Calcium/calmodulin-dependent protein kinase type II

Overview
NameCalcium/calmodulin-dependent protein kinase type II
Smed IDSMED30033189
Length (bp)2443
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium/calmodulin-dependent protein kinase type II (SMED30033189) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase type II (SMED30033189) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium/calmodulin-dependent protein kinase type II (SMED30033189) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase type II (SMED30033189) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033189 SmedASXL_050036SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30033189SMESG000029689.1 dd_Smed_v4_4320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033189SMESG000029689.1 dd_Smed_v4_4320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033189SMESG000029689.1 dd_Smed_v4_4320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033189SMESG000029689.1 dd_Smed_v4_7358_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033189SMESG000029689.1 dd_Smed_v4_4320_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Human
Match: CAMK2D (calcium/calmodulin dependent protein kinase II delta [Source:HGNC Symbol;Acc:HGNC:1462])

HSP 1 Score: 421.009 bits (1081), Expect = 0.000e+0
Identity = 195/302 (64.57%), Postives = 242/302 (80.13%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 470          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Human
Match: CAMK2D (calcium/calmodulin dependent protein kinase II delta [Source:HGNC Symbol;Acc:HGNC:1462])

HSP 1 Score: 416.772 bits (1070), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Human
Match: CAMK2D (calcium/calmodulin dependent protein kinase II delta [Source:HGNC Symbol;Acc:HGNC:1462])

HSP 1 Score: 416.772 bits (1070), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Human
Match: CAMK2D (calcium/calmodulin dependent protein kinase II delta [Source:HGNC Symbol;Acc:HGNC:1462])

HSP 1 Score: 416.772 bits (1070), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.411 bits (716), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Human
Match: CAMK2D (calcium/calmodulin dependent protein kinase II delta [Source:HGNC Symbol;Acc:HGNC:1462])

HSP 1 Score: 416.387 bits (1069), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 385.571 bits (989), Expect = 0.000e+0
Identity = 180/309 (58.25%), Postives = 236/309 (76.38%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKK----TITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVL+KDPY K VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK LI+SML +N  KRI+A  AL+ PWIC RERVASA HRQ+TVDCLKKFNARRKLKGAILTTMIATRN SN      N  ++    TI +++E + T D++D  + +KQ++++VT+ L   I+  D+ ++ +L D  +T FEP + GNL+EGIEF +F+FD     R  + ++  +L+P VH++ +D A +AY+K+TQ++DR G  + +QS+E+RVW KK+G+W+ VH H S   S
Sbjct:  170 GFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFD---GNRKNQ-VHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRSTQPS 474          

HSP 2 Score: 278.87 bits (712), Expect = 0.000e+0
Identity = 131/164 (79.88%), Postives = 149/164 (90.85%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSW 565
             K SD YD+KEELG+GAFS+VRRCV K+T LEFAAKIINTKKL+ARD QKLEREARICR L+HPNIVRLHD+IQ+E FHY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILES+ YCH + IVHRDLKPENL+LASK KGAAVKLADFGLAIEV  D+ +W
Sbjct:    6 TKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN-DSEAW 168          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 385.571 bits (989), Expect = 0.000e+0
Identity = 180/309 (58.25%), Postives = 236/309 (76.38%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKK----TITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVL+KDPY K VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK LI+SML +N  KRI+A  AL+ PWIC RERVASA HRQ+TVDCLKKFNARRKLKGAILTTMIATRN SN      N  ++    TI +++E + T D++D  + +KQ++++VT+ L   I+  D+ ++ +L D  +T FEP + GNL+EGIEF +F+FD     R  + ++  +L+P VH++ +D A +AY+K+TQ++DR G  + +QS+E+RVW KK+G+W+ VH H S   S
Sbjct:  170 GFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFD---GNRKNQ-VHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRSTQPS 474          

HSP 2 Score: 278.87 bits (712), Expect = 0.000e+0
Identity = 131/164 (79.88%), Postives = 149/164 (90.85%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSW 565
             K SD YD+KEELG+GAFS+VRRCV K+T LEFAAKIINTKKL+ARD QKLEREARICR L+HPNIVRLHD+IQ+E FHY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILES+ YCH + IVHRDLKPENL+LASK KGAAVKLADFGLAIEV  D+ +W
Sbjct:    6 TKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN-DSEAW 168          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 385.571 bits (989), Expect = 0.000e+0
Identity = 180/309 (58.25%), Postives = 236/309 (76.38%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKK----TITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVL+KDPY K VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK LI+SML +N  KRI+A  AL+ PWIC RERVASA HRQ+TVDCLKKFNARRKLKGAILTTMIATRN SN      N  ++    TI +++E + T D++D  + +KQ++++VT+ L   I+  D+ ++ +L D  +T FEP + GNL+EGIEF +F+FD     R  + ++  +L+P VH++ +D A +AY+K+TQ++DR G  + +QS+E+RVW KK+G+W+ VH H S   S
Sbjct:  170 GFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFD---GNRKNQ-VHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRSTQPS 474          

HSP 2 Score: 278.87 bits (712), Expect = 0.000e+0
Identity = 131/164 (79.88%), Postives = 149/164 (90.85%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSW 565
             K SD YD+KEELG+GAFS+VRRCV K+T LEFAAKIINTKKL+ARD QKLEREARICR L+HPNIVRLHD+IQ+E FHY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILES+ YCH + IVHRDLKPENL+LASK KGAAVKLADFGLAIEV  D+ +W
Sbjct:    6 TKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN-DSEAW 168          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 368.622 bits (945), Expect = 1.222e-178
Identity = 179/345 (51.88%), Postives = 237/345 (68.70%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGK--KTITDTTEVTSTNDESDD--------------------------------------LRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVL+KDPY K VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK LI+SML +N  KRI+A  AL+ PWIC RERVASA HRQ+TVDCLKKFNARRKLKGAILTTMIATRN S++++ +        TI +++E + T D++D                                       L  +KQ++++VT+ L   I+  D+ ++ +L D  +T FEP + GNL+EGIEF +F+FD     R  + ++  +L+P VH++ +D A +AY+K+TQ++DR G  + +QS+E+RVW KK+G+W+ VH H S   S
Sbjct:  170 GFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSSRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKGGGQLKHENTVVRADGATGIVSSSNSSTASKSSSTNLSAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFD---GNRKNQ-VHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRSTQPS 510          

HSP 2 Score: 278.87 bits (712), Expect = 1.222e-178
Identity = 131/164 (79.88%), Postives = 149/164 (90.85%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSW 565
             K SD YD+KEELG+GAFS+VRRCV K+T LEFAAKIINTKKL+ARD QKLEREARICR L+HPNIVRLHD+IQ+E FHY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILES+ YCH + IVHRDLKPENL+LASK KGAAVKLADFGLAIEV  D+ +W
Sbjct:    6 TKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN-DSEAW 168          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 368.622 bits (945), Expect = 1.222e-178
Identity = 179/345 (51.88%), Postives = 237/345 (68.70%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGK--KTITDTTEVTSTNDESDD--------------------------------------LRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVL+KDPY K VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK LI+SML +N  KRI+A  AL+ PWIC RERVASA HRQ+TVDCLKKFNARRKLKGAILTTMIATRN S++++ +        TI +++E + T D++D                                       L  +KQ++++VT+ L   I+  D+ ++ +L D  +T FEP + GNL+EGIEF +F+FD     R  + ++  +L+P VH++ +D A +AY+K+TQ++DR G  + +QS+E+RVW KK+G+W+ VH H S   S
Sbjct:  170 GFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSSRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKGGGQLKHENTVVRADGATGIVSSSNSSTASKSSSTNLSAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFD---GNRKNQ-VHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRSTQPS 510          

HSP 2 Score: 278.87 bits (712), Expect = 1.222e-178
Identity = 131/164 (79.88%), Postives = 149/164 (90.85%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSW 565
             K SD YD+KEELG+GAFS+VRRCV K+T LEFAAKIINTKKL+ARD QKLEREARICR L+HPNIVRLHD+IQ+E FHY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILES+ YCH + IVHRDLKPENL+LASK KGAAVKLADFGLAIEV  D+ +W
Sbjct:    6 TKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN-DSEAW 168          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0300377)

HSP 1 Score: 424.476 bits (1090), Expect = 0.000e+0
Identity = 192/305 (62.95%), Postives = 246/305 (80.66%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLR-IKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDS 1475
            GFAGTPGYLSPEVL+K+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LYSQIK+GA+DYPSPEWDTVT EAK+LIN ML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++S+ +       + ++T+ +ST  E DD++  ++QE++K+TE L   I +GD+  + K+ DP +T FEP + GNL+EGI+F KF+F+    K + K+IN  IL+P VHLL ++ A IAY+++TQY+D+QG  +  QSEETRVW K++ KW NVH+H S  +
Sbjct:  173 GFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVEGIDFHKFYFENVLGK-NCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASA 476          

HSP 2 Score: 286.189 bits (731), Expect = 0.000e+0
Identity = 133/165 (80.61%), Postives = 149/165 (90.30%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD YDIKEELG+GAFSIV+RCVQKST  EFAAKIINTKKL ARD QKLEREARICR L HPNIVRLHD+IQ+E +HY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILESVN+CH + +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    8 TRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0089217)

HSP 1 Score: 424.476 bits (1090), Expect = 0.000e+0
Identity = 192/305 (62.95%), Postives = 246/305 (80.66%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLR-IKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDS 1475
            GFAGTPGYLSPEVL+K+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LYSQIK+GA+DYPSPEWDTVT EAK+LIN ML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++S+ +       + ++T+ +ST  E DD++  ++QE++K+TE L   I +GD+  + K+ DP +T FEP + GNL+EGI+F KF+F+    K + K+IN  IL+P VHLL ++ A IAY+++TQY+D+QG  +  QSEETRVW K++ KW NVH+H S  +
Sbjct:  173 GFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVEGIDFHKFYFENVLGK-NCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASA 476          

HSP 2 Score: 286.189 bits (731), Expect = 0.000e+0
Identity = 133/165 (80.61%), Postives = 149/165 (90.30%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD YDIKEELG+GAFSIV+RCVQKST  EFAAKIINTKKL ARD QKLEREARICR L HPNIVRLHD+IQ+E +HY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILESVN+CH + +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    8 TRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0089218)

HSP 1 Score: 424.476 bits (1090), Expect = 0.000e+0
Identity = 192/305 (62.95%), Postives = 246/305 (80.66%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLR-IKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDS 1475
            GFAGTPGYLSPEVL+K+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LYSQIK+GA+DYPSPEWDTVT EAK+LIN ML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++S+ +       + ++T+ +ST  E DD++  ++QE++K+TE L   I +GD+  + K+ DP +T FEP + GNL+EGI+F KF+F+    K + K+IN  IL+P VHLL ++ A IAY+++TQY+D+QG  +  QSEETRVW K++ KW NVH+H S  +
Sbjct:  173 GFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVEGIDFHKFYFENVLGK-NCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASA 476          

