+C K KL+R YI++E  L EFDR R LY KF+ F P     W+ +A  E  L + ER R IYE A+    LD P  +WK+YID+E + +E+     L+RR++++ +H  +W S A  +L   + TE      +V A            R+RE++ EAN +L+K  E  QR  L+  WK FE++YG +E+   VA   P+ +V+ +R+++E G   W E     FPD   +  N  ++
Sbjct:   25 KNKTPAPVQITAEQILREAKNRELEVAPAAPTQKITNLAELRDFQLRKRKDYEDNIRKNRLAMQNWIKYAKFEESQGELQRARSIFERALDVDFRNIGLWLKYADMEMRNKQVNHARNLWDRAVTLIPRANQFWYKYTYMEEQLGNIVGARQVFERWMEWEPEEQAWHAYINFELRYKELQRARMIYERFVLVNPEPKNWVKYAKFEERNNYINSARQVFERAVEFYGTDNPQARLFIEFARFEERQKEHDRARVIYKYALDNLPSDECPEIYKAFTLHEKKYGDRLAIEGVILNKRKFQYESEVEANPHNYDVWFDYVRLMEEEG-SVEQTRELYERAVANVPPIKEKRYWRRYIYLWINYALYEELTVGDVERTREVYNFALRLIPHRRFTFAKMWLYAAKFEIRQKLLPTARKILGTALGKCPKAKLFRGYIELEIQLREFDRCRKLYEKFLEFSPENCTTWMRYAEMEALLDEVERARAIYELAISQPLLDMPEILWKAYIDYEIEQREWNRARALYRRLMQKTQHVKVWLSLANFELCAQNSTEHGNELGDVGASANETETRAAVERAREVYREANLALRKSNEKEQRVQLIDEWKAFEEEYGDEETQMEVAGFEPQRLVRSRRLEDEAG-GGWEEYVDYIFPDTTAEQPNRKLL 682          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. TrEMBL
Match: A0A0R3SHV1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4514 PE=4 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 324/675 (48.00%), Postives = 461/675 (68.30%), Query Frame = 1
Query:   43 NFQASXXXXXXXXRNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAE-LDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEE---------------EERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVI 2016
            +F  SK+ K  KV+NKTPAP+QIT+EQ+LREAK RELE  P  P QKI+   E +++QL+KR+DYE+NIRK++L + NW+KYA FE SQ E+ RAR++FERA+++ ++ + +WLKYA+ME++ KQV HARNL++RA+ ++PRANQ WYKY YMEE L N+  AR++F+RWM WEP EQAWH++IN E +Y E+++A  IY++FV V+P+ KNW+K+AKFEE NN  + AR V   A+ FYG+DNP   +  EFA+FEERQ+EH+R + IYKYALDNLP     +IY+AY  +EKK+GD++ I+  I+ KR+  YE  +  N H+YD WF Y+++MEEE  +++  RE+YERA+AN P +++K YWRRYIYLWI YA +EELT  +++R  EVY+  L   PH+KFTFAK+W+Y A+  IRQK L  ARK LG A+G+C K KL+R YI++E  L EFDR R LY+KF+ F P     W+ +A  E  L + ER R IYE A+    LD P  +WK+YID+E + +E++    L+RR++E+ +H  +W S A  +L   D  E               E      + RSR ++ EAN++L+K  E  QR  L++ WK FE +YG +E+ + VA+  P+ +V+ +R++       W E     FPD   +  N  ++
Sbjct:   12 SFDKSKRAKFAKVKNKTPAPIQITAEQILREAKNRELEVAPVAPTQKITNLAELRDFQLRKRKDYEDNIRKNRLAMQNWIKYAKFEESQGELQRARSIFERALDVDFRNIGLWLKYADMEMRNKQVNHARNLWDRAVALIPRANQFWYKYTYMEELLGNVAGARQVFERWMEWEPEEQAWHAYINFELRYKELQRARLIYERFVLVNPEPKNWVKYAKFEERNNYINSARKVFERAVEFYGTDNPQARLFIEFARFEERQKEHDRARVIYKYALDNLPSDECPEIYKAYTLHEKKYGDRLAIEGVILNKRKFQYESEVEANPHNYDVWFDYVRLMEEEG-SVEQTRELYERAVANVPPVKEKRYWRRYIYLWINYAFYEELTVADVERTREVYNFALRLIPHKKFTFAKMWLYAAKFEIRQKQLTAARKLLGTALGKCPKAKLFRGYIELEIQLREFDRCRKLYDKFLEFSPENCTTWMRYAEIEALLDEVERARAIYELAISQPLLDMPEILWKAYIDYEIEQREWDRARALYRRLMEKTQHVKVWLSLANFELCAQDAVEVEEGNADSETAMATNEREGRAAIERSRAVYREANQALRKSPEKEQRVQLIEEWKAFEGEYGNEETRKEVASFEPQRVVRSRRLEEGGAAGGWEEFVEYIFPDTAAEQPNRKLL 685          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. TrEMBL
Match: A0A158QHU7 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8091 PE=4 SV=1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 324/675 (48.00%), Postives = 464/675 (68.74%), Query Frame = 1
Query:   43 NFQASXXXXXXXXRNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAE-LDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFD----------TEEEERFPE-----VLARSREIFEEANKSLKK-MESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVI 2016
            +F  SK+ K  KV+NKTPAP+QIT+EQ+LREAK RELE  P  P QKI+   E +++QL+KR+DYE+NIRK++L + NW+KYA FE SQ E+ RAR++FERA+++ ++ + +WLKYA+ME++ KQV HARNL++RA+ ++PRANQ WYKY YMEE L N+  AR++F+RWM WEP EQAWH++IN E +Y E+++A  IY++FV V+P+ KNW+K+AKFEE NN  + AR V   A+ FYG+DNP   +  EFA+FEERQ+EH+R + IYKYALDNLP     +IY+AY  +EKK+GD++ I+  I+ KR+  YE     N H+YD WF Y+++MEEE  +++  RE+YERA+AN P +++K YWRRYIYLWI YA++EELT  +++R  EVY+  L   PH+KFTFAK+W+Y A+  IRQK L  ARK LG A+G+C K KL+R YI++E  L EFDR R LY+KF+ F P     W+ +A  E  L + ER R IYE A+    LD P  +WK+YID+E + +E++    L+RR++E+ +H  +W S A  +L   D           E    F E      + R+R ++ EAN++L+K  E  QR  LL+ WK FE++YG +E+ + V++  P+ +++ +R++ E     W E     FPD   +  N  ++
Sbjct:   12 SFDKSKRAKFAKVKNKTPAPIQITAEQILREAKNRELEVAPLAPTQKITNLAELRDFQLRKRKDYEDNIRKNRLAMQNWIKYAKFEESQGELQRARSIFERALDVDFRNIGLWLKYADMEMRNKQVNHARNLWDRAVTLIPRANQFWYKYTYMEELLGNVAGARQVFERWMEWEPEEQAWHAYINFELRYKELQRARLIYERFVLVNPEPKNWVKYAKFEERNNYINSARKVFERAIEFYGTDNPQARLFIEFARFEERQKEHDRARVIYKYALDNLPSDECPEIYKAYTLHEKKYGDRLAIEGVILNKRKFQYESEAEANPHNYDVWFDYVRLMEEEG-SVEQTRELYERAVANVPPVKEKRYWRRYIYLWINYALYEELTVADMERTREVYNFALRLIPHKKFTFAKMWLYAAKFEIRQKQLTAARKLLGTALGKCPKAKLFRGYIELEILLREFDRCRKLYDKFLEFSPENCTTWMRYAEMEALLDEVERARAIYELAISQPLLDMPEILWKAYIDYEIEQREWDRARALYRRLMEKTQHVKVWLSLANFELCAQDAIVVEEGSANAETAREFNESEARTAIERARAVYREANQTLRKSSEKEQRVQLLEEWKTFEEEYGNEETRKEVSSFEPQRVIRSRRLEEEGAAGGWEEFVEYIFPDTAAEQPNRKLL 685          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. TrEMBL
Match: A0A1S8WTJ5 (HAT repeat protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_06402 PE=4 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 327/674 (48.52%), Postives = 461/674 (68.40%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDT---------------------------EEEERFPEVLARSREIFEEANKSLKKMESS-QREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA +QIT+EQLLREAKERELE TPK PQQKI++ +E +++QL+KR+DYE+NIRK++L + NW+KYA FE SQ EI RAR++FERA+++ Y+ V +WLKYAEME++ KQV HARNL++RA+ ++PRANQ WYKY YMEE L NI  AR++F+RWM W+P EQAWH++IN E +Y E+++A  IY++++  +P  +NW+K+AKFEE N   +  R V   A+ F+G+DNP   +L EFA+FEERQ+EHER + IYKYALDNLPK   ++IY+AY  +EKK+GD++ I++ I+ KR+  YE+ +  N H+YD WF Y+++MEEE  ++D  REIYERA+AN P I++K YWRRYIYLW+ YA++EELT  N++RA +VY  CL   PHR+FTFAK+W+Y A+  IRQK L  ARK LG AIG C K+KL+R YI++E  L EFDR R LY KF+ F P     W+ +A  E  L + +R R IYE A+ +  LD P  +WK+YIDFE +  ++E    L+RR+L++ +H  +W S+A  +L   +T                             E    + + R+R ++ EANK+L+  E   QR  LL+ WK+FED+YG  ES + +A   P+ +V+ +R+ +E     W E     FPD   +  N  ++
Sbjct:   25 KNKMPAAIQITAEQLLREAKERELEVTPKAPQQKITSLSELRDFQLRKRKDYEDNIRKNRLAMQNWIKYAKFEESQGEIQRARSIFERALDVDYRNVGLWLKYAEMEMRNKQVNHARNLWDRAVVLMPRANQFWYKYTYMEEMLGNIAGARQVFERWMEWQPEEQAWHAYINFELRYKELDQARMIYERYILFYP--RNWVKYAKFEERNGFVNSCRQVFERAVEFFGTDNPQARLLIEFARFEERQKEHERARVIYKYALDNLPKEECQEIYKAYTLHEKKYGDRLAIEDVILSKRKFQYEEEVQANPHNYDVWFDYVRLMEEEG-SVDQTREIYERAVANVPPIKEKRYWRRYIYLWLNYALYEELTVENMERARQVYRFCLKLIPHRRFTFAKMWLYAAKFEIRQKALTDARKLLGAAIGMCPKDKLFRGYIELEIQLREFDRCRKLYEKFLEFSPENCTTWMRYAELESLLGEVDRARAIYELAINRPLLDMPELLWKAYIDFEIEQYDWERARALYRRLLKRTQHVKVWISFANFELCAHNTLTLDDLDDGAEAHLKSANVDKETIIREHNENEVKKGVLRTRAVYREANKALRTCEDKEQRVRLLEAWKEFEDEYGDAESQKEIAKLQPQKVVRSRRLGDERS--GWEEFVEYIFPDTDAEKPNQKLL 693          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Cavefish
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:103034616])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 309/648 (47.69%), Postives = 455/648 (70.22%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+ E E  +Y+L+KR+ +E++IRK++  I NW+KYA +E S  EI RAR+++ERA+++ ++ V++WLKYAEME++ +QV HARN+++RA+ ILPR NQ WYKY YMEE L N+   R++F+RWM WEP EQAWHS+IN E +Y E++KA  IY++FV VHP+ KNWIK+A+FE+ +   + AR V   A+ F+G ++   ++   FA+FEE+Q+E ERV+ IYKYALD +PK  ++++++ Y  +EKKFGD+  I++ IV KR+  YE+ +  N H+YD WF Y++++ E + ++D +RE+YERAIAN P I++K +WRRYIYLWI YA++EEL   + +R  +VY  CL   PH+KFTFAKIW+   +  IRQK+L  AR+ +G+AIG+C KNKL++ YI++E  L EFDR R LY K++ F P     WI+FA  E  L   ER R I+E A+ +  LD P  +WKSYIDFE + +E++   +L++R+L++ +H  +W SYAQ + L  D+E+       L R R+++EE+NKSL+   E  +R MLL+ W+ FE ++GT  + + V   LP+ + +R+++  EDG    W E     FP+D     N+ ++
Sbjct:   18 KNKAPAEVQITAEQLLREAKERELELLPPPPKQKITDEEELNDYKLRKRKGFEDHIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDHRNVTLWLKYAEMEMKSRQVNHARNIWDRAITILPRVNQFWYKYSYMEEMLGNVAGCRQVFERWMEWEPEEQAWHSYINFELRYKEVDKARTIYERFVIVHPEIKNWIKYARFEDKHGYIAHARKVFERAVEFFGEEHIDENLFVAFARFEEKQKEFERVRVIYKYALDKIPKQQAQELFKNYTVFEKKFGDRRGIEDVIVSKRRFQYEEEVKANPHNYDAWFDYLRLV-ESDADVDTVREVYERAIANMPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQACLELIPHKKFTFAKIWLLYGQFEIRQKNLQNARRGMGSAIGKCPKNKLFKGYIELELQLREFDRCRKLYEKYLEFGPENCTTWIKFAELETILGDTERARAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEYDKTRELYKRLLQRTQHVKVWISYAQFE-LSVDSEDR------LQRCRQVYEESNKSLRNCEEKEERLMLLESWRDFEQEFGTFANKDRVRKLLPEKVKKRRKLTAEDGSDAGWEEYYDYIFPEDAANQPNLKLL 657          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Cavefish
Match: xab2 (XPA binding protein 2 [Source:NCBI gene;Acc:103039703])

HSP 1 Score: 58.151 bits (139), Expect = 2.914e-8
Identity = 79/362 (21.82%), Postives = 148/362 (40.88%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVL-SENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCL-LHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+ +A F     ++  AR +FE+A  ++YK V    ++W +Y EMEL+ +    A  +  +A  I  R  +    Y    E ++N     +++K         + W    +LE+  G  +   A+Y + + +     +  I +A F + +N    +       +  +   N          KF +R   ++ ER +++++ ALD  P   ++ IY  Y + E+++G        +       YE+   +  T +  + F+       E   +   R IY++AI  + L ++        +  +      E   G IDRA  +YS C  +  P     F + W    E  IR  +  T R+ L
Sbjct:  393 WVAFARFYEDNEQLEDARTIFEKATKVNYKVVDDLAAVWCEYGEMELRHENYDQALRILRKATAIPARKAE----YFDSSEPVQN-----RVYKSL-------KVWSMLADLEESLGTFQSTKAVYDRIIDLRIATPQIIINYAMFLDEHNYFEESFKAYERGIALFKWPNVYDIWNTYLTKFIDRYGGKKLERARDLFEQALDGCPSKFAKTIYLLYAKLEEEYG--------LARHAMAVYERATQAVETEERLQMFNIYIKRAAEIYGVTHTRAIYQKAI--EILSDEHARDMCLRFADM------ESKLGEIDRARAIYSFCSQMCDPRMTANFWQTW---KEFEIRHGNEDTIREML 719          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Cavefish
Match: prpf39 (pre-mRNA processing factor 39 [Source:NCBI gene;Acc:103021423])

HSP 1 Score: 53.5286 bits (127), Expect = 5.180e-7
Identity = 41/161 (25.47%), Postives = 80/161 (49.69%), Query Frame = 1
Query:  208 EYQLQKRQDYENNIRK--------DKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCI-LPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSF--INLEKKYGEIEKAHAIYKKFVQ 657
            E+++ KR  +E  I++        +K ++ NW +Y  FE+      R   +FER +         W+KYA+  L+    +  R++Y++A  I LP+   + + +   EE+  NI+ AR I K  +    P  A      ++LE+++G +++A  + +  +Q
Sbjct:  201 EHEVSKRWAFEEGIKRPYFHVKALEKTQLSNWREYLDFELENGTPERVVVLFERCLIACALYEEFWIKYAKY-LESYSTEGVRHVYKKACTIHLPKKANIHFLWAAFEEQQGNIEEARGILKS-LEESVPGLAMVRLRRVSLERRHGNLDEAETLLRDAIQ 359          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Cavefish
Match: prpf39 (pre-mRNA processing factor 39 [Source:NCBI gene;Acc:103021423])

HSP 1 Score: 53.1434 bits (126), Expect = 8.681e-7
Identity = 41/161 (25.47%), Postives = 80/161 (49.69%), Query Frame = 1
Query:  208 EYQLQKRQDYENNIRK--------DKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCI-LPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSF--INLEKKYGEIEKAHAIYKKFVQ 657
            E+++ KR  +E  I++        +K ++ NW +Y  FE+      R   +FER +         W+KYA+  L+    +  R++Y++A  I LP+   + + +   EE+  NI+ AR I K  +    P  A      ++LE+++G +++A  + +  +Q
Sbjct:  410 EHEVSKRWAFEEGIKRPYFHVKALEKTQLSNWREYLDFELENGTPERVVVLFERCLIACALYEEFWIKYAKY-LESYSTEGVRHVYKKACTIHLPKKANIHFLWAAFEEQQGNIEEARGILKS-LEESVPGLAMVRLRRVSLERRHGNLDEAETLLRDAIQ 568          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Cavefish
Match: prpf6 (pre-mRNA processing factor 6 [Source:NCBI gene;Acc:103027632])