HSP 2 Score: 286.189 bits (731), Expect = 0.000e+0
Identity = 133/165 (80.61%), Postives = 149/165 (90.30%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD YDIKEELG+GAFSIV+RCVQKST  EFAAKIINTKKL ARD QKLEREARICR L HPNIVRLHD+IQ+E +HY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILESVN+CH + +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    8 TRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0333673)

HSP 1 Score: 423.705 bits (1088), Expect = 0.000e+0
Identity = 191/304 (62.83%), Postives = 243/304 (79.93%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDS 1475
            GFAGTPGYLSPEVL+K+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LYSQIK+GA+DYPSPEWDTVT EAK+LIN ML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++S+ +       + ++T+ +ST  E DD++ ++QE++K+TE L   I +GD+  + K+ DP +T FEP + GNL+EGI+F KF+F+ A        IN  IL+P VHLL ++ A IAY+++TQY+D+QG  +  QSEETRVW K++ KW NVH+H S  +
Sbjct:  173 GFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVEGIDFHKFYFENA--------INTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASA 468          

HSP 2 Score: 286.189 bits (731), Expect = 0.000e+0
Identity = 133/165 (80.61%), Postives = 149/165 (90.30%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD YDIKEELG+GAFSIV+RCVQKST  EFAAKIINTKKL ARD QKLEREARICR L HPNIVRLHD+IQ+E +HY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILESVN+CH + +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    8 TRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0100147)

HSP 1 Score: 417.542 bits (1072), Expect = 0.000e+0
Identity = 192/324 (59.26%), Postives = 246/324 (75.93%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLR--------------------IKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDS 1475
            GFAGTPGYLSPEVL+K+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LYSQIK+GA+DYPSPEWDTVT EAK+LIN ML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++S+ +       + ++T+ +ST  E DD++                     ++QE++K+TE L   I +GD+  + K+ DP +T FEP + GNL+EGI+F KF+F+    K + K+IN  IL+P VHLL ++ A IAY+++TQY+D+QG  +  QSEETRVW K++ KW NVH+H S  +
Sbjct:  173 GFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVVSKEPEAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVEGIDFHKFYFENVLGK-NCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASA 495          

HSP 2 Score: 286.574 bits (732), Expect = 0.000e+0
Identity = 133/165 (80.61%), Postives = 149/165 (90.30%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD YDIKEELG+GAFSIV+RCVQKST  EFAAKIINTKKL ARD QKLEREARICR L HPNIVRLHD+IQ+E +HY++FDL+TGGELFEDIVAREFYSEADAS+C+QQILESVN+CH + +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    8 TRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Zebrafish
Match: camk2a (calcium/calmodulin-dependent protein kinase II alpha [Source:ZFIN;Acc:ZDB-GENE-051113-72])

HSP 1 Score: 412.535 bits (1059), Expect = 0.000e+0
Identity = 191/308 (62.01%), Postives = 242/308 (78.57%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKT--ITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN SKRI+AA+AL+HPWI  R  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS      +   KKT  + +++E T+T  E +D R++KQE++KVTE L   I+ GD+ S+ K+ DP +T FEP + GNL+EG++F +F+F+  ++K + K ++  IL+P +HL+ ++ A IAYI++TQY+D  GMP   QSEETR+W +K+GKW  VH+H SG  +A
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVECLKKFNARRKLKGAILTTMLATRNFSG---GKSGVSKKTDGVKESSESTNTTIEDEDTRVRKQEIIKVTEQLIEAISNGDFESYTKMCDPSVTAFEPEALGNLVEGLDFHRFYFENLWSK-NSKPVHTTILNPHIHLIGEEAACIAYIRITQYLDNNGMPCTAQSEETRIWHRKDGKWQIVHFHRSGSPAA 475          

HSP 2 Score: 264.233 bits (674), Expect = 0.000e+0
Identity = 121/171 (70.76%), Postives = 148/171 (86.55%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T+   + ++ Y + EELG+GAFS+VRRCV+  +  E+AAKIINTKKL+ RD QKL+REARICRLLKHPNIVRLHD+I +EG HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK+KGAAVKLADFGLAIEV+ +  +WF
Sbjct:    1 MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLSGQEYAAKIINTKKLSTRDHQKLDREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGEQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Zebrafish
Match: camk2d1 (calcium/calmodulin-dependent protein kinase (CaM kinase) II delta 1 [Source:NCBI gene;Acc:445208])

HSP 1 Score: 409.453 bits (1051), Expect = 0.000e+0
Identity = 188/302 (62.25%), Postives = 240/302 (79.47%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRK+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+AL+HPWICQR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS+K+      G   + +++E T+T  E +D++ +KQE++KVTELL   I  G++ ++ K+ DP +T FEP + GNL+EG +F +F+F+ + +K   K I+  +L+P VHL+ +D A IAYI++TQY+D   MP   QSEETRVW +++GKW N+H+H SG
Sbjct:  172 GFAGTPGYLSPEVLRKEPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSSKNPYKKPDG---VKESSESTNTTIEDEDIKARKQEIIKVTELLIEAINNGEFEAYTKICDPGLTSFEPEALGNLVEGTDFHRFYFENSLSK-GHKPIHTILLNPHVHLIGEDAACIAYIRLTQYMDVNNMPRTMQSEETRVWHRRDGKWQNIHFHRSG 469          

HSP 2 Score: 267.7 bits (683), Expect = 0.000e+0
Identity = 124/171 (72.51%), Postives = 147/171 (85.96%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ ST  E+AAKIINTKKL+ARD QKLEREARICRLLKH NIVRLHD+I +EG HY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHANIVRLHDSISEEGVHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Zebrafish
Match: camk2d2 (calcium/calmodulin-dependent protein kinase (CaM kinase) II delta 2 [Source:NCBI gene;Acc:436815])

HSP 1 Score: 408.297 bits (1048), Expect = 0.000e+0
Identity = 193/319 (60.50%), Postives = 242/319 (75.86%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS------NKSITSANSGKKTIT--------DTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN SKRI+AA+AL+HPWICQR  VAS  HRQETV+CLKKFNARRKLKGAILTT++ TRNFS      NK        + T+         ++TE  +T  E +DL+ +KQE++KVTE L   I  GD+ ++AK+ DP +T FEP + GNL+EG +F +F+F+ A +K + K ++  +L+P VHL+ +D A IAYI++TQY+D  GMP   QSEETRVW +++GKW+N+H+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTLLVTRNFSAAKSLLNKKPDGVKEPQTTVIHNPVDRNKESTESANTTIEDEDLKARKQEIIKVTEQLIESINNGDFEAYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGN-KPVHTILLNPHVHLIGEDAACIAYIRLTQYMDGSGMPRTMQSEETRVWHRRDGKWLNIHFHRSGAPS 489          

HSP 2 Score: 278.485 bits (711), Expect = 0.000e+0
Identity = 129/171 (75.44%), Postives = 152/171 (88.89%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M   I  + +D Y + EELG+GAFS+VRRCV+ S+  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESV++CH++ IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MALTICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHVNGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Zebrafish
Match: camk2d1 (calcium/calmodulin-dependent protein kinase (CaM kinase) II delta 1 [Source:NCBI gene;Acc:445208])

HSP 1 Score: 404.831 bits (1039), Expect = 0.000e+0
Identity = 190/317 (59.94%), Postives = 243/317 (76.66%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKK----TIT--------DTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRK+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+AL+HPWICQR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS+K+      G K    T+         +++E T+T  E +D++ +KQE++KVTELL   I  G++ ++ K+ DP +T FEP + GNL+EG +F +F+F+ + +K   K I+  +L+P VHL+ +D A IAYI++TQY+D   MP   QSEETRVW +++GKW N+H+H SG  +
Sbjct:  172 GFAGTPGYLSPEVLRKEPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSSKNPYKKPDGVKEPQTTVIHNPTDGNKESSESTNTTIEDEDIKARKQEIIKVTELLIEAINNGEFEAYTKICDPGLTSFEPEALGNLVEGTDFHRFYFENSLSK-GHKPIHTILLNPHVHLIGEDAACIAYIRLTQYMDVNNMPRTMQSEETRVWHRRDGKWQNIHFHRSGSPT 487          

HSP 2 Score: 267.7 bits (683), Expect = 0.000e+0
Identity = 124/171 (72.51%), Postives = 147/171 (85.96%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ ST  E+AAKIINTKKL+ARD QKLEREARICRLLKH NIVRLHD+I +EG HY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHANIVRLHDSISEEGVHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Zebrafish
Match: camk2d1 (calcium/calmodulin-dependent protein kinase (CaM kinase) II delta 1 [Source:NCBI gene;Acc:445208])

HSP 1 Score: 404.445 bits (1038), Expect = 0.000e+0
Identity = 190/314 (60.51%), Postives = 239/314 (76.11%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDT------------TEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRK+PYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+AL+HPWICQR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS+K+      G K    T            +E T+T  E +D++ +KQE++KVTELL   I  G++ ++ K+ DP +T FEP + GNL+EG +F +F+F+ + +K   K I+  +L+P VHL+ +D A IAYI++TQY+D   MP   QSEETRVW +++GKW N+H+H SG
Sbjct:  172 GFAGTPGYLSPEVLRKEPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSSKNPYKKPDGVKEPQTTVIHNPTDGNKESSESTNTTIEDEDIKARKQEIIKVTELLIEAINNGEFEAYTKICDPGLTSFEPEALGNLVEGTDFHRFYFENSLSK-GHKPIHTILLNPHVHLIGEDAACIAYIRLTQYMDVNNMPRTMQSEETRVWHRRDGKWQNIHFHRSG 484          

HSP 2 Score: 275.018 bits (702), Expect = 0.000e+0
Identity = 127/171 (74.27%), Postives = 150/171 (87.72%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ ST  E+AAKIINTKKL+ARD QKLEREARICRLLKH NIVRLHD+I +EG HY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHANIVRLHDSISEEGVHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Xenopus
Match: atp6v1d (ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D [Source:Xenbase;Acc:XB-GENE-973447])

HSP 1 Score: 422.935 bits (1086), Expect = 0.000e+0
Identity = 195/302 (64.57%), Postives = 242/302 (80.13%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+ALRHPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K ++  IL+P VHL+ +D A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALRHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSN-KPVHTIILNPHVHLIGEDAACIAYIRLTQYLDSTGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 469          

HSP 2 Score: 280.026 bits (715), Expect = 0.000e+0
Identity = 128/171 (74.85%), Postives = 152/171 (88.89%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ +T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTCTRFTDEYQLFEELGKGAFSVVRRCMKITTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Xenopus
Match: atp6v1d (ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D [Source:Xenbase;Acc:XB-GENE-973447])

HSP 1 Score: 407.912 bits (1047), Expect = 0.000e+0
Identity = 195/330 (59.09%), Postives = 242/330 (73.33%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLR----------------------------IKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+ALRHPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS KS+     G   + ++TE ++T  E +D++                             +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K ++  IL+P VHL+ +D A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALRHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAKSLLKKPDG---VKESTESSNTTIEDEDVKATKCTENTYSKTHLHESEPSRNSSSSVQSRKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSN-KPVHTIILNPHVHLIGEDAACIAYIRLTQYLDSTGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 497          