HSP 1 Score: 51.9878 bits (123), Expect = 2.356e-6
Identity = 46/205 (22.44%), Postives = 82/205 (40.00%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYL 885
             WM+ A   +S   +  AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K        + ++K  K E        A+ + T AL  Y +    P +     + EE+    +  +E Y   L   P  +
Sbjct:  575 TWMEDAESCVSHGALECARAIYAHALQVFPSKKSVWLRAAYFEKSHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAATARVFMKSIKLEWVLGNIDAAQELCTEALRLYENF---PKLWMMKGQIEEQSENMDLAREAYNQGLKKCPHSM 776          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Sea Lamprey
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-040426-694])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 307/649 (47.30%), Postives = 449/649 (69.18%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFV-QVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA +QIT+EQLLREAKERELE  P PP+QKIS E E  +Y+L+KR+ +E+NIRK++  + NW+KYA +E S  EI RAR+++ERA+++ ++ V++WLKYAEME++ +QV HARN+++RA+ ILPR N  WYKY YMEE L N+   R++F+RWM WEP EQAWHS+IN E +Y E++ A A+Y+K++  VHP+ KNWIK+A+FE+ +  T+ AR V   A+ FYG ++    +   FA+FEE Q+E +RV+ IYKYALD +PK  S+++++ Y  +EKK+GD+  I++ IV KR+  YE+ +  N H+YD WF Y++++E + + ++ +RE+YERAIAN PL+ +K +WRRYIYLWI +A+FEEL   + DR  +VY  CL   PH+KFTF+KIW+  A+  IRQK+L  ARK LG +IG+C KNKL++ YI++E  L EFDR R LY KF+ F P     W++FA  E  L   ER R IYE A+ +  LD P  +WKSYIDFE + +E      L+RR+L++ +H  +W S+A+ +L     E +ER    ++R R ++EE N+SL+   E  +R MLL+ W+ FED +G ++S E V   +P  + +R+++  +DG    W E     FP+D     N+ ++
Sbjct:   19 KNKAPADLQITAEQLLREAKERELELLPPPPRQKISDEEELADYKLRKRKTFEDNIRKNRTVVTNWIKYAQWEESLKEIQRARSLYERALDVDHRNVTLWLKYAEMEMKNRQVNHARNIWDRAVTILPRINAFWYKYTYMEEMLSNVAGCRQVFERWMEWEPEEQAWHSYINFELRYKEVDAARAVYEKYILGVHPEIKNWIKYARFEDRHGYTAHARRVYERAVEFYGEEHMKEPLFVAFARFEEAQKEFDRVRVIYKYALDRIPKQSSQELFKNYTMFEKKYGDRRGIEDVIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDCE-VESVREVYERAIANVPLLPEKRHWRRYIYLWINFALFEELEMKDPDRTRQVYQGCLELIPHKKFTFSKIWLLFAQFEIRQKNLTAARKILGMSIGKCPKNKLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTTWMKFAELETILGDVERSRAIYELAVGQPRLDMPEVLWKSYIDFEIEQEECSRTRNLYRRLLQRTQHVKVWISFAKFEL---SVEGKER----VSRCRRVYEEGNRSLRSCEEKEERVMLLEAWRDFEDPFGNEDSRERVQKLMPSRVKKRRKVQTDDGSDAGWEEYYDYIFPEDSANQPNLKLL 659          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Sea Lamprey
Match: prpf6 (PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-2575])

HSP 1 Score: 62.003 bits (149), Expect = 3.714e-10
Identity = 86/439 (19.59%), Postives = 165/439 (37.59%), Query Frame = 1
Query:  325 ARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWM------AWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKN----WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKN-KLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAK 1608
            AR +  RA+      V +WL  A +E      ++AR +  +A   +P    +W     +EE   N     KI  R +        E   + W        K G +    A+ +  + +  +E++    W++ A    ++     AR++   AL  + S      +    A FE+     E ++ + + A+ + PK  +E ++    + +   GD    +  + +  Q         N +  + W + +K+ E EN   +  R +  +A ++ P                  ++  E   G I RA E+  + L H       F K+W+ K +I  + +    AR      + +C  +  L+    ++E  + +  R R +  K  +  P   + W+E    EYR    + +     A    E      +W   I  EA+
Sbjct:  427 ARILLSRAVECCPTSVELWLALARLE----SYENARKVLNKARENIPTDRHIWITAAKLEEANGNTAMVEKIVDRAITSLRANGVEINREHWIQDAEECDKAGSVTTCQAVIRAVIGIGVEEEDRKHTWMEDADSCVSHGACECARAIYAFALQVFPSKK---SVWLRAAYFEKNHGTRESLEALLQRAVAHCPK--AEVLWLMGAKSKWMAGDVPAARSILALAFQ--------ANPNSEEIWLAAVKL-ESENNEDERARRLLAKARSSAP-----------TARVFMKSVKLEWVLGEIPRAKELSEEALRHYED----FPKLWMMKGQIEEQLQLNDKARDAYSQGLKKCPHSVALWLLLSRLEEHVGQLTRARAILEKARLKNPQNPELWLESVRLEYR-AGLKNIASTLMAKAMQECPSSGILWAEAIFLEAR 831          

HSP 2 Score: 52.373 bits (124), Expect = 3.612e-7
Identity = 69/335 (20.60%), Postives = 132/335 (39.40%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIW 1275
             WM+ A   +S      AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K     P  + ++K  K E        A+ +   AL  Y  D P   ++K   + EE+ + +++ ++ Y   L   P  ++  ++      E+  G ++T    I+       EK   +N  + + W   +++  E    + +I            L+ K         +    AIF E       ++++   +C  H PH     AK++
Sbjct:  550 TWMEDADSCVSHGACECARAIYAFALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWMAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEDERARRLLAKARSSAPTARVFMKSVKLEWVLGEIPRAKELSEEALRHY-EDFPKLWMMK--GQIEEQLQLNDKARDAYSQGLKKCPHSVA--LWLLLSRLEEHVG-QLTRARAIL-------EKARLKNPQNPELWLESVRL--EYRAGLKNIAST---------LMAKAMQECPSSGILWAEAIFLEARPQRKTKSVDALKKC-EHDPHVLLAVAKLF 859          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Sea Lamprey
Match: xab2 (XPA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-685])

HSP 1 Score: 61.2326 bits (147), Expect = 6.560e-10
Identity = 83/363 (22.87%), Postives = 145/363 (39.94%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTC--GNIDRAIEVYSQCL-LHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+ +A +    ++I  AR +FE+A  +  K V     +W ++AEMEL+ +    A  L  RA  +  R       Y    E ++N     +++K         + W    +LE+  G  +   A+Y + + +     +  I +A F E +N    +       +  +   N          KF ER   ++ ER +++++ AL+  P   ++  Y  Y + E++ G  +      V +R         E +  Y  +  YIK    E   +   R IYE+AI             +  +       F ++ C  G IDRA  VYS C  +  P    +F + W    E  I+  +  T R+ L
Sbjct:  400 WVAFAKYYEENDQIEDARTIFEKATKVALKSVDDLAGVWCEFAEMELRHENYDEALRLLRRATAMPSRKAD----YFDTSEPVQN-----RLYKSL-------KVWSMLADLEESLGTFKSTKAVYDRIIDLRIATPQIIINYAMFLEEHNYFEESYKAYERGIALFRWPNVFDIWNTYLVKFIERYGGKKLERARDLFEQALEGCPPKFAKSFYLLYAKLEEEHG--LARHAMAVYERGTRG----VEPSEQYSMFNIYIKRA-AEIYGVTHTRAIYEKAI----------EVLQDDHAREMCMRFADMECKLGEIDRARAVYSYCSQMSDPRTTLSFWQTW---KEFEIKHGNEDTVREML 726          

HSP 2 Score: 50.8322 bits (120), Expect = 9.131e-7
Identity = 55/247 (22.27%), Postives = 108/247 (43.72%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCIL--PRANQLWYKYV--YMEE-KLKNIDSARKIFKRWMAWEPPEQA---WHSFINLEKKYGEIEKAHAIYKKFVQ-VHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGS-----DNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQ 975
            W   A  E S       + V++R I++      I + YA    +    + +   YER + +   P    +W  Y+  ++E    K ++ AR +F++ +   PP+ A   +  +  LE+++G    A A+Y++  + V P E+    ++ F     R +    V  T  I+  +     D+    +   FA  E +  E +R + +Y Y         +   +Q + E+E K G++ T++E + +KR 
Sbjct:  489 WSMLADLEESLGTFKSTKAVYDRIIDLRIATPQIIINYAMFLEEHNYFEESYKAYERGIALFRWPNVFDIWNTYLVKFIERYGGKKLERARDLFEQALEGCPPKFAKSFYLLYAKLEEEHGLARHAMAVYERGTRGVEPSEQ----YSMFNIYIKRAAEIYGVTHTRAIYEKAIEVLQDDHAREMCMRFADMECKLGEIDRARAVYSYCSQMSDPRTTLSFWQTWKEFEIKHGNEDTVREMLRIKRS 731          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Sea Lamprey
Match: pdcd11 (programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE-030131-4076])

HSP 1 Score: 57.3806 bits (137), Expect = 9.871e-9
Identity = 31/147 (21.09%), Postives = 71/147 (48.30%), Query Frame = 1
Query:  235 YENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINI--HYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKR--WMAWEPPEQA--WHSFINLEKKYGEIEKAHAIYKKFVQ 657
            Y   +R+ + +   W+ Y SF + + +   AR + +RA+      + V + +K+A+++ +  +V+H   ++E  L   P+   +W  Y+ M  K       R +F+R   M + P      +  +++ E+K+G+      + +K ++
Sbjct: 1720 YNKMLRRFRQEKAVWLAYGSFLVQRGQTDSARRLMQRALKSLPEREHVDVIVKFAQLDFRSGEVEHGVAVFENTLSSYPKRTDIWSIYIDMLAKHGTAQQIRAVFERVVHMNFSPKRMKFFFKRYLDYERKHGDAASVQRVRQKALE 1866          