HSP 2 Score: 280.026 bits (715), Expect = 0.000e+0
Identity = 128/171 (74.85%), Postives = 152/171 (88.89%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ +T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTCTRFTDEYQLFEELGKGAFSVVRRCMKITTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Xenopus
Match: camk2a (calcium/calmodulin dependent protein kinase (CaM kinase) II alpha [Source:NCBI gene;Acc:100101771])

HSP 1 Score: 405.986 bits (1042), Expect = 0.000e+0
Identity = 190/315 (60.32%), Postives = 240/315 (76.19%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITS--ANSGKK--------TITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN SKRI+AA+AL+HPWI  R  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS     S   N G K         + +++E T+T  E +D +++KQE++KVTE L   I+ GD+  + K+ DP +T FEP + GNL+EG++F +F+F+  ++ R  K ++  IL+P +HL+ D++A IAYI++TQY+D  G+P   QSEET +W +++GKW NVH+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGSNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFECYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWS-RSNKPLHTTILNPHIHLMGDESACIAYIRITQYLDTSGVPRTAQSEETCIWHRRDGKWQNVHFHRSGAPS 485          

HSP 2 Score: 266.929 bits (681), Expect = 0.000e+0
Identity = 124/171 (72.51%), Postives = 148/171 (86.55%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T+   + S+ Y + EELG+GAFSIVRRCV+  +  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EG HY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEV+ +  +WF
Sbjct:    1 MATITCTRFSEEYQLFEELGKGAFSIVRRCVKVLSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Xenopus
Match: camk2a (calcium/calmodulin dependent protein kinase (CaM kinase) II alpha [Source:NCBI gene;Acc:100101771])

HSP 1 Score: 395.971 bits (1016), Expect = 0.000e+0
Identity = 187/332 (56.33%), Postives = 239/332 (71.99%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLR---------------------------IKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN SKRI+AA+AL+HPWI  R  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS    + +N     + +++E T+T  E +D +                           ++KQE++KVTE L   I+ GD+  + K+ DP +T FEP + GNL+EG++F +F+F+  ++ R  K ++  IL+P +HL+ D++A IAYI++TQY+D  G+P   QSEET +W +++GKW NVH+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGK-SGSNKKNDGVKESSESTNTTIEDEDTKDFSLAAQNENITPGLENPIAPKKPSQTVRKQEIIKVTEQLIEAISNGDFECYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWS-RSNKPLHTTILNPHIHLMGDESACIAYIRITQYLDTSGVPRTAQSEETCIWHRRDGKWQNVHFHRSGAPS 501          

HSP 2 Score: 266.929 bits (681), Expect = 0.000e+0
Identity = 124/171 (72.51%), Postives = 148/171 (86.55%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T+   + S+ Y + EELG+GAFSIVRRCV+  +  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EG HY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEV+ +  +WF
Sbjct:    1 MATITCTRFSEEYQLFEELGKGAFSIVRRCVKVLSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Xenopus
Match: camk2a (calcium/calmodulin dependent protein kinase (CaM kinase) II alpha [Source:NCBI gene;Acc:100101771])

HSP 1 Score: 392.119 bits (1006), Expect = 0.000e+0
Identity = 190/342 (55.56%), Postives = 240/342 (70.18%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITS--ANSGKK--------TITDTTEVTSTNDESDDLR---------------------------IKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN SKRI+AA+AL+HPWI  R  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS     S   N G K         + +++E T+T  E +D +                           ++KQE++KVTE L   I+ GD+  + K+ DP +T FEP + GNL+EG++F +F+F+  ++ R  K ++  IL+P +HL+ D++A IAYI++TQY+D  G+P   QSEET +W +++GKW NVH+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGSNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKDFSLAAQNENITPGLENPIAPKKPSQTVRKQEIIKVTEQLIEAISNGDFECYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWS-RSNKPLHTTILNPHIHLMGDESACIAYIRITQYLDTSGVPRTAQSEETCIWHRRDGKWQNVHFHRSGAPS 512          

HSP 2 Score: 266.929 bits (681), Expect = 0.000e+0
Identity = 124/171 (72.51%), Postives = 148/171 (86.55%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T+   + S+ Y + EELG+GAFSIVRRCV+  +  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EG HY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEV+ +  +WF
Sbjct:    1 MATITCTRFSEEYQLFEELGKGAFSIVRRCVKVLSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Mouse
Match: Camk2d (calcium/calmodulin-dependent protein kinase II, delta [Source:MGI Symbol;Acc:MGI:1341265])

HSP 1 Score: 420.239 bits (1079), Expect = 0.000e+0
Identity = 196/310 (63.23%), Postives = 243/310 (78.39%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKK--------TITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS KS+     G K         + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAKSLLKKPDGVKKRKSSSSVQMMESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 481          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Mouse
Match: Camk2d (calcium/calmodulin-dependent protein kinase II, delta [Source:MGI Symbol;Acc:MGI:1341265])

HSP 1 Score: 416.772 bits (1070), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.411 bits (716), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Mouse
Match: Camk2d (calcium/calmodulin-dependent protein kinase II, delta [Source:MGI Symbol;Acc:MGI:1341265])

HSP 1 Score: 416.387 bits (1069), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Mouse
Match: Camk2d (calcium/calmodulin-dependent protein kinase II, delta [Source:MGI Symbol;Acc:MGI:1341265])

HSP 1 Score: 412.535 bits (1059), Expect = 0.000e+0
Identity = 197/314 (62.74%), Postives = 241/314 (76.75%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDT-----------TEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G K    T           TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKEPQTTVIHNPDGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 485          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Mouse
Match: Camk2a (calcium/calmodulin-dependent protein kinase II alpha [Source:MGI Symbol;Acc:MGI:88256])

HSP 1 Score: 412.149 bits (1058), Expect = 0.000e+0
Identity = 189/305 (61.97%), Postives = 240/305 (78.69%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN SKRI+AA+AL+HPWI  R  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS    +  N     + +++E T+T  E +D +++KQE++KVTE L   I+ GD+ S+ K+ DP +T FEP + GNL+EG++F +F+F+  ++ R+ K ++  IL+P +HL+ D++A IAYI++TQY+D  G+P   QSEETRVW +++GKW  VH+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGK-SGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWS-RNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPS 474          

HSP 2 Score: 265.003 bits (676), Expect = 0.000e+0
Identity = 123/171 (71.93%), Postives = 147/171 (85.96%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T+   + ++ Y + EELG+GAFS+VRRCV+     E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EG HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEV+ +  +WF
Sbjct:    1 MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. UniProt/SwissProt
Match: sp|Q9DG02|KCC2D_XENLA (Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis OX=8355 GN=camk2d PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 0.000e+0
Identity = 194/302 (64.24%), Postives = 241/302 (79.80%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A +ALRHPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K ++  IL+P VHL+ +D A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRINATEALRHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSN-KPVHTIILNPHVHLIGEDAACIAYIRLTQYLDSAGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 469          

HSP 2 Score: 275.789 bits (704), Expect = 0.000e+0
Identity = 126/171 (73.68%), Postives = 151/171 (88.30%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ +   E+AAKIINTKKL+ARD QKLEREA+ICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTCTRFTDEYQLFEELGKGAFSVVRRCIKINIGQEYAAKIINTKKLSARDHQKLEREAKICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. UniProt/SwissProt
Match: sp|Q2HJF7|KCC2D_BOVIN (Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus OX=9913 GN=CAMK2D PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 0.000e+0
Identity = 196/310 (63.23%), Postives = 243/310 (78.39%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKK--------TITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS KS+     G K         + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAKSLLKKPDGVKKRKSSSSVQMMESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 481          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. UniProt/SwissProt
Match: sp|Q5ZKI0|KCC2D_CHICK (Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus OX=9031 GN=CAMK2D PE=2 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGTGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 279.256 bits (713), Expect = 0.000e+0
Identity = 127/172 (73.84%), Postives = 154/172 (89.53%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++ +T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ +  +WF
Sbjct:    1 MASTATCTRFTDEYQLFEELGKGAFSVVRRCMKITTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGEQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. UniProt/SwissProt
Match: sp|Q95266|KCC2D_PIG (Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa OX=9823 GN=CAMK2D PE=2 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. UniProt/SwissProt
Match: sp|Q6PHZ2|KCC2D_MOUSE (Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus OX=10090 GN=Camk2d PE=1 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 0.000e+0
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL+HPWICQR  VAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS  KS+     G   + ++TE ++T  E +D++ +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG++F +F+F+ A +K + K I+  IL+P VHL+ DD A IAYI++TQY+D  GMP   QSEETRVW +++GKW NVH+H SG
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDG---VKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN-KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG 471          

HSP 2 Score: 280.796 bits (717), Expect = 0.000e+0
Identity = 128/172 (74.42%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + +T    + +D Y + EELG+GAFS+VRRC++  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH++ IVHRDLKPENL+LASK+KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. TrEMBL
Match: A0A1E1X3Q6 (Putative calcium/calmodulin-dependent protein kinase type ii subunit delta-like isoform x34 OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 0.000e+0
Identity = 201/306 (65.69%), Postives = 250/306 (81.70%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVL+KDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK+LINSML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++SI +       + ++T+ +ST  E DD++ +KQE++K+TE L   I +GDY ++ KL DP +T FEP + GNL+EG+EF KF+FD   A +  KS N  I++P VHLL DD A IAYI++ QY+DR G+P  +Q+EETRVW +K+ KW NVH+H SG+S+ 
Sbjct:  173 GFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKNLINSMLTVNPAKRITAAEALKHPWICQRERVASTLHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSIMTKKGEGSQVKESTD-SSTTIEDDDVKARKQEIVKLTEQLIESINSGDYETYTKLCDPHLTAFEPEALGNLVEGMEFHKFYFDNG-AGKSYKSQNTTIINPTVHLLGDDAACIAYIRLMQYIDRAGIPRTRQTEETRVWHRKDTKWQNVHFHRSGNSAG 476          

HSP 2 Score: 288.5 bits (737), Expect = 0.000e+0
Identity = 132/165 (80.00%), Postives = 153/165 (92.73%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD Y++KEELG+GAFSIVRRCVQKST LEFAAKIINTKKL++RD QKLEREARICR L HPNIVRLHD+IQ+EG+HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH +N+VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ +  +W+
Sbjct:    8 TRFSDNYELKEELGKGAFSIVRRCVQKSTGLEFAAKIINTKKLSSRDFQKLEREARICRKLNHPNIVRLHDSIQEEGYHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHQNNVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGEQQAWY 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. TrEMBL
Match: A0A210QTQ8 (Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06245 PE=3 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 0.000e+0
Identity = 203/307 (66.12%), Postives = 252/307 (82.08%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITS-ANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK+LINSML +N +KRI+A +AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++S+ +  N G   I ++T+ ++T DESDD + +KQ+V+K+TE L + I +GDY ++ K VDP +T FEP + GNL+ G++F KF+FD     ++ K IN +IL+P VHLL DD A IAY+++TQY+DR G+P   Q+EETRVW +K+ KW NVH+H SG  SA
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKNLINSMLTVNPAKRINATEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSLMAKKNDG---IKESTDSSATIDESDDTKGRKQDVIKLTEQLIAAITSGDYDAYTKFVDPHMTCFEPEAMGNLIVGMDFHKFYFDV--HTKNNKQINTSILNPHVHLLGDDAACIAYVRLTQYIDRNGLPVTTQAEETRVWQRKDNKWQNVHFHRSGSPSA 474          

HSP 2 Score: 304.294 bits (778), Expect = 0.000e+0
Identity = 142/164 (86.59%), Postives = 155/164 (94.51%), Query Frame = 2
Query:   77 KVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            K SD+YD+KEELG+GAFSIVRRCVQKST+LEFAAKIINTKKL+ARD QKLEREARICRLLKH NIVRLHD+IQDEGFHY++FDL+TGGELFEDIVAREFYSEADAS+CMQQILESVNYCH H IVHRDLKPENL+LASK KGAAVKLADFGLAIE+Q D  +WF
Sbjct:    9 KFSDIYDLKEELGKGAFSIVRRCVQKSTNLEFAAKIINTKKLSARDHQKLEREARICRLLKHTNIVRLHDSIQDEGFHYLVFDLVTGGELFEDIVAREFYSEADASHCMQQILESVNYCHQHGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEIQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. TrEMBL
Match: A0A2R5L7F7 (Putative calcium/calmodulin-dependent protein kinase type ii alpha chain isoform x4 OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 0.000e+0
Identity = 201/306 (65.69%), Postives = 247/306 (80.72%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVL+KDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK+LINSML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++SI +       + ++T+ +ST  E DD++ +KQE++K+TE L   I  GDY ++ KL DP +T FEP + GNL+EG+EF KF+FD   A +  KS N  I++P VHLL DD A IAYI++ QY+DR G P  +Q+EETRVW +K+ KW NVH+H S +SS 
Sbjct:  173 GFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKNLINSMLTVNPAKRITAAEALKHPWICQRERVASTLHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSIMTKKGDGSQVKESTD-SSTTIEDDDVKARKQEIVKLTEQLIESINGGDYDTYTKLCDPHLTAFEPEALGNLVEGMEFHKFYFDNG-AGKSYKSQNTTIMNPTVHLLGDDAACIAYIRLMQYIDRSGTPRTRQTEETRVWYRKDTKWQNVHFHRSANSSG 476          

HSP 2 Score: 288.5 bits (737), Expect = 0.000e+0
Identity = 132/165 (80.00%), Postives = 153/165 (92.73%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD Y++KEELG+GAFSIVRRCVQKST LEFAAKIINTKKL++RD QKLEREARICR L HPNIVRLHD+IQ+EG+HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CH +N+VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ +  +W+
Sbjct:    8 TRFSDNYELKEELGKGAFSIVRRCVQKSTGLEFAAKIINTKKLSSRDFQKLEREARICRKLNHPNIVRLHDSIQEEGYHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHQNNVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGEQQAWY 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. TrEMBL
Match: T1DCJ3 (Putative calcium-calmodulin-dependent protein kinase type 2 OS=Cupiennius salei OX=6928 PE=2 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 0.000e+0
Identity = 198/306 (64.71%), Postives = 251/306 (82.03%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVL+KDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY+QIK+GA+DYPSPEWDTVT EAK+LINSML +N +KRI+A++AL+HPWICQRERVAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS++SI         + ++T+ +ST  E +D++ +KQE++K+TE L   I TGDY ++ K  DP +T FEP + GNL+EG++F KF+FD A  K   KS+N  IL+P VHLL +D A +AYI++TQYVD+ G+ + +QSEETRVW K++GKW +VH+H SG +S+
Sbjct:  172 GFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKNLINSMLTVNPAKRITASEALKHPWICQRERVASTLHRQETVECLKKFNARRKLKGAILTTMLATRNFSSRSIMQKKGDGSQVKESTD-SSTTLEDEDVKARKQEIVKITEQLIDAINTGDYETYTKYCDPHMTAFEPEALGNLIEGMDFHKFYFDNASGK-SCKSLNTTILNPTVHLLGEDGACVAYIRLTQYVDKMGLAHTQQSEETRVWHKRDGKWQSVHFHRSGSASS 475          

HSP 2 Score: 285.034 bits (728), Expect = 0.000e+0
Identity = 129/171 (75.44%), Postives = 155/171 (90.64%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M   +  + SD Y++KEELG+GAFS+VR+CVQK+T LEFAAKIINTKKL+ARD QKLEREARICR L HPNIVRLHD+IQ+EG+HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILESV++CH +++VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ +  +W+
Sbjct:    1 MAVTVCTRFSDNYELKEELGKGAFSVVRKCVQKNTLLEFAAKIINTKKLSARDFQKLEREARICRKLNHPNIVRLHDSIQEEGYHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILESVSHCHQNSVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGEQQAWY 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. TrEMBL
Match: A0A4D5RDB3 (Putative calcium/calmodulin-dependent protein kinase ii isoform x34 (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 0.000e+0
Identity = 201/306 (65.69%), Postives = 247/306 (80.72%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVL+KDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+DYPSPEWDTVT EAK+LINSML +N +KRI+AA+AL+HPWICQRERVAS  HRQETVDCLKKFNARRKLKGAILTTM+ATRNFS++SI +       + ++T+ +ST  E DD++ +KQE++K+TE L   I  GDY ++ KL DP +T FEP + GNL+EG+EF KF+FD   A +  KS N  I++P VHLL DD A IAYI++ QY+DR G+   +Q+EETRVW +K+ KW NVH+H SG+SS 
Sbjct:  173 GFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYMQIKAGAYDYPSPEWDTVTPEAKNLINSMLTVNPAKRITAAEALKHPWICQRERVASTLHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSIMTKKGEGSQVKESTD-SSTTIEDDDVKARKQEIVKLTEQLIESINGGDYETYTKLCDPHLTAFEPEALGNLVEGMEFHKFYFDNG-AGKSYKSQNTTIINPTVHLLGDDAACIAYIRLMQYIDRAGIARTRQTEETRVWHRKDTKWQNVHFHRSGNSSG 476          

HSP 2 Score: 290.812 bits (743), Expect = 0.000e+0
Identity = 133/165 (80.61%), Postives = 154/165 (93.33%), Query Frame = 2
Query:   74 AKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
             + SD Y++KEELG+GAFSIVRRCVQKST LEFAAKIINTKKL++RD QKLEREARICR L HPNIVRLHD+IQ+EG+HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILESVN+CHM+N+VHRDLKPENL+LASK KGAAVKLADFGLAIEVQ +  +W+
Sbjct:    8 TRFSDNYELKEELGKGAFSIVRRCVQKSTGLEFAAKIINTKKLSSRDFQKLEREARICRKLNHPNIVRLHDSIQEEGYHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHMNNVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGEQQAWY 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Cavefish
Match: camk2a (calcium/calmodulin-dependent protein kinase type II subunit alpha [Source:NCBI gene;Acc:103045689])

HSP 1 Score: 412.535 bits (1059), Expect = 0.000e+0
Identity = 187/305 (61.31%), Postives = 240/305 (78.69%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+AL+HPWI  R  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS    + AN     + +++E T+T  E +D R++KQE++KVTE L   I+ GD+ S+ K+ DP +T FEP + GNL+EG++F +F+F+  ++K + K ++  IL+P +HL+ ++ A IAYI++TQY+D  GMP   QSEE+R+W +++GKW  VH+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALKHPWISHRSTVASCMHRQETVECLKKFNARRKLKGAILTTMLATRNFSGGK-SGANKKADGVKESSESTNTTIEDEDTRVRKQEIIKVTEQLIEAISNGDFESYTKMCDPSVTAFEPEALGNLVEGLDFHRFYFENLWSK-NSKPVHTTILNPHIHLIGEEAACIAYIRITQYIDNNGMPRTAQSEESRIWHRRDGKWQIVHFHRSGAPS 474          

HSP 2 Score: 266.929 bits (681), Expect = 0.000e+0
Identity = 123/171 (71.93%), Postives = 149/171 (87.13%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T+   + ++ Y + EELG+GAFS+VRRCV+  +  E+AAKIINTKKL+ARD QKL+REARICRLLKHPNIVRLHD+I +EG HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK+KGAAVKLADFGLAIEV+ D  +WF
Sbjct:    1 MATITCTRFTEEYQLFEELGKGAFSVVRRCVKILSGQEYAAKIINTKKLSARDHQKLDREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Cavefish
Match: camk2a (calcium/calmodulin-dependent protein kinase type II subunit alpha [Source:NCBI gene;Acc:103045689])

HSP 1 Score: 407.142 bits (1045), Expect = 0.000e+0
Identity = 188/315 (59.68%), Postives = 241/315 (76.51%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS------NKSITSANSGKKT----ITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+AL+HPWI  R  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS      NK        K +    + +++E T+T  E +D R++KQE++KVTE L   I+ GD+ S+ K+ DP +T FEP + GNL+EG++F +F+F+  ++K + K ++  IL+P +HL+ ++ A IAYI++TQY+D  GMP   QSEE+R+W +++GKW  VH+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALKHPWISHRSTVASCMHRQETVECLKKFNARRKLKGAILTTMLATRNFSGGKSGANKKADGVKKRKSSSSVQLMESSESTNTTIEDEDTRVRKQEIIKVTEQLIEAISNGDFESYTKMCDPSVTAFEPEALGNLVEGLDFHRFYFENLWSK-NSKPVHTTILNPHIHLIGEEAACIAYIRITQYIDNNGMPRTAQSEESRIWHRRDGKWQIVHFHRSGAPS 485          

HSP 2 Score: 267.314 bits (682), Expect = 0.000e+0
Identity = 123/171 (71.93%), Postives = 149/171 (87.13%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T+   + ++ Y + EELG+GAFS+VRRCV+  +  E+AAKIINTKKL+ARD QKL+REARICRLLKHPNIVRLHD+I +EG HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK+KGAAVKLADFGLAIEV+ D  +WF
Sbjct:    1 MATITCTRFTEEYQLFEELGKGAFSVVRRCVKILSGQEYAAKIINTKKLSARDHQKLDREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Cavefish
Match: camk2b1 (calcium/calmodulin-dependent protein kinase type II subunit beta [Source:NCBI gene;Acc:103043420])

HSP 1 Score: 402.519 bits (1033), Expect = 0.000e+0
Identity = 189/315 (60.00%), Postives = 243/315 (77.14%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITS--ANSGKKTITDTTEVTSTND------ESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVLRK+ YGK VD+WACGVILYILLVGYPPFWDEDQ KLY QIK+GA+D+PSPEWDTVT EAK+LIN ML IN +KRI+A +AL+HPW+CQR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ +RNFS  KS+ +  A+  K+  + T +   ++D      E +D++ +KQE++K+TE L   I  GD+ ++AK+ DP +T FEP + GNL+EG++F +F+F+   +K + K I+  IL+P VHL+ +D A IAYI++TQYVD QG P   QSEETRVW +++ KW NVH+H SG  +A
Sbjct:  172 GFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKADVKKRKSSSTVQYMESSDSSNATVEDEDMKARKQEIIKITEQLIEAINNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLSK-NSKPIHTTILNPHVHLIGEDAACIAYIRLTQYVDGQGRPRSSQSEETRVWHRRDSKWQNVHFHCSGAPAA 485          