HSP 2 Score: 53.5286 bits (127), Expect = 1.854e-7
Identity = 51/251 (20.32%), Postives = 107/251 (42.63%), Query Frame = 1
Query:  376 IWLKYAEMELQCKQVQHARNLYERALCILPRANQ------LWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKN-WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNID--DIREIYERAI 1101
            +WL+Y    LQ  +V  AR + ERAL  +  + +      +W   + +E    +  S  + F+R +      +A+     +     + ++A  +Y K ++    EK  W+ +  F     +T  AR ++  AL     +     ++ +FA+ + R  E E    +++  L + PK    DI+  Y +   K G    I+          +E+V+  N       F + + ++ E ++ D   ++ + ++A+
Sbjct: 1626 VWLQYMAFHLQATEVDRARAVAERALKTISFSREEQEKLNVWVALLNLENLYGDEASLMRAFERAVQHNDALKAFRHLAQIYIGSDKFQQADVLYNKMLRRFRQEKAVWLAYGSFLVQRGQTDSARRLMQRALKSL-PEREHVDVIVKFAQLDFRSGEVEHGVAVFENTLSSYPK--RTDIWSIYIDMLAKHGTAQQIRAV--------FERVVHMNFSPKRMKFFFKRYLDYERKHGDAASVQRVRQKAL 1865          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Yeast
Match: CLF1 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs; homolog of Drosophila crooked neck protein; interacts with U1 snRNP proteins [Source:SGD;Acc:S000004107])

HSP 1 Score: 331.643 bits (849), Expect = 3.003e-104
Identity = 209/617 (33.87%), Postives = 330/617 (53.48%), Query Frame = 1
Query:  199 EKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYG--------SDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIAN-KPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLH--TPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELD-----RPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHA-LIWCSYA--------QLQLLDFDTEEEERFPEVL---------ARSREIFEEANKSLKKMESSQ-REMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI 1944
            E +EYQ +KR +YE  +++++L +  W++YA FEI Q+++ RAR++FERA+ +    + +W++Y + EL+ K + HARNL  RA+  LPR ++LWYKY+ +EE L N++  R ++ +W + EP   AW+SF++ E +         IY K+V  HP  + W+KW +FE  +  T   RSV + A+            SD     ++  FA +E  Q+E+ER   +Y+ A++  P   ++ +     ++EK+FGD  +I+ETI  KR+  YE +LS N +DYD W+ Y+ ++ E       I + +E+AI + +P    K    +         I             E   Q L+    PH+ FTF+KIW+  A+  IR  D+  ARK LG AIG C K K ++ YI++E  L EFDRVR +Y KFI F P+  Q W ++   E  L  ++RVR IY  AL    D         + + YI FE + +EFE   KL+RR LE  +++   W  +A        + QLLD    + E   E +           +R++FEEA    K+ +  Q R  +L+  K +E+ YGT+   E V  + PK I   K++  ++G+
Sbjct:   42 ELREYQRRKRTEYEGYLKRNRLDMGQWIRYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWNGVREIYSKYVMAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLVNSFAHWEAAQQEYERSSALYQIAIEKWPS--NQLLKAGLLDFEKQFGDINSIEETISYKRKMEYETILSNNAYDYDTWWLYLDLISESFPK--QIMQTFEKAIVDSRPKELSKNVQWKRYIYLWMRYICYVELELENSLLEEELFQRLIDDIIPHKHFTFSKIWLMYAKFLIRHDDVPKARKILGKAIGLCPKAKTFKGYIELEVKLKEFDRVRKIYEKFIEFQPSDLQIWSQYGELEENLGDWDRVRGIYTIALDENSDFLTKEAKIVLLQKYITFETESQEFEKARKLYRRYLELNQYSPQSWIEFAMYQTSTPTEQQLLDLAKLQSENVDEDIEFEITDENKLEARKVFEEAIVFFKEKDDKQGRLSILEALKDYEETYGTELDQETVKKRFPKVI---KKVRLQNGV 651          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Yeast
Match: RRP5 (RNA binding protein involved in synthesis of 18S and 5.8S rRNAs; component of ribosomal small subunit (SSU) processome and 90S preribosome; required for pre-rRNA packaging and compaction of processome into dense terminal balls; part of Mak21p-Noc2p-Rrp5p module that associates with nascent pre-rRNA during transcription with role in biogenesis of large ribosomal subunit; binds single stranded tracts of U's; relocalizes from nucleolus to nucleus upon DNA replication stress [Source:SGD;Acc:S000004842])

HSP 1 Score: 63.1586 bits (152), Expect = 1.149e-10
Identity = 56/265 (21.13%), Postives = 118/265 (44.53%), Query Frame = 1
Query:  337 FERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCIL---PRANQL--WYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKN--WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANK 1110
            FER +  +     +W+ Y   +LQ  +++ AR L ERAL  +     A +L  W   + +E      ++  ++F R   +          + + +   + +KA  ++K   +    EK   W+ W  F  ++N    AR++L  AL      N    ++++FA+ E  + + ER + +++  + + PK +  D++  Y + E K  DK  +++         +E+++++        F + K ++ E    D+    Y +A A +
Sbjct: 1464 FERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAERALKTINFREEAEKLNIWIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEISEKFDKAAELFKATAKKFGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRN-HIEVVRKFAQLEFAKGDPERGRSLFEGLVADAPKRI--DLWNVYVDQEVKAKDKKKVEDL--------FERIITKKITRKQAKFFFNKWLQFEESEGDEKTIEYVKAKATE 1717          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Nematostella
Match: EDO45828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV5])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 316/667 (47.38%), Postives = 448/667 (67.17%), Query Frame = 1
Query:   25 MNFNDDNFQASXXXXXXXXRNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKMESS-QREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            M  +D      +  KV KV+NK PAPVQIT+EQLLREAKER+LE +  PP+QKIS   E  EY+L+KR+ +E+NIRK++  + NW+KYA +E SQ EI RAR+V+ER++++ ++ ++IWLKYAEME++ +Q+ HARN+++RA+ ILPR NQ WYKY YMEE L NI  AR+IF+RWM WEP EQAWHS+IN+E +Y E+E A  IY++FV VHPD KNW+K+AKFEE       AR V   A+ FYG ++    +   F KFEE  +EH+RV+ IYKYALDNLPK   +++Y+++ ++EKK+GDK  I+  IV KR+  YE+ +  N ++YD WF Y+++ME E  ++  +RE+YER+IAN PL  +K  WRRYIYLWI YA++EEL   +I+R   VY  CL   PH KFTFAKIW+  A+  IRQK+LA ARK LG AIG+C K+KL+R YI +E  L EFDR R +Y KF+ F P     W+++A  E  L   +R R ++E A+ +  LD P  +WK+YIDFE   +EF++   L+ R+L++  H  +W SYAQ +L                ++R I++ A+K L+  E+  +R +LL+ WK+ ED YG + S   + N++P+ + +R+++  +DG    W E     FPDD     N  ++
Sbjct:    1 MASSDSGPMGKRVPKVAKVKNKAPAPVQITAEQLLREAKERQLELSLPPPKQKISDPDELAEYKLRKRKAFEDNIRKNRSVVANWLKYAQWEESQQEIQRARSVYERSLDVDHRNITIWLKYAEMEMRHRQINHARNIWDRAVTILPRVNQFWYKYTYMEEMLGNIAGARQIFERWMEWEPEEQAWHSYINMELRYKEVEHARTIYERFVLVHPDVKNWVKFAKFEERQGNIVGARGVYERAVEFYGEEHMDEKLFLAFGKFEEGCKEHDRVRTIYKYALDNLPKEQCQELYKSFTQHEKKYGDKGGIENVIVSKRKFQYEEEVKANPNNYDAWFDYLRLMEAE-ADVSTVRELYERSIANVPLAAEKTLWRRYIYLWINYALYEELMAKDIERTRLVYRACLDVIPHGKFTFAKIWLLYAQFEIRQKNLADARKALGTAIGKCPKDKLFREYIGLELQLREFDRCRKIYEKFLTFNPANCTTWVKYAELESVLGDVDRARALFELAVAQPLLDMPEVLWKAYIDFEINQEEFDHTRDLYERLLKRTNHVKVWISYAQFELTT-------GVEGCTDQARGIYKRADKQLRSAENKEERVLLLESWKELEDSYGDESSQTEMKNRMPRRVKRRRKLQADDGSDAGWEEYYDYIFPDDDTSMPNFKLL 659          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Nematostella
Match: EDO33185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX5])