HSP 2 Score: 274.248 bits (700), Expect = 0.000e+0
Identity = 127/171 (74.27%), Postives = 148/171 (86.55%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T    + +D Y + EELG+GAFS+VRRCV+  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+ QIL+SVN+ H H+IVHRDLKPENL+LASK K AAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MATTTCTRFTDEYQLYEELGKGAFSVVRRCVKLCTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIHQILDSVNHIHQHDIVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Cavefish
Match: camk2b2 (calcium/calmodulin-dependent protein kinase type II subunit beta [Source:NCBI gene;Acc:103033831])

HSP 1 Score: 401.749 bits (1031), Expect = 0.000e+0
Identity = 188/315 (59.68%), Postives = 243/315 (77.14%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITS--ANSGKKTITDTTEVTSTND------ESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVLRK+ YGK VD+WACGVILYILLVGYPPFWDEDQ KLY QIK+GA+D+PSPEWDTVT EAK+LIN ML IN +KRI+A +AL+HPW+CQR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ +RNFS  KS+ +  A+  K+  + T +   ++D      E +D++ +KQE++K+TE L   +  GD+ ++AK+ DP +T FEP + GNL+EG++F +F+F+   +K + K I+  IL+P VHL+ +D A IAYI++TQ+VD QG P   QSEETRVW +++ KW NVH+H SG  SA
Sbjct:  172 GFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKADVKKRKSSSTVQYMESSDSSNTTIEDEDVKARKQEIIKITEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLSK-NSKPIHTTILNPHVHLIGEDAACIAYIRLTQFVDSQGRPRSSQSEETRVWHRRDSKWQNVHFHCSGAPSA 485          

HSP 2 Score: 272.322 bits (695), Expect = 0.000e+0
Identity = 126/171 (73.68%), Postives = 147/171 (85.96%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T    + +D Y + EELG+GAFS+VRRCV+  T  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK K AAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MATTTCTRFTDEYQLYEELGKGAFSVVRRCVKLCTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Cavefish
Match: camk2g2 (calcium/calmodulin dependent protein kinase II gamma [Source:NCBI gene;Acc:103044561])

HSP 1 Score: 398.282 bits (1022), Expect = 0.000e+0
Identity = 187/318 (58.81%), Postives = 238/318 (74.84%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS------NKSITSANSGKKT----ITDTTEVTSTNDESD--DLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ KLY QIK+GA+D+PSPEWDTVT EAK+LIN ML IN +KRI+A  AL+HPW+CQR  VAS  HRQETV+CL+KFNARRKLKGAILTTM+ +RNFS      NK        K +    +  +TE  +T +E D    + +KQE++K+TE L   I  GD+ ++ ++ DP +T FEP + GNL+EG++F KF+F+   +K + K ++  IL+P VHL+ +D A IAYI++TQY+D QG P   QSEETRVW +++ KW+NVH+H SG  +A
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSACKSLLNKKSDGVKKRKSSSSVYLMGSTESCNTTEEEDMKGRKARKQEIIKITEQLIEAINNGDFEAYTRICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSK-NSKPVHTTILNPHVHLIGEDAACIAYIRLTQYIDSQGRPRSCQSEETRVWHRRDAKWLNVHFHCSGAPAA 489          

HSP 2 Score: 278.485 bits (711), Expect = 0.000e+0
Identity = 129/172 (75.00%), Postives = 151/172 (87.79%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + T     + +D Y + EELG+GAFS+VRRCV+KST  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+ QILESV++ H H+IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MATIATSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCINQILESVSHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 282.722 bits (722), Expect = 4.733e-152
Identity = 131/171 (76.61%), Postives = 151/171 (88.30%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M T I  + +D Y + EELG+GAFS+VRRCV+ ST  EFAAKIINTKKL+ARD QKLEREARICRLLKH NIVRLH++I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESV++CH H IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    2 MATTICTRFTDEYQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWF 172          

HSP 2 Score: 274.248 bits (700), Expect = 4.733e-152
Identity = 128/189 (67.72%), Postives = 153/189 (80.95%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS------NKSITSANSGKKT-----ITDTTEVTSTNDESDDLRIKKQ 1097
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ KLY QIK+GA+D+PSPEWDTVT+EAK+LIN ML IN +KRI+AA+AL+HPWICQR  VAS  HRQETV+CL+KFNARRKLKGAILTTM+ATRNFS      NK        +K+     + +++E ++T  E +D++ + Q
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQRSTVASCMHRQETVECLRKFNARRKLKGAILTTMLATRNFSAAKSLLNKKTQDGVKKRKSSASVQVLESSESSNTTIEDEDVKGESQ 361          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Sea Lamprey
Match: camk2a (calcium/calmodulin-dependent protein kinase II alpha [Source:ZFIN;Acc:ZDB-GENE-051113-72])

HSP 1 Score: 319.316 bits (817), Expect = 5.489e-121
Identity = 155/246 (63.01%), Postives = 189/246 (76.83%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESDDLRIK---------KQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKR 1271
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+A++AL HPWI QR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS  KS+   N     + ++T+ ++T  E +DL++K         KQE++KVTE L   +  GD+ ++ KL DP +T FEP + GNL+ G+EF KF+F+   A +
Sbjct:   81 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKSLINQMLTINPAKRITASEALTHPWIFQRSTVASCMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLM--NKKTDGVKESTDSSNTTLEDEDLKLKKTKCSLKMRKQEIIKVTEQLIEAVNHGDFEAYTKLCDPGMTSFEPEALGNLVGGMEFHKFYFENREAHK 324          

HSP 2 Score: 134.42 bits (337), Expect = 5.489e-121
Identity = 63/80 (78.75%), Postives = 71/80 (88.75%), Query Frame = 2
Query:  329 ITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            +TGGELFEDIVARE+YSEADAS  +QQILE+V +CH   IVHRDLKPENL+LASKTKGAAVKLADFGLAIEVQ +  +WF
Sbjct:    1 VTGGELFEDIVAREYYSEADASTGIQQILEAVLHCHQLGIVHRDLKPENLLLASKTKGAAVKLADFGLAIEVQGEQQAWF 80          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 114.775 bits (286), Expect = 1.140e-52
Identity = 58/149 (38.93%), Postives = 81/149 (54.36%), Query Frame = 3
Query:  561 RGFAGTPGYLSPEVLR------KDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNF 989
            R   GTPGYLSPE+L+         YGK VD+WACGVI+Y LL G PPFW   Q  +   I  G +D+ +PEW+  +   K LI+ +L +   KR +A  AL HP           F +Q  V+ ++ F+  RK K  +LT + + R +
Sbjct:  186 RELCGTPGYLSPELLKCSMDESHPGYGKEVDLWACGVIMYTLLAGSPPFWHRKQMTMLRLIMDGKYDFSTPEWEDRSDTVKDLISRLLVVEPEKRFTAEQALAHP-----------FFQQYDVEEVRHFSPYRKFKTIMLTVLASVRMY 323          

HSP 2 Score: 110.923 bits (276), Expect = 1.140e-52
Identity = 60/163 (36.81%), Postives = 98/163 (60.12%), Query Frame = 2
Query:   83 SDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIIN--TKKLNARDMQKLE----REARICRLLK-HPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQA 550
            +D Y+ KE LG G  S+VRRCV K T  +FA KII+    +L+  +++ +     +E  I + +  HP+I+ L D  +   F +++FDL+  GELF+ +  +   SE D  + M+ I E V++ H  NIVHRDLKPEN++L        ++L+DFG +++++ 
Sbjct:   22 NDKYEPKEVLGSGVSSVVRRCVHKRTGQDFAVKIIDITPDRLSEEELEDIYSSTVKEVDILKAVSGHPHIITLIDAYESSTFFFLVFDLMKRGELFDYLTEKVALSEKDTRSIMRSIFEVVHFLHAKNIVHRDLKPENILLDDNMN---IRLSDFGFSMQLRP 181          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 1.563e-47
Identity = 45/100 (45.00%), Postives = 66/100 (66.00%), Query Frame = 3
Query:  570 AGTPGYLS---PEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPW 860
             GTPGY++   PEVL + PY + VD W+ GVI YILL GYPPF+DE  S+L+ QI    +++ SP WD ++  AK  I  +++ + ++R +   AL+HPW
Sbjct:  156 CGTPGYVACEAPEVLAQKPYTRAVDCWSIGVISYILLCGYPPFYDEVDSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          

HSP 2 Score: 101.679 bits (252), Expect = 1.563e-47
Identity = 60/154 (38.96%), Postives = 87/154 (56.49%), Query Frame = 2
Query:  116 RGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDL----ITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLA-IEVQADALS 562
            RGAFS V    ++ST    A K I    L  +D   +E E  +   +KH NI+ L D  + +   Y+I  L    I GGELF+ IV R FY+E DAS  ++Q+L +V++ H   +VHRDLKPENL+  S    + + ++DFGL+ +E     +S
Sbjct:    1 RGAFSEVVLAEERSTGRHVAIKCIAKTALRGKD-NTVENEVCVLSRIKHENIIALEDIYETDSHLYLIMQLVLLLIRGGELFDRIVERGFYTERDASALIRQVLRAVSHLHGQGVVHRDLKPENLLYYSAEDDSKIMISDFGLSKVEAPGSVMS 153          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 5.541e-47
Identity = 61/182 (33.52%), Postives = 95/182 (52.20%), Query Frame = 2
Query:   32 SINFT*LIMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTS--------LEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGA-AVKLADFGLAIEVQA 550
            S  F  L M  V L  +   Y+I   +G G F+ V+ C + S+          + A KII+  KL  R+       A   RL +HPN+VRL + ++     Y++ + + GG+LF+ I     ++E  A+  +  +  ++ Y H +NIVHRD+KPENL++     G   +KLAD GLA+EV  
Sbjct:  343 SKKFPNLPMPIVSLQDIESRYEIGRTIGDGNFATVKECRRVSSGDGSAGEAEWDLAMKIIDKAKLVGREEMLRSEVALTTRLGQHPNVVRLVEAMESPSDAYLVLERVRGGDLFDAITESVRFTERHAAAMVADLCRALQYLHANNIVHRDVKPENLLVQRNADGGTTLKLADLGLAMEVTG 524          

HSP 2 Score: 100.908 bits (250), Expect = 5.541e-47
Identity = 54/144 (37.50%), Postives = 86/144 (59.72%), Query Frame = 3
Query:  525 LGLQLKFK---LTLCRGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPF--WDEDQSKLYSQIKSGAFDYPSPEWDTVT---SEAKHLINSMLQINTSKRISAADALRHPWICQRERV-ASAFHRQETVDCLKKF 929
            LGL ++      T+C    GTP Y++PE+L +  YG  VD+WA GVI YILL G+PPF   + DQ +L+  I+ G +++ SP WD ++     AK L++ +L ++T++R +A  AL HPW+        +  HR+ T++  + F
Sbjct:  516 LGLAMEVTGPIYTVC----GTPTYVAPEILAETGYGLEVDMWAAGVITYILLCGFPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPWVSDGGAGDHTDLHREVTMNIQRHF 655          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 115.161 bits (287), Expect = 7.789e-47
Identity = 59/150 (39.33%), Postives = 93/150 (62.00%), Query Frame = 2
Query:  110 LGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARD--MQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQAD 553
            LG G+F +VR+  + ST+ + A KI+  K L   +  +Q L  E  I + L HPNIV   D  + +   Y++  L TGGELF+ I++R  ++E DA   + QIL +V Y H  N+VHRDLKPEN++   K++ + + +ADFG+A +++ +
Sbjct:   53 LGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGE 202          