HSP 1 Score: 65.4698 bits (158), Expect = 6.104e-11
Identity = 100/484 (20.66%), Postives = 192/484 (39.67%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKR-----------WMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKK-FVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKV---------------------------LSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKN-KLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAK 1608
            W+K A+ E    EI+  + V+ +A+      V IW    E+E    + + AR +  RA+   P + +LW        +L+  ++ARK+  +           W+     E+A ++   +EK    IE+A A  K   V+++ D+  WIK A+  E        ++++ T +     +    H   + A        +E  + IY +AL   P   S  +  AY  +EK +G + ++ E+++     H  K                               N +  + W + +K+ E EN      R++ +RA  N                 +  +I  E   GNI  A ++  + +   P     FAK+W+ K ++  ++K+L  AR+     + +C  +  L+    ++E    +  + R++  +     P   + W+E    E R  + +  R +   A++ E      +W   I  E +
Sbjct:  368 WIKAAAVE---TEIVAKKRVYRKALEHIPNSVRIWKAAVELE----EPEDARIMLSRAVECCPTSVELWLALA----RLETYENARKVLNKARENIPTDRLIWITAAKLEEANNNMPMVEKI---IERAVASLKSNGVEINRDQ--WIKDAEECEKAQSVETCQAIIRTVIGVGVEEEDRKHTWMDDADSCVANSAYECSRAIYAHALTVFPSKKSVWLRAAY--FEKNYGTRESL-ESLLQSAVKHCPKAEVLWLMGAKSKWMANDIPSARSILALAFQANPNSEEIWLAAVKL-ESENNEDQRARKLLQRARMN-----------ACTARVMMKSIKLEWVLGNIPEANKLLDEAVQKYPD----FAKLWMMKGQLQEQEKNLPEAREAYKTGVKKCPTSIPLWLLLSRLEEKTGQATKARSVLEQGRQRNPKSPELWLEAVRIETRGGRKDFARTLMAKAMQ-ECPTAGVLWSEAIFMEPR 815          

HSP 2 Score: 52.373 bits (124), Expect = 5.601e-7
Identity = 41/180 (22.78%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  220 QKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYME----EKLKNIDS--------------------------ARKIFKRWMAWEPP-EQAWHSFINLEKKYGEIEKAHAIYKKFVQVHP 666
            + R+ Y+  ++K    I  W+  +  E    +  +AR+V E+    + K   +WL+   +E +  +   AR L  +A+   P A  LW + ++ME     K +++D+                          AR  F R +  +P    AW  F   E ++G   +  ++  K VQV P
Sbjct:  719 EAREAYKTGVKKCPTSIPLWLLLSRLEEKTGQATKARSVLEQGRQRNPKSPELWLEAVRIETRGGRKDFARTLMAKAMQECPTAGVLWSEAIFMEPRPQRKTRSVDALKRCEHDAHVLLAVAKLFWSERKVSKARDWFNRAVKLDPDFGDAWAYFYRFELQHGTEAQQESVSHKCVQVEP 898          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Nematostella
Match: EDO38955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBJ3])

HSP 1 Score: 58.5362 bits (140), Expect = 8.407e-9
Identity = 62/292 (21.23%), Postives = 121/292 (41.44%), Query Frame = 1
Query:  229 QDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAI-NIHYKE----VSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKA----HAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDI 1077
            +D++  +       + W++Y +F +   EI +AR V ERA+  I ++E    ++IW+    +E          NLY                           +S  K+F+R +    P++ +   I +  +  + E A    H + K+F Q    +K WI++ +F     +   AR +L   L    +      I+ +FA  E +  + +R + + +  L N PK    DI+  Y +   K G   T+++         +E+V+  N       F + K ++ E ++ D++
Sbjct: 1508 EDFDRLVLSSPNNSVTWLQYMAFHLHTTEIDKARAVAERALRTISFREEREKLNIWVALMNLE----------NLYGTQ------------------------ESLIKVFERALQHNEPKKVFFHLITIYTQSEKTELAEKLFHTMTKRFSQ---SKKVWIEFGRFFMKTGKPDSARKLLQRGLKSLPTRKHVETIV-QFALMEFKNGDPQRGQTVLESVLSNYPK--RTDIWSVYIDMMSKQGHPDTVRQI--------FERVIHMNLSSRKMKFLFKKYLDFEREHGDEM 1751          

HSP 2 Score: 55.0694 bits (131), Expect = 9.414e-8
Identity = 50/227 (22.03%), Postives = 93/227 (40.97%), Query Frame = 1
Query:  439 YERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAW----EPPEQ--AWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAI 1101
            ++R +   P  +  W +Y+        ID AR + +R +      E  E+   W + +NLE  YG  E    ++++ +Q +  +K +         + +T +A  +  T    +        +  EF +F  +  + +  +++ +  L +LP     +    +   E K GD    Q  +        E VLS      D W  YI MM ++    D +R+I+ER I
Sbjct: 1510 FDRLVLSSPNNSVTWLQYMAFHLHTTEIDKARAVAERALRTISFREEREKLNIWVALMNLENLYGTQESLIKVFERALQHNEPKKVFFHLITIYTQSEKTELAEKLFHTMTKRFSQSK---KVWIEFGRFFMKTGKPDSARKLLQRGLKSLPTRKHVETIVQFALMEFKNGDPQRGQTVL--------ESVLSNYPKRTDIWSVYIDMMSKQGHP-DTVRQIFERVI 1724          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Nematostella
Match: EDO33251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSQ6])

HSP 1 Score: 51.6026 bits (122), Expect = 7.644e-7
Identity = 43/199 (21.61%), Postives = 90/199 (45.23%), Query Frame = 1
Query:  235 YENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKL-----KNIDSARKIFKRWMAWEP----PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSD--NPPPHILKE 798
            Y  +++++     +W     F   +N++  AR  F+     +      W KYA+ME +   ++ A+ ++E+ +  +  +  LW  Y+    +         +  R++F+R +A        ++ W ++I  EK  G++++  A+Y K   V P +     + KF+E  N   VA  + T  L+   ++    PP ++ E
Sbjct:    2 YWKSVKENPSDFTSWTYLLQFVEQENKLSSARKAFQTFFKRYPYCYGYWKKYADMERKNGNIEAAKEVFEQGVKAIACSVDLWVHYLNFSSQATKGQPDGPEIMRRLFERAIATAGQDFRSDKLWDAYIEWEKSQGQLQRVTALYDKLFTV-PTQNYAQHFEKFKEHINTHPVASVLQTEELLKLRAEVAAAPPGVISE 199          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Nematostella
Match: EDO29782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2N5])

HSP 1 Score: 49.6766 bits (117), Expect = 1.605e-6
Identity = 61/292 (20.89%), Postives = 120/292 (41.10%), Query Frame = 1
Query:  229 QDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAI-NIHYKE----VSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKA----HAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDI 1077
            +D++  +       + W++Y +F +   EI +AR V ERA+  I ++E    ++IW+    +E          NLY                           +S  K+F+R +    P++ +   I +  +  + E A    H + K+F Q    +  WI++ +F     +   AR +L   L    +      I+ +FA  E +  + +R + + +  L N PK    DI+  Y +   K G   T+++         +E+V+  N       F + K ++ E ++ D++
Sbjct:   11 EDFDRLVLSSPNNSVTWLQYMAFHLHTTEIDKARAVAERALRTISFREEREKLNIWVALMNLE----------NLY------------------------GTQESLIKVFERALQHNEPKKVFFHLITIYTQSEKTELAEKLFHTMTKRFSQ---SKTVWIEFGRFFMKTGKPDSARKLLQRGLKSLPTRKHVETIV-QFALMEFKNGDPQRGQTVLESVLSNYPK--RTDIWSVYIDMMSKQGHPDTVRQI--------FERVIHMNLSSRKMKFLFKKYLDFEREHGDEM 254          