HSP 2 Score: 90.1225 bits (222), Expect = 7.789e-47
Identity = 67/212 (31.60%), Postives = 103/212 (48.58%), Query Frame = 3
Query:  534 QLKFKLTLCRGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAF--DYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCL----KKFNARRKLKGAILTTMIATRNFSNKSITS-ANSGKKTITDTTEVTSTND----ESDDLRIKKQEVLKVTELLESHI 1136
            QLK +  L    AG+ GY++PEVL +D +GK  D+W+ GVI Y LL GY PF  E       +  +  +   +  P WD ++ + K  I   L++N + R +A + L  PWI  +        R ET + L    K F+ R+KL+ AI    +  R    +++ S  + G   I + +   S  D      DDLR++ Q+  K  EL E  +
Sbjct:  198 QLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITSK--------RVETSNILPDVKKGFSLRKKLRDAIEIVKLNNRIKRLRNMYSLGDDGDNDIEENSLNESLLDGVTHSLDDLRLQSQK--KGGELTEEQM 399          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 107.457 bits (267), Expect = 1.312e-43
Identity = 60/156 (38.46%), Postives = 88/156 (56.41%), Query Frame = 2
Query:   92 YDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKL--NARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQAD 553
            Y   + LG G F +VR+     T  + A KI+  K L  N   ++ L  E  I + L HPNIV   D  + +   Y+I  L  GGELF+ I+ +  ++E DA   + +IL +V Y H  NIVHRDLKPENL+   K+  + + +ADFG+A  +++D
Sbjct:   37 YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSD 192          

HSP 2 Score: 87.0409 bits (214), Expect = 1.312e-43
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  570 AGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAF--DYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPW-ICQRERVASAF-HRQETVDCLKKFNAR----------RKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQ 1097
            AG+ GY++PEVL +D +GK  D+W+ GVI Y LL GY  F  E       +  +G +   +  P WD+V+++AK  I   L ++ SKR +AA+ L  PW IC   +  +     +E +D  +KF             +KL+   L    +  +F   S  + +      TDT++++    E +  ++K +
Sbjct:  200 AGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWIICTELKTHNLLPGLKEGLDARQKFRNSVERVRLNMKIQKLRDLYLEQTESDSDFDEGSQANGSVPPLKATDTSQLSKKLSEEEQSKLKSE 389          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 103.605 bits (257), Expect = 1.571e-42
Identity = 57/157 (36.31%), Postives = 90/157 (57.32%), Query Frame = 2
Query:   86 DLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADA 556
            D   I E +G+GAF+ V++ ++++T   FA KII+ +K+   +M  + RE  + + L HP IVRL    +D   +YM+ + ++GG+L + + A     E       +QIL ++ Y H   I HRDLKP+N IL  +     VK+ DFGLA +VQ + 
Sbjct:  196 DFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIG-NMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDN-ILIEQDDPVLVKITDFGLA-KVQGNG 349          

HSP 2 Score: 87.4261 bits (215), Expect = 1.571e-42
Identity = 42/118 (35.59%), Postives = 69/118 (58.47%), Query Frame = 3
Query:  552 TLCRGFAGTPGYLSPEVLR-------------KDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWD-TVTSEAKHLINSMLQINTSKRISAADALRHPWI 863
            +  + F GT  Y++PEV+R             ++ Y  LVD+W+ G ++Y++L G+ PF    Q +LY QI  G++ +  P  D  ++ EA+  I+S+LQ++ + R +AA AL HPWI
Sbjct:  350 SFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSY-HEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 120.168 bits (300), Expect = 2.043e-41
Identity = 68/149 (45.64%), Postives = 92/149 (61.74%), Query Frame = 2
Query:   92 YDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQ-KLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLA 535
            Y I + LG G+F  V+     +T  + A KIIN K L   DMQ ++ERE    RLL+HP+I++L+D I+ +    M+ +   G ELF+ IV R+  SE +A    QQI+ +V YCH H IVHRDLKPENL+L        VK+ADFGL+
Sbjct:   55 YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEY-AGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLN---VKIADFGLS 199          

HSP 2 Score: 67.3958 bits (163), Expect = 2.043e-41
Identity = 37/97 (38.14%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  573 GTPGYLSPEVLRKDPY-GKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPW 860
            G+P Y +PEV+    Y G  VDVW+CGVILY++L    PF DE    L+  I +G +  P      ++  A  LI  ML +N   RIS  + ++  W
Sbjct:  213 GSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPK----FLSPGAAGLIKRMLIVNPLNRISIHEIMQDDW 305          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 100.138 bits (248), Expect = 4.213e-40
Identity = 51/131 (38.93%), Postives = 74/131 (56.49%), Query Frame = 3
Query:  534 QLKFKLTLCRGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDE-DQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPW---ICQRERVASAFHRQETVD 914
            +++F  TLC    GTP Y++PEVL K  Y   VD+W+ GVILY+ L G+PPF D+     L  QI    + + SP WD +     HLI+++L +N  +R +  +AL HPW   I Q+  V+    R +  D
Sbjct:  374 EMQFTNTLC----GTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFNDIQQQSSVSLELQRLQITD 500          

HSP 2 Score: 82.8037 bits (203), Expect = 4.213e-40
Identity = 55/172 (31.98%), Postives = 89/172 (51.74%), Query Frame = 2
Query:   86 DLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLERE-ARICRLLKHPNIVRLHDNI-----QDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLIL-------ASKTKGAA---------VKLADFGLA 535
            D Y + +ELG G +++V+    K T  + A KI + ++ + +   K  RE   I   ++HPNIV L D+      + +   Y++ + I  GELFE IV +    + ++    +Q+L  + Y H  NI+HRD+KPEN++L        S+ +            VK+ADFGLA
Sbjct:  198 DKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLA 369          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Nematostella
Match: EDO49898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF52])

HSP 1 Score: 365.155 bits (936), Expect = 5.851e-166
Identity = 174/306 (56.86%), Postives = 228/306 (74.51%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSN-----KSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSS 1466
            GFAGTPGYLSPEVL+KDPYGK VD+WACGVILYILLVGYPPFWDE+Q KLYSQIK+G +DYPSPEWDTVT++AK LI+ ML ++  KRI+AA+AL+HPWI  RER+AS  HRQ+T+D LK+FNARRKL+GAI  T++AT NFS+     K  +  +S    I + TE T T  E        QE++++T+ L + I   D+ S++KLVDP+IT FEP + GN +EG+EF KF+FD    KR+  ++N  IL+P V +L ++ A I+Y+++TQ +   G+P   QSEETRVW KK+G W+NVH+H S
Sbjct:  176 GFAGTPGYLSPEVLKKDPYGKPVDLWACGVILYILLVGYPPFWDEEQQKLYSQIKAGTYDYPSPEWDTVTADAKDLIDKMLTVDAPKRITAAEALKHPWIVNRERIASKVHRQQTLDGLKRFNARRKLRGAIHATILATHNFSSGSRHKKKGSDEDSIATIIEEDTESTKTQRE--------QEIIRLTQQLITSITAKDFDSYSKLVDPKITAFEPEALGNQVEGLEFHKFYFDNLPNKRN-TTVNTTILAPHVQMLGEEGACISYVRLTQGIGPDGLPRTTQSEETRVWQKKKGVWLNVHFHRS 472          

HSP 2 Score: 238.81 bits (608), Expect = 5.851e-166
Identity = 104/159 (65.41%), Postives = 135/159 (84.91%), Query Frame = 2
Query:   92 YDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            Y++KEELG+GAFS VR+C  + T +E+A KI++TK +  RD+ K+EREARICR L+HPN+VRLH NI  +GF++++FDL+TGGELFEDIVARE+YSEADAS+C+QQ+L SV +CH + IVHRDLKPENL+LAS+ +GA VKLADFGLAIEV  + L W+
Sbjct:   17 YELKEELGKGAFSTVRKCCHRETKIEYAVKILDTKNMTQRDVHKVEREARICRHLRHPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAMVKLADFGLAIEVDGERLGWY 175          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Nematostella
Match: EDO30537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0H5])

HSP 1 Score: 391.734 bits (1005), Expect = 2.471e-128
Identity = 187/320 (58.44%), Postives = 239/320 (74.69%), Query Frame = 3
Query:  525 LGLQLKFKLTLCRGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDL--RIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            L ++++ + T   GFAGTPGYLSPEVL+K+PYGK VD+WACGVILYILLVGYPPFWDEDQ KLY+QIK+G +DYPSPEWDTVT EAK LIN ML ++ SKRI A +AL+HPWI  RERVAS  HRQET+D LKKFNARRKLKGAILTT++AT NF+     + NS ++ +       S ++E  D+  ++++QE++++T+ L + I TGDY +++KLVDP +T FEP S GNL+EG+EF KF+FD   +KR    IN  ILSP VH+L +D A I Y+++TQ V+  G     Q EETRVW KK G W+NVH+H SG  S
Sbjct:  159 LAIEVEIEKTGWYGFAGTPGYLSPEVLKKEPYGKPVDLWACGVILYILLVGYPPFWDEDQHKLYAQIKTGNYDYPSPEWDTVTDEAKDLINMMLTVDQSKRIGAGEALKHPWIVNRERVASKVHRQETLDGLKKFNARRKLKGAILTTILATSNFNTNIAGAQNSDEELMAH-----SEDEEGQDVTAKVREQEIIRLTQKLITSITTGDYDTYSKLVDPHVTCFEPFSNGNLVEGLEFHKFYFDNTLSKR-SVPINTTILSPHVHVLGEDAACICYMRLTQSVNSSGEAKTLQQEETRVWQKKGGNWINVHFHISGKMS 472          

HSP 2 Score: 266.159 bits (679), Expect = 2.001e-80
Identity = 118/161 (73.29%), Postives = 147/161 (91.30%), Query Frame = 2
Query:   86 DLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            D Y++KEELG+GAFSIVRRC+ K + +E+AAKIINT+KL++RD+QKL+REARICRLLKHPNIVRLH +I +EG+HY++FDL+TGGELFEDIVARE+YSEADAS+C+QQI+ESV +CH +N+VHRDLKPENL+LASK K AAVKLADFGLAIEV+ +   W+
Sbjct:   11 DTYELKEELGKGAFSIVRRCIHKESRIEYAAKIINTRKLSSRDLQKLDREARICRLLKHPNIVRLHASIAEEGYHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIIESVQHCHTNNVVHRDLKPENLLLASKEKNAAVKLADFGLAIEVEIEKTGWY 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Nematostella
Match: EDO42276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X1])