HSP 2 Score: 48.521 bits (114), Expect = 3.845e-6
Identity = 50/227 (22.03%), Postives = 93/227 (40.97%), Query Frame = 1
Query:  439 YERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAW----EPPEQA--WHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAI 1101
            ++R +   P  +  W +Y+        ID AR + +R +      E  E+   W + +NLE  YG  E    ++++ +Q +  +K +         + +T +A  +  T    +        +  EF +F  +  + +  +++ +  L +LP     +    +   E K GD    Q  +        E VLS      D W  YI MM ++    D +R+I+ER I
Sbjct:   13 FDRLVLSSPNNSVTWLQYMAFHLHTTEIDKARAVAERALRTISFREEREKLNIWVALMNLENLYGTQESLIKVFERALQHNEPKKVFFHLITIYTQSEKTELAEKLFHTMTKRFSQSKT---VWIEFGRFFMKTGKPDSARKLLQRGLKSLPTRKHVETIVQFALMEFKNGDPQRGQTVL--------ESVLSNYPKRTDIWSVYIDMMSKQGHP-DTVRQIFERVI 227          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Medaka
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:101164119])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 315/648 (48.61%), Postives = 451/648 (69.60%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+   E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E SQ E+ RAR+++ERA+++ ++ +++WLKYAEME++ +QV HARN+++RA+ ILPR NQ WYKY YMEE L N+   R+ F+RWM WEP EQAWHS+IN E +Y E++KA  IY++FV VHP+ KNWIK+A+FEE +   + +R V   A  FYG D+   ++   FAKFEE Q+E ERV+ IYKYALD +PK  ++++++ Y  +EKKFGD+  I++ I+ KR+  YE+ +  N  +YD WF Y++++E +  + D +R++YERAIAN P I++K +WRRYIYLWI YA++EEL   + +R  +VY  CL   PH+KFTFAKIW+  A+  IRQK+L  ARK +G AIG+C KNKL + YI++E  L EFDR R LY K++ F P     WI+FA  E  L   ER R I+E A+ +  LD P  +WKSYIDFE + +EFEN   L++R+L++ +H  +W SYA+ + L  D       P+ LA+ R+IFEEANKS++   E  +R MLL+ W+ +E ++G+D S E V+  LP+ + +R+++  EDG    W E     FP+D     N+ ++
Sbjct:   18 KNKAPADVQITAEQLLREAKERELELLPPPPKQKITNAEELNDYKLRKRKAFEDNIRKNRTIISNWIKYAQWEESQKEVQRARSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEEMLGNVAGCRQAFERWMEWEPDEQAWHSYINFELRYKEVDKARTIYERFVMVHPEVKNWIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINKRRFQYEEEVKANPLNYDAWFDYLRLVESDG-DPDTVRDVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQACLDLMPHKKFTFAKIWLLFAQFEIRQKNLQAARKIMGTAIGKCPKNKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDVERSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKVWISYAKFE-LSVDG------PDRLAKCRQIFEEANKSMRNCEEKEERLMLLESWRDYEKEFGSDSSRERVSKLLPEKVKKRRKLTAEDGSDAGWEEYYDYIFPEDAANQPNLKLL 657          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Medaka
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:101164119])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 307/655 (46.87%), Postives = 444/655 (67.79%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHP-------DEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+   E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E SQ E+ RAR+++ERA+++ ++ +++WLKYAEME++ +QV HARN+++RA+ ILPR NQ WYKY YMEE L N+   R+ F+RWM WEP EQAWHS+IN E +Y E++KA  IY++++ +H         E NWIK+A+FEE +   + +R V   A  FYG D+   ++   FAKFEE Q+E ERV+ IYKYALD +PK  ++++++ Y  +EKKFGD+  I++ I+ KR+  YE+ +  N  +YD WF Y++++E +  + D +R++YERAIAN P I++K +WRRYIYLWI YA++EEL      +    ++ CLL     KFTFAKIW+  A+  IRQK+L  ARK +G AIG+C KNKL + YI++E  L EFDR R LY K++ F P     WI+FA  E  L   ER R I+E A+ +  LD P  +WKSYIDFE + +EFEN   L++R+L++ +H  +W SYA+ + L  D       P+ LA+ R+IFEEANKS++   E  +R MLL+ W+ +E ++G+D S E V+  LP+ + +R+++  EDG    W E     FP+D     N+ ++
Sbjct:   19 KNKAPADVQITAEQLLREAKERELELLPPPPKQKITNAEELNDYKLRKRKAFEDNIRKNRTIISNWIKYAQWEESQKEVQRARSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEEMLGNVAGCRQAFERWMEWEPDEQAWHSYINFELRYKEVDKARTIYERYILLHHLFDHFDLTETNWIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINKRRFQYEEEVKANPLNYDAWFDYLRLVESDG-DPDTVRDVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEV----KVGSSFTSCLLS----KFTFAKIWLLFAQFEIRQKNLQAARKIMGTAIGKCPKNKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDVERSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKVWISYAKFE-LSVDG------PDRLAKCRQIFEEANKSMRNCEEKEERLMLLESWRDYEKEFGSDSSRERVSKLLPEKVKKRRKLTAEDGSDAGWEEYYDYIFPEDAANQPNLKLL 657          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Medaka
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:101164119])

HSP 1 Score: 527.324 bits (1357), Expect = 1.531e-178
Identity = 299/648 (46.14%), Postives = 431/648 (66.51%), Query Frame = 1
Query:   82 RNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAAL-KAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKM-ESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGI-PTWIESSSLEFPDDVQQDHNMSVI 2016
            +NK PA VQIT+EQLLREAKERELE  P PP+QKI+   E  +Y+L+KR+ +E+NIRK++  I NW+KYA +E SQ E+ RAR+++ERA+++ ++ +++WLKYAEME++ +QV HARN+++RA+ ILPR NQ WYKY YMEE L N+   R+ F+RWM WEP EQAWHS+IN E +Y E++KA  IY++FV VHP+ KNWIK+A+FEE +   + +R V   A  FYG D+   ++   FAKFEE Q+E ERV+ IYKYALD +PK  ++++++ Y  +EKKFGD+  I++ I+ KR+  YE+ +  N  +YD WF Y++++E +  + D +R++YERAIAN P I++K +WRRYIYLWI YA++EEL   + +R  +VY  CL   PH+K                           G AIG+C KNKL + YI++E  L EFDR R LY K++ F P     WI+FA  E  L   ER R I+E A+ +  LD P  +WKSYIDFE + +EFEN   L++R+L++ +H  +W SYA+ + L  D       P+ LA+ R+IFEEANKS++   E  +R MLL+ W+ +E ++G+D S E V+  LP+ + +R+++  EDG    W E     FP+D     N+ ++
Sbjct:   18 KNKAPADVQITAEQLLREAKERELELLPPPPKQKITNAEELNDYKLRKRKAFEDNIRKNRTIISNWIKYAQWEESQKEVQRARSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEEMLGNVAGCRQAFERWMEWEPDEQAWHSYINFELRYKEVDKARTIYERFVMVHPEVKNWIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINKRRFQYEEEVKANPLNYDAWFDYLRLVESDG-DPDTVRDVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQACLDLMPHKK---------------------------GTAIGKCPKNKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDVERSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKVWISYAKFE-LSVDG------PDRLAKCRQIFEEANKSMRNCEEKEERLMLLESWRDYEKEFGSDSSRERVSKLLPEKVKKRRKLTAEDGSDAGWEEYYDYIFPEDAANQPNLKLL 630          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Medaka
Match: prpf6 (pre-mRNA processing factor 6 [Source:NCBI gene;Acc:101162926])

HSP 1 Score: 63.5438 bits (153), Expect = 6.183e-10
Identity = 84/439 (19.13%), Postives = 168/439 (38.27%), Query Frame = 1
Query:  325 ARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWM------AWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKN----WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKN-KLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAK 1608
            AR +  RA+      V +WL  A +E      ++AR +  +A   +P    +W     +EE   N     KI  R +        E     W        K G +    A+ +  + +  +E++    W++ A     +     AR++   AL  + S      +    A FE+     E ++ + + A+ + PK  +E ++    + +   GD    +  + +  Q         N +  + W + +K+ E EN   +  R +  +A ++ P                  ++  E   GNI+ A ++ ++ L H       F K+W+ + +I  + +++  AR+     + +C  +  L+    ++E  + +  R R +  K  +  P     W+E    EYR         +   AL+ E      +W   +  EA+
Sbjct:  447 ARIMLSRAVECCPTSVELWLALARLE----TYENARRVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINRDQWIQDAEECDKAGSVATCQAVIRAVIGIGIEEEDRKHTWMEDADSCVAHGALECARAIYAHALQVFPSKK---SVWLRAAYFEKNHGTRESLEALLQRAVAHCPK--AEVLWLMGAKSKWLAGDVPAARSILALAFQ--------ANPNSEEIWLAAVKL-ESENNEYERARRLLAKARSSAP-----------TARVFMKSVKLEWVLGNIEAAQDLCTEALKHYED----FPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVALWFLLSRLEERVGQLTRARAILEKSRLKNPQCADLWLESVRLEYRAGLKNIANTLMAKALQ-ECPNSGILWAEAVFLEAR 851          

HSP 2 Score: 57.3806 bits (137), Expect = 4.967e-8
Identity = 71/335 (21.19%), Postives = 134/335 (40.00%), Query Frame = 1
Query:  274 NWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEP-PEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIW 1275
             WM+ A   ++   +  AR ++  A+ +   + S+WL+ A  E      +    L +RA+   P+A  LW      +    ++ +AR I        P  E+ W + + LE +  E E+A  +  K     P  + ++K  K E        A+ + T AL  Y  D P   +++   + EE+    ++ +E Y   L   P  ++  ++      E++ G ++T    I+       EK   +N    D W   +++  E    + +        IAN  L+ K         +    A+F E       ++++   +C  H PH     AK++
Sbjct:  570 TWMEDADSCVAHGALECARAIYAHALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAAQDLCTEALKHY-EDFPKLWMMR--GQIEEQCENMDKAREAYNQGLKKCPHSVA--LWFLLSRLEERVG-QLTRARAIL-------EKSRLKNPQCADLWLESVRL--EYRAGLKN--------IANT-LMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKC-EHDPHVLLAVAKLF 879          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Medaka
Match: xab2 (XPA binding protein 2 [Source:NCBI gene;Acc:101157537])