HSP 1 Score: 134.035 bits (336), Expect = 1.306e-62
Identity = 64/152 (42.11%), Postives = 102/152 (67.11%), Query Frame = 2
Query:   80 VSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLA 535
            + D YDI +ELGRGA S+V+ C QK T+ EFA KI+        D + ++ E  I   + HPNI+ + +  +     +M+ +L+TGGELF+ +V + +Y E DA++ ++ ILE+V + H ++IVHRDLKPENL+ A++ + + +K+ADFGL+
Sbjct:   14 IEDFYDIGKELGRGASSVVKLCRQKGTNKEFAVKIMK----KTVDKKIIQTETGILFRINHPNIIHMKELFETHTHLFMVLELVTGGELFDRVVEKGYYCEKDAADAIKMILEAVGHLHKNDIVHRDLKPENLLYANEREDSPLKIADFGLS 161          

HSP 2 Score: 125.561 bits (314), Expect = 1.306e-62
Identity = 65/153 (42.48%), Postives = 94/153 (61.44%), Query Frame = 3
Query:  552 TLCRGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIA---TRNFSNKS 1001
            T+C    GTPGY +PEVL+ + Y   VD+WA GVI YILL G+ PF+DE   +++ +I    +D+ SP WD V+S AK L+  ++  + +KR++A  AL HPW+  +   A     + T   LK+FNA+RKLKG +L  M A    + F+ KS
Sbjct:  172 TVC----GTPGYCAPEVLKGESYDTGVDMWAIGVIAYILLCGFEPFYDETDQQMFQRILKCDYDFVSPWWDDVSSGAKDLVKRLITGDKNKRLTAKQALDHPWV--KGENARREDMERTRKKLKEFNAKRKLKGGMLGVMAAENFAKGFAKKS 318          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 126.331 bits (316), Expect = 1.086e-59
Identity = 68/159 (42.77%), Postives = 102/159 (64.15%), Query Frame = 2
Query:   77 KVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLA-IEVQA 550
            K++  YD++E LG GAFS V    +K+T   FA K I+ K+L  ++ + +E E  I + ++H NI+ L D   ++   Y++ DL+ GGELF+ IV +  Y+E DAS  +QQILE+ +Y H   IVHRDLKPENL+  S  + + + ++DFGL+ IE Q 
Sbjct:   12 KITKKYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGKE-ESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKIEAQG 169          

HSP 2 Score: 123.635 bits (309), Expect = 1.086e-59
Identity = 51/124 (41.13%), Postives = 76/124 (61.29%), Query Frame = 3
Query:  570 AGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARR 941
             GTPGY++PEVL++ PYGK VD W+ GVI YILL GYPPF+D+  + L++QI    +++ SP WD ++  AK  I  +++++   R +   AL HPWIC  E +    H   +    K F  ++
Sbjct:  176 CGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWICGGEALTRDIHASVSEQIKKNFYKQK 299          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Nematostella
Match: EDO44594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV77])

HSP 1 Score: 128.257 bits (321), Expect = 1.001e-55
Identity = 70/162 (43.21%), Postives = 99/162 (61.11%), Query Frame = 3
Query:  525 LGLQLKFKLTLCRGFAGTPGYLSPEVLR------KDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWI-CQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNF 989
              ++LK   TL R   GTPGYL+PEVL+         Y K VD+WACGVILY LL G+PPFW   Q  +   I +G +++ SPEW+ V+++AK+LI  +L ++  +RI+A+DAL+HPW+   + R  S F          +F AR K KGA+L  +IA + F
Sbjct:  169 FAVELKEGETL-RELCGTPGYLAPEVLQCSMFPDAPGYTKEVDMWACGVILYTLLCGFPPFWHRRQVVMLRNIMNGKYNFSSPEWEDVSNDAKNLIKKLLVVHPKERITASDALKHPWLQSTKVRTVSFFLFYFQSQKNDRFCARWKFKGAVL-AVIAVQEF 328          

HSP 2 Score: 108.227 bits (269), Expect = 1.001e-55
Identity = 64/177 (36.16%), Postives = 96/177 (54.24%), Query Frame = 2
Query:   32 SINFT*LIMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREAR-----ICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQ 547
             +NF   ++ +       D Y+ KE LG G  SIVR+C  K T   FA KII+  KL+ +    +    R     +  L  H NI+RL D  +   F +++F++   GELF+ +  +   SE      M  I E+V+Y H HN+VHRDLKPEN++L  +     VK++DFG A+E++
Sbjct:    3 GLNFDDGLLGSEATGGFIDKYEPKELLGCGVSSIVRKCYDKLTGKAFAVKIID--KLSDQGGSDIIATTRDEVNILLSLQGHKNIIRLEDVFESTAFFFLVFEIAPKGELFDYLTEKVTLSEKQTRRIMLSIFEAVDYMHYHNVVHRDLKPENILLDEEIN---VKISDFGFAVELK 174          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Medaka
Match: ENSORLT00000016110.2 (calcium/calmodulin dependent protein kinase II alpha [Source:NCBI gene;Acc:101156912])

HSP 1 Score: 413.305 bits (1061), Expect = 0.000e+0
Identity = 189/305 (61.97%), Postives = 240/305 (78.69%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KRI+AA+AL+HPWI  R  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS    + +N     + +++E T+T  E +D R+KKQ+++KVTE L   I+ GD+ S+ K+ DP +T FEP + GNL+EG++F +F+F+  ++K + K ++  IL+P +HL+ D+ A IAYI+VTQY+D  G P   QSEETRVW +++GKW  VH+H SG +S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALKHPWISHRSTVASCMHRQETVECLKKFNARRKLKGAILTTMLATRNFSGGK-SGSNKKADGVKESSESTNTTIEDEDTRVKKQDIIKVTEQLIEAISNGDFESYTKMCDPAVTAFEPEALGNLVEGLDFHRFYFENLWSK-NSKPVHTTILNPHIHLVGDEAACIAYIRVTQYIDNNGTPRTAQSEETRVWHRRDGKWQIVHFHRSGSAS 474          

HSP 2 Score: 269.626 bits (688), Expect = 0.000e+0
Identity = 125/171 (73.10%), Postives = 149/171 (87.13%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M TVI  + ++ Y + EELG+GAFS+VRRCV+  T  E+AAKIINTKKL+ARD QKL+REARICRLLKHPNIVRLHD+I +E  HY+IFDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK+KGAAVKLADFGLAIEV+ D  +WF
Sbjct:    1 MATVICTRFTEEYQLYEELGKGAFSVVRRCVKVVTGQEYAAKIINTKKLSARDHQKLDREARICRLLKHPNIVRLHDSISEEAHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Medaka
Match: ENSORLT00000033503.1 (calcium/calmodulin-dependent protein kinase type II delta 1 chain [Source:NCBI gene;Acc:101172229])

HSP 1 Score: 407.527 bits (1046), Expect = 0.000e+0
Identity = 189/303 (62.38%), Postives = 237/303 (78.22%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKS-ININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KR++A D L+HPWICQR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS KS+ +       + +++E T+T  E +D+R +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG +F +F+F+ A  K  GK  I+  +L+P VHL+ DD A IAYI++TQY+D  G+P   QSEETR+W +++ KW N+H+H SG
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRVTATDVLKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAKSLLAKKP--DGVKESSESTNTTIEDEDVRARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGTDFHRFYFENAPPK--GKQPIHTILLNPHVHLIGDDAACIAYIRLTQYIDGGGLPRTTQSEETRIWHRRDSKWQNIHFHRSG 470          

HSP 2 Score: 275.789 bits (704), Expect = 0.000e+0
Identity = 127/171 (74.27%), Postives = 150/171 (87.72%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ ST  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQAD  +WF
Sbjct:    1 MASTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQADQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Medaka
Match: ENSORLT00000046433.1 (calcium/calmodulin-dependent protein kinase type II delta 1 chain [Source:NCBI gene;Acc:101172229])

HSP 1 Score: 402.519 bits (1033), Expect = 0.000e+0
Identity = 190/319 (59.56%), Postives = 240/319 (75.24%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSI-------------TSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKS-ININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN +KR++A D L+HPWICQR  VAS  HRQETV+CLKKFNARRKLKGAILTTM+ATRNFS KS+             T  ++  +   +++E T+T  E +D+R +KQE++KVTE L   I  GD+ ++ K+ DP +T FEP + GNL+EG +F +F+F+ A  K  GK  I+  +L+P VHL+ DD A IAYI++TQY+D  G+P   QSEETR+W +++ KW N+H+H SG  +
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRVTATDVLKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAKSLLAKKPDGVKEPQSTVIHNPPEGNKESSESTNTTIEDEDVRARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGTDFHRFYFENAPPK--GKQPIHTILLNPHVHLIGDDAACIAYIRLTQYIDGGGLPRTTQSEETRIWHRRDSKWQNIHFHRSGSPT 488          

HSP 2 Score: 276.174 bits (705), Expect = 0.000e+0
Identity = 127/171 (74.27%), Postives = 150/171 (87.72%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M +    + +D Y + EELG+GAFS+VRRC++ ST  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILE+V +CH   +VHRDLKPENL+LASK KGAAVKLADFGLAIEVQAD  +WF
Sbjct:    1 MASTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQADQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Medaka
Match: camk2g2 (calcium/calmodulin-dependent protein kinase type II subunit gamma [Source:NCBI gene;Acc:101159287])

HSP 1 Score: 395.586 bits (1015), Expect = 0.000e+0
Identity = 186/322 (57.76%), Postives = 238/322 (73.91%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS------NKSITSANSGKKTI-------TDTTEVTSTNDESDDL---RIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSA 1481
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ KLY QIK+GA+D+PSPEWDTVT EAK+LIN ML IN +KRI+A  AL+HPW+CQR  VAS  HRQETV+CL+KFNARRKLKGAILTTM+ +RNFS      NK        + TI       T  +  +  N E +++   + +KQE++K+TE L   I  GD+ ++ ++ DP +T FEP + GNL+EG++F KF+FD   +K + K ++  IL+P VHL+ +D A IAYI++TQ++D QG P   QSEETRVW +++ KW+NVH+H SG  +A
Sbjct:  173 GFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSACKTLLNKKSDGVKEAQTTIVHNPADGTKGSTESCNNAEEEEMKGRKARKQEIIKMTEQLIEAINNGDFEAYTRICDPGLTSFEPEALGNLVEGMDFHKFYFDNLLSK-NSKPVHTTILNPHVHLIGEDAACIAYIRLTQFIDGQGRPRSCQSEETRVWHRRDAKWLNVHFHCSGSPAA 493          

HSP 2 Score: 281.182 bits (718), Expect = 0.000e+0
Identity = 130/172 (75.58%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   53 IMTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            + T V   + +D Y + EELG+GAFS+VRRCV+KSTS E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+ QILES+++ H H+IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MATVVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTSQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQILESISHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWF 172          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Medaka
Match: camk2d2 (calcium/calmodulin-dependent protein kinase type II delta 2 chain [Source:NCBI gene;Acc:101168431])