HSP 1 Score: 60.077 bits (144), Expect = 7.170e-9
Identity = 87/361 (24.10%), Postives = 152/361 (42.11%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEV----SIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVH-PDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEER--QREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCL-LHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTL 1335
            W+ +A F     ++  AR +FE+A  +++K+V    ++W +Y EMEL+ +        Y++AL IL +A  +  K      K +  DS+  +  R        + W    +LE+  G  +   A+Y + + +     +  I +A F E +N    +       +  +   N          KF +R   ++ ER +++++ ALD  P   ++ IY  Y + E+++G  +      V +R    + V  E  H    +  YIK    E   +   R IY++AI   P    +    R+  +        E   G IDRA  +YS C  +  P     F + W    E  IR  +  T R+ L
Sbjct:  393 WVCFAKFYEENEQLDDARTIFEKATKVNFKQVDDLAAVWCEYGEMELRHEN-------YDQALRILRKATAIPSK------KAEYFDSSEPVQNRVYK---SLKVWSMLADLEESLGTFQSTKAVYDRIIDLRIATPQIIINYAMFLEEHNYFEESFKAYERGIALFKWPNVYDIWNTYLTKFIDRYGGKKLERARDLFEQALDGCPAKFAKTIYLLYAKLEEEYG--LARHAMAVYERAT--QAVEPEERHHM--FNIYIKRA-AEIYGVTYTRAIYQKAIEVLPDEHARDMCLRFADM--------ESKLGEIDRARAIYSYCSQICDPRLTANFWQTW---KEFEIRHGNEDTIREML 719          

HSP 2 Score: 53.9138 bits (128), Expect = 5.638e-7
Identity = 57/246 (23.17%), Postives = 109/246 (44.31%), Query Frame = 1
Query:  277 WMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCIL--PRANQLWYKYV--YMEE-KLKNIDSARKIFKRWMAWEPPEQA---WHSFINLEKKYGEIEKAHAIYKKFVQ-VHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGS-----DNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKR 972
            W   A  E S       + V++R I++      I + YA    +    + +   YER + +   P    +W  Y+  +++    K ++ AR +F++ +   P + A   +  +  LE++YG    A A+Y++  Q V P+E++ +    F     R +    V  T  I+  +     D     +   FA  E +  E +R + IY Y        L+ + +Q + E+E + G++ TI+E + +KR
Sbjct:  482 WSMLADLEESLGTFQSTKAVYDRIIDLRIATPQIIINYAMFLEEHNYFEESFKAYERGIALFKWPNVYDIWNTYLTKFIDRYGGKKLERARDLFEQALDGCPAKFAKTIYLLYAKLEEEYGLARHAMAVYERATQAVEPEERHHM----FNIYIKRAAEIYGVTYTRAIYQKAIEVLPDEHARDMCLRFADMESKLGEIDRARAIYSYCSQICDPRLTANFWQTWKEFEIRHGNEDTIREMLRIKR 723          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Planmine SMEST
Match: SMESG000006174.1 (SMESG000006174.1)

HSP 1 Score: 1305.43 bits (3377), Expect = 0.000e+0
Identity = 676/678 (99.71%), Postives = 678/678 (100.00%), Query Frame = 1
Query:   25 MNFNDDNFQASXXXXXXXXRNKTPAPVQITSXXXXXXXXXXXXXXTPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKMESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVIDDFLKNVQNWDISI 2058
            MNFNDDNFQASKKTKVTKVRNKTPAPVQITSEQLLREAKERELEATPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEE+NNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKYYWRRYIYLWIRYAIFEELTCGNIDRAIEVYSQCLLHTPH+KFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKMESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVIDDFLKNVQNWDISI
Sbjct:    1 MNFNDDNFQASKKTKVTKVRNKTPAPVQITSEQLLREAKERELEATPKPPQQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIEKAHAIYKKFVQVHPDEKNWIKWAKFEESNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDDIREIYERAIANKPLIEKKYYWRRYIYLWIRYAIFEELTCGNIDRAIEVYSQCLLHTPHKKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIYEAALKAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHALIWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKMESSQREMLLKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLEFPDDVQQDHNMSVIDDFLKNVQNWDISI 678          
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Planmine SMEST
Match: SMESG000011657.1 (SMESG000011657.1)

HSP 1 Score: 50.447 bits (119), Expect = 4.962e-6
Identity = 95/458 (20.74%), Postives = 189/458 (41.27%), Query Frame = 1
Query:  280 MKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEK---LKNIDSARKIFKRWMAWEPPEQA-WHSFINLE-----------KKYGEIEKAHAIYKKFVQVHPDEKN------------------WIKWAKFEETNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSE---DIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMME--EENQNIDDIREIYERAIANKPLIEKKXXXXXXXXXXXXXAIFEELTCGNIDRAIEVYSQCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAI-GRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIY 1536
            M  +  E++  +I ++R + +   + +  +VS W+     E    ++  A+ L  +     P + ++W + + + ++     NI  A+ +  + +   P   + W +  NLE           +   EI  +  ++K  V++  D +                   W+  AK     N  + AR+VL TA     +D     I     K EE +   E+++ + + A++ L   + E   D +    E  +K G+K+T Q+ I        ++V+S    + D   +++   E  EE+  ++  R IY  AI++  L +KK        +W R A FE+   G  +   ++ SQ + H      T   +W+  A+      D+ +AR  L  A        ++    +K+E++  EFDR   L  +  +   T ++ W++ A  E+ L   +    + 
Sbjct:  257 MNPSGSEVA--DIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKL----NNPTEARAVLNTARQKIPNDR---QIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKII--------QRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISS--LSKKK-------GIWKRAAAFEK-EHGTRENYEKILSQAVEHCD----TVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGT-DRVWMKSARLEWCLGNLDSAETLL 682          
The following BLAST results are available for this feature:
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRNKL10.000e+047.53crooked neck pre-mRNA splicing factor 1 [Source:HG... [more]
CRNKL10.000e+047.53crooked neck pre-mRNA splicing factor 1 [Source:HG... [more]
CRNKL10.000e+047.53crooked neck pre-mRNA splicing factor 1 [Source:HG... [more]
PRPF61.253e-819.36pre-mRNA processing factor 6 [Source:HGNC Symbol;A... [more]
XAB22.113e-721.33XPA binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
M03F8.31.221e-17945.97pep chromosome:WBcel235:V:5940024:5943362:1 gene:W... [more]
M03F8.32.729e-17845.90pep chromosome:WBcel235:V:5940024:5943362:1 gene:W... [more]
syf-14.606e-722.04SYF pre-mRNA splicing factor homolog [Source:UniP... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crn3.653e-17745.23gene:FBgn0000377 transcript:FBtr0070418[more]
CG68413.813e-724.77gene:FBgn0036828 transcript:FBtr0346816[more]
CG68413.813e-724.77gene:FBgn0036828 transcript:FBtr0075068[more]
fand3.375e-622.05gene:FBgn0033859 transcript:FBtr0087623[more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crnkl10.000e+047.22crooked neck pre-mRNA splicing factor 1 [Source:ZF... [more]
xab26.358e-1023.27XPA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
prpf63.482e-921.79PRP6 pre-mRNA processing factor 6 homolog (S. cere... [more]
prpf63.610e-921.79PRP6 pre-mRNA processing factor 6 homolog (S. cere... [more]
pdcd112.261e-822.22programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serpinb10.000e+047.38serpin family B member 1 [Source:Xenbase;Acc:XB-GE... [more]
serpinb10.000e+046.30serpin family B member 1 [Source:Xenbase;Acc:XB-GE... [more]
serpinb10.000e+046.30serpin family B member 1 [Source:Xenbase;Acc:XB-GE... [more]
adgrb12.456e-1022.25adhesion G protein-coupled receptor B1 [Source:Xen... [more]
adgrb15.097e-1022.19adhesion G protein-coupled receptor B1 [Source:Xen... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crnkl10.000e+047.69crooked neck pre-mRNA splicing factor 1 [Source:MG... [more]
Prpf62.098e-1019.59pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:... [more]
Prpf62.098e-1019.59pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:... [more]
Xab21.649e-721.49XPA binding protein 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Pdcd115.993e-723.17programmed cell death 11 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63155|CRNL1_RAT0.000e+047.69Crooked neck-like protein 1 OS=Rattus norvegicus O... [more]
sp|P63154|CRNL1_MOUSE0.000e+047.69Crooked neck-like protein 1 OS=Mus musculus OX=100... [more]
sp|Q9BZJ0|CRNL1_HUMAN0.000e+047.53Crooked neck-like protein 1 OS=Homo sapiens OX=960... [more]
sp|P17886|CRN_DROME3.662e-17645.23Protein crooked neck OS=Drosophila melanogaster OX... [more]
sp|Q5BDX1|CLF1_EMENI4.408e-16942.08Pre-mRNA-splicing factor clf1 OS=Emericella nidula... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LQG40.000e+048.96Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0R3UJ630.000e+049.09Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3SHV10.000e+048.00Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A158QHU70.000e+048.00Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A1S8WTJ50.000e+048.52HAT repeat protein (Fragment) OS=Opisthorchis vive... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crnkl10.000e+047.69crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
xab22.914e-821.82XPA binding protein 2 [Source:NCBI gene;Acc:103039... [more]
prpf395.180e-725.47pre-mRNA processing factor 39 [Source:NCBI gene;Ac... [more]
prpf398.681e-725.47pre-mRNA processing factor 39 [Source:NCBI gene;Ac... [more]
prpf62.356e-622.44pre-mRNA processing factor 6 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crnkl10.000e+047.30crooked neck pre-mRNA splicing factor 1 [Source:ZF... [more]
prpf63.714e-1019.59PRP6 pre-mRNA processing factor 6 homolog (S. cere... [more]
xab26.560e-1022.87XPA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pdcd119.871e-921.09programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CLF13.003e-10433.87Member of the NineTeen Complex (NTC); this complex... [more]
RRP51.149e-1021.13RNA binding protein involved in synthesis of 18S a... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458280.000e+047.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331856.104e-1120.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389558.407e-921.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332517.644e-721.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297821.605e-620.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crnkl10.000e+048.61crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
crnkl10.000e+046.87crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
crnkl11.531e-17846.14crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
prpf66.183e-1019.13pre-mRNA processing factor 6 [Source:NCBI gene;Acc... [more]
xab27.170e-924.10XPA binding protein 2 [Source:NCBI gene;Acc:101157... [more]
back to top
BLAST of Crooked neck pre-mRNA splicing factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000006174.10.000e+099.71SMESG000006174.1[more]
SMESG000011657.14.962e-620.74SMESG000011657.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033191 ID=SMED30033191|Name=Crooked neck pre-mRNA splicing factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2100bp
ATCTATATAAATCTTATATGAGCTATGAATTTTAATGACGATAATTTTCA
AGCTTCCAAAAAAACAAAAGTAACCAAAGTTCGAAATAAAACACCAGCAC
CCGTTCAAATAACATCAGAACAATTGTTAAGAGAAGCAAAAGAAAGAGAA
TTAGAAGCAACTCCTAAACCTCCACAGCAAAAGATAAGTACGGAAACTGA
AAAGAAAGAATATCAATTGCAAAAAAGACAGGATTATGAAAATAATATTC
GTAAAGATAAATTAAAAATAATCAACTGGATGAAATATGCTTCATTCGAA
ATTTCGCAAAATGAAATACTTCGAGCCAGAAATGTATTTGAAAGAGCAAT
AAATATCCACTACAAAGAAGTTTCAATTTGGTTGAAATATGCTGAAATGG
AACTTCAATGTAAACAAGTTCAACATGCAAGAAATCTTTATGAAAGAGCT
TTGTGTATTTTACCAAGAGCTAATCAATTATGGTACAAGTATGTTTATAT
GGAAGAAAAATTAAAAAACATTGACTCAGCACGAAAGATTTTCAAGCGAT
GGATGGCTTGGGAACCCCCTGAACAAGCATGGCATTCTTTTATCAATTTA
GAAAAAAAATATGGTGAAATTGAGAAAGCACATGCTATTTATAAGAAATT
CGTTCAAGTTCATCCCGATGAAAAGAATTGGATTAAATGGGCAAAATTTG
AAGAAACCAACAATCGAACCAGTGTAGCTAGAAGCGTTTTAACCACAGCT
CTGATTTTTTATGGCTCTGACAATCCTCCACCGCATATTTTAAAGGAATT
TGCAAAATTTGAAGAAAGACAACGAGAACACGAACGTGTTAAAGAAATTT
ATAAATATGCTTTGGACAATTTACCGAAATATTTATCCGAAGACATTTAT
CAAGCCTATTGTGAGTATGAAAAAAAATTTGGGGATAAAATGACAATCCA
AGAAACCATAGTTATGAAAAGACAGCATCACTATGAAAAAGTACTATCAG
AAAATACTCACGATTACGACGAATGGTTTAGTTATATAAAAATGATGGAA
GAGGAAAATCAAAATATCGATGATATCCGTGAAATCTACGAACGGGCGAT
TGCCAACAAGCCGTTGATCGAGAAGAAATATTACTGGCGAAGATATATTT
ATCTATGGATTAGATATGCGATATTCGAAGAGCTGACCTGTGGAAATATT
GACCGAGCTATCGAGGTCTATTCACAATGTCTGTTACACACTCCCCATAG
GAAATTCACATTTGCCAAAATTTGGATTTATAAAGCTGAAATTCACATTC
GACAAAAGGATTTGGCAACTGCTCGGAAAACGCTCGGCAATGCAATCGGT
CGGTGCGGTAAGAACAAATTGTACCGATATTACATCAAAATGGAAACCGA
TCTATTGGAATTCGACAGAGTACGCACGCTTTACAATAAGTTCATCGTTT
TTTATCCGACATATGAGCAAGCGTGGATCGAGTTCGCTAATTTCGAGTAT
CGATTGAAGCAATTCGAGCGAGTTCGATATATATATGAAGCTGCGCTGAA
AGCCGAATTAGATCGACCGTATTATGTTTGGAAAAGCTACATAGATTTTG
AGGCGAAAATTAAGGAATTCGAAAACTGTTGGAAGCTTCATAGGAGGATC
CTGGAACAAGAGGAACATGCATTAATCTGGTGCAGTTATGCTCAACTCCA
GTTGTTAGATTTCGATACAGAGGAAGAGGAAAGATTTCCAGAGGTGCTGG
CTCGGTCTCGCGAGATTTTCGAGGAAGCGAATAAATCTCTGAAGAAAATG
GAGAGCTCTCAAAGGGAAATGCTTTTAAAGTTCTGGAAGAAATTCGAGGA
TGATTATGGAACGGACGAGTCGATTGAATATGTAGCAAACAAATTACCGA
AGACAATAGTGCAGAGGAAACGAATCGATAATGAAGATGGCATCCCGACA
TGGATTGAATCAAGCAGTCTGGAATTCCCTGATGACGTGCAGCAAGATCA
TAACATGTCCGTTATTGACGACTTTCTTAAAAACGTTCAAAATTGGGATA
TAAGTATTTAGATTTGTTTCTATACGCGTTTCGTTTAAATAAAATTTGTG
back to top

protein sequence of SMED30033191-orf-1

>SMED30033191-orf-1 ID=SMED30033191-orf-1|Name=SMED30033191-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=679bp
MNFNDDNFQASKKTKVTKVRNKTPAPVQITSEQLLREAKERELEATPKPP
QQKISTETEKKEYQLQKRQDYENNIRKDKLKIINWMKYASFEISQNEILR
ARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRAN
QLWYKYVYMEEKLKNIDSARKIFKRWMAWEPPEQAWHSFINLEKKYGEIE
KAHAIYKKFVQVHPDEKNWIKWAKFEETNNRTSVARSVLTTALIFYGSDN
PPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSEDIYQAYCEYEK
KFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMMEEENQNIDD
IREIYERAIANKPLIEKKYYWRRYIYLWIRYAIFEELTCGNIDRAIEVYS
QCLLHTPHRKFTFAKIWIYKAEIHIRQKDLATARKTLGNAIGRCGKNKLY
RYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERV
RYIYEAALKAELDRPYYVWKSYIDFEAKIKEFENCWKLHRRILEQEEHAL
IWCSYAQLQLLDFDTEEEERFPEVLARSREIFEEANKSLKKMESSQREML
LKFWKKFEDDYGTDESIEYVANKLPKTIVQRKRIDNEDGIPTWIESSSLE
FPDDVQQDHNMSVIDDFLKNVQNWDISI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR003107HAT
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 338..361
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..61
NoneNo IPR availablePANTHERPTHR11246PRE-MRNA SPLICING FACTORcoord: 19..664
NoneNo IPR availablePANTHERPTHR11246:SF3CROOKED NECK-LIKE PROTEIN 1coord: 19..664
IPR003107HAT (Half-A-TPR) repeatSMARTSM00386hat_new_1coord: 461..493
e-value: 4.6E-5
score: 32.8
coord: 346..380
e-value: 0.0032
score: 26.7
coord: 62..94
e-value: 110.0
score: 7.8
coord: 267..301
e-value: 4.4E-5
score: 32.9
coord: 230..265
e-value: 27.0
score: 12.2
coord: 197..228
e-value: 1.9E-5
score: 34.1
coord: 428..459
e-value: 96.0
score: 8.2
coord: 130..162
e-value: 1.0E-5
score: 35.0
coord: 530..561
e-value: 370.0
score: 3.9
coord: 164..195
e-value: 0.06
score: 22.5
coord: 495..528
e-value: 0.0083
score: 25.3
coord: 96..128
e-value: 5.2E-5
score: 32.6
coord: 390..426
e-value: 67.0
score: 9.4
IPR003107HAT (Half-A-TPR) repeatPFAMPF02184HATcoord: 97..126
e-value: 1.6E-5
score: 24.8
coord: 198..228
e-value: 6.5E-14
score: 51.6
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 517..645
e-value: 7.1E-6
score: 27.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 111..314
e-value: 1.6E-43
score: 151.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 460..515
e-value: 2.2E-8
score: 36.2
coord: 319..459
e-value: 1.8E-19
score: 72.3
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 72..541
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 515..623
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 82..183
score: 13.101
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 183..216
score: 7.61