HSP 1 Score: 394.43 bits (1012), Expect = 0.000e+0
Identity = 190/327 (58.10%), Postives = 238/327 (72.78%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSN------------KSITSANSGKKTITDTTE----------VTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSS 1478
            GFAGTPGYLSPEVLRKDPYGK VD+WACGVILYILLVGYPPFWDEDQ +LY QIK+GA+D+PSPEWDTVT EAK LIN ML IN SKRI+AA+AL+HPWICQR  VAS  HRQETV+CLKKFNARRKLKGAILTT++ TRNFS                   N+   T+T   +          +  T DE  D++ +KQE++KVTE L   I  GD+ ++AK+ DP +T FEP + GNL+EG +F +F+F+ A +K + K ++  +L+P VHL+ ++ A IAYI++TQY+D  GMP   QSEETRVW +++GKW N+H+H SG  S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTLLVTRNFSGMENVCMCVMCPLHCPLQVNNKANTVTSPKDTGPAPALVYTLICTVDE--DVKARKQEIIKVTEQLIESINNGDFEAYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGN-KPVHTILLNPHVHLIGENAACIAYIRLTQYMDGSGMPRTMQSEETRVWHRRDGKWQNIHFHRSGSPS 495          

HSP 2 Score: 278.1 bits (710), Expect = 0.000e+0
Identity = 129/171 (75.44%), Postives = 152/171 (88.89%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            M   I  + +D Y + EELG+GAFS+VRRCV+ S+  E+AAKIINTKKL+ARD QKLEREARICRLLKHPNIVRLHD+I +EGFHY++FDL+TGGELFEDIVARE+YSEADAS+C+QQILESV++CH++ IVHRDLKPENL+LASK KGAAVKLADFGLAIEVQ D  +WF
Sbjct:    1 MALTICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWF 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Planmine SMEST
Match: SMESG000029689.1 (SMESG000029689.1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSAQ 1484
            GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSAQ
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSAQ 478          

HSP 2 Score: 355.91 bits (912), Expect = 0.000e+0
Identity = 170/171 (99.42%), Postives = 171/171 (100.00%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSW+
Sbjct:    1 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWY 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Planmine SMEST
Match: SMESG000029689.1 (SMESG000029689.1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 307/314 (97.77%), Postives = 307/314 (97.77%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-------NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSAQ 1484
            GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS       NKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSAQ
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSKILSDRKNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDSSAQ 485          

HSP 2 Score: 355.91 bits (912), Expect = 0.000e+0
Identity = 170/171 (99.42%), Postives = 171/171 (100.00%), Query Frame = 2
Query:   56 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSW+
Sbjct:    1 MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWY 171          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Planmine SMEST
Match: SMESG000062800.1 (SMESG000062800.1)

HSP 1 Score: 439.884 bits (1130), Expect = 1.532e-146
Identity = 208/324 (64.20%), Postives = 258/324 (79.63%), Query Frame = 3
Query:  525 LGLQLKFKLTLCRGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESD------DLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSGDS 1475
            L ++++   T   GFAGTPGYLSPEVLRK+PYGK VD+WACGVILYILLVGYPPFWDEDQSKLY QIK+GA+DYPSPEWDTVT EAK LINSMLQ+N SKRISAA+AL++PWICQR+RVAS FHRQ+TVDCL+KFNARRKLKGAILTTM+AT+NFS  KSIT++ S +    +T    S  +  D      D + KKQE+LK+TE L S IA G+Y+SF KLVDPQIT FEP + GNL+EGI++ KF F+  ++KRD KS+N++IL+P +H+L +D A IA++KV Q VD+ G   V + EETR+W +KEGKW N+H H SG++
Sbjct:  158 LAIEVQGDATAWYGFAGTPGYLSPEVLRKEPYGKAVDIWACGVILYILLVGYPPFWDEDQSKLYGQIKAGAYDYPSPEWDTVTIEAKKLINSMLQVNVSKRISAAEALKNPWICQRDRVASMFHRQQTVDCLRKFNARRKLKGAILTTMLATKNFSLAKSITNSTSNQNNTQNTIVKKSDKEMIDNISANADCKNKKQEILKLTENLLSSIANGNYSSFIKLVDPQITVFEPDTCGNLIEGIDYYKFLFNNVYSKRDAKSVNMSILNPTIHILGEDCASIAFVKVVQIVDKNGSVTVGRGEETRIWQRKEGKWQNIHVHKSGNA 481          

HSP 2 Score: 302.753 bits (774), Expect = 9.698e-94
Identity = 140/168 (83.33%), Postives = 157/168 (93.45%), Query Frame = 2
Query:   65 VILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            V +AK SDLY++K+ELGRGAFSIV++CVQ ST LEFAAKIINTK+L+ RD+QKLEREARICRLLKH NIVRLHD+IQDEGFHY++FDL+TGGELFEDIVAREFYSE DASNCMQQILESV+YCH HNIVHRDLKPENL+LASKTKGA VKLADFGLAIEVQ DA +W+
Sbjct:    3 VTVAKFSDLYELKDELGRGAFSIVKKCVQLSTGLEFAAKIINTKRLSNRDLQKLEREARICRLLKHSNIVRLHDSIQDEGFHYLVFDLVTGGELFEDIVAREFYSEVDASNCMQQILESVSYCHNHNIVHRDLKPENLLLASKTKGAIVKLADFGLAIEVQGDATAWY 170          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Planmine SMEST
Match: SMESG000062800.1 (SMESG000062800.1)

HSP 1 Score: 437.187 bits (1123), Expect = 1.447e-145
Identity = 207/322 (64.29%), Postives = 255/322 (79.19%), Query Frame = 3
Query:  525 LGLQLKFKLTLCRGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFS-NKSITSANSGKKTITDTTEVTSTNDESD------DLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQSEETRVWCKKEGKWMNVHWHSSG 1469
            L ++++   T   GFAGTPGYLSPEVLRK+PYGK VD+WACGVILYILLVGYPPFWDEDQSKLY QIK+GA+DYPSPEWDTVT EAK LINSMLQ+N SKRISAA+AL++PWICQR+RVAS FHRQ+TVDCL+KFNARRKLKGAILTTM+AT+NFS  KSIT++ S +    +T    S  +  D      D + KKQE+LK+TE L S IA G+Y+SF KLVDPQIT FEP + GNL+EGI++ KF F+  ++KRD KS+N++IL+P +H+L +D A IA++KV Q VD+ G   V + EETR+W +KEGKW N+H H S 
Sbjct:  158 LAIEVQGDATAWYGFAGTPGYLSPEVLRKEPYGKAVDIWACGVILYILLVGYPPFWDEDQSKLYGQIKAGAYDYPSPEWDTVTIEAKKLINSMLQVNVSKRISAAEALKNPWICQRDRVASMFHRQQTVDCLRKFNARRKLKGAILTTMLATKNFSLAKSITNSTSNQNNTQNTIVKKSDKEMIDNISANADCKNKKQEILKLTENLLSSIANGNYSSFIKLVDPQITVFEPDTCGNLIEGIDYYKFLFNNVYSKRDAKSVNMSILNPTIHILGEDCASIAFVKVVQIVDKNGSVTVGRGEETRIWQRKEGKWQNIHVHKSA 479          

HSP 2 Score: 302.368 bits (773), Expect = 9.981e-94
Identity = 140/168 (83.33%), Postives = 157/168 (93.45%), Query Frame = 2
Query:   65 VILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWF 568
            V +AK SDLY++K+ELGRGAFSIV++CVQ ST LEFAAKIINTK+L+ RD+QKLEREARICRLLKH NIVRLHD+IQDEGFHY++FDL+TGGELFEDIVAREFYSE DASNCMQQILESV+YCH HNIVHRDLKPENL+LASKTKGA VKLADFGLAIEVQ DA +W+
Sbjct:    3 VTVAKFSDLYELKDELGRGAFSIVKKCVQLSTGLEFAAKIINTKRLSNRDLQKLEREARICRLLKHSNIVRLHDSIQDEGFHYLVFDLVTGGELFEDIVAREFYSEVDASNCMQQILESVSYCHNHNIVHRDLKPENLLLASKTKGAIVKLADFGLAIEVQGDATAWY 170          
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Planmine SMEST
Match: SMESG000008997.1 (SMESG000008997.1)

HSP 1 Score: 376.711 bits (966), Expect = 1.347e-121
Identity = 189/326 (57.98%), Postives = 236/326 (72.39%), Query Frame = 3
Query:  564 GFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLKGAILTTMIATRNFSNKSITSANSGKKTITDT---------------------TEVTSTNDESDDLRIKKQEVLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFFDTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPN---VKQSEETRVWCKK-EGKWMNVHWHSS 1466
            GFAGTPGYLSPEVLRKDPYGK VDVWACGVILYILLVGYPPFWDEDQ++LY+QIKSG FDYPSPEWDTVT+EAK+LIN ML +N +KRI+AA+AL+HPWI QRE +AS  HRQ+TVDCLKKFNARRKLKGAILTTM+ATRNFS  S  S N G K  TD+                     + V  ++  S ++  KKQE++KVTE L S I+  D+ S+ KLVD  +T F P S GNL+EG++  +F+F+ A +K + K  + +IL+P VHLL ++NA IAY+++ Q+ DR    +    +Q EETR+W K+   KW N+H H S
Sbjct:  172 GFAGTPGYLSPEVLRKDPYGKPVDVWACGVILYILLVGYPPFWDEDQNRLYAQIKSGLFDYPSPEWDTVTAEAKNLINQMLTVNPTKRITAAEALKHPWIYQREHIASMVHRQQTVDCLKKFNARRKLKGAILTTMLATRNFSMISKKS-NGGIKDSTDSVAPAIEDTDDSKTPSRVMNCNSTVLKSDVSSSEIETKKQEIIKVTEQLISSISACDFNSYTKLVDSNLTCFGPESMGNLIEGVDIHRFYFENALSK-NTKMSHTSILNPTVHLLGEENACIAYVRLVQFQDRSNGGSKCLTEQFEETRIWQKRPNNKWQNIHVHRS 495          

HSP 2 Score: 290.812 bits (743), Expect = 7.571e-89
Identity = 134/175 (76.57%), Postives = 160/175 (91.43%), Query Frame = 2
Query:   77 KVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWFRWNSWIFITGS 601
            K SDLY++KEELGRGAFSIV+RCVQK+++LEFAAKIINTK+L++RDMQKLEREARICRLLKHPNIVRLHD+IQD+GFHY++FDL+TGGELFEDIVAREFYSEADASNCMQQILESVNYCH +NI+HRDLKPENL+L+SK+K A VKLADFGLA+E++ +  +     SW+   G+
Sbjct:    7 KFSDLYEMKEELGRGAFSIVKRCVQKASNLEFAAKIINTKRLSSRDMQKLEREARICRLLKHPNIVRLHDSIQDDGFHYLVFDLVTGGELFEDIVAREFYSEADASNCMQQILESVNYCHQNNIIHRDLKPENLLLSSKSKNARVKLADFGLAVEMKENEEA-----SWLGFAGT 176          
The following BLAST results are available for this feature:
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMK2D0.000e+064.57calcium/calmodulin dependent protein kinase II del... [more]
CAMK2D0.000e+064.36calcium/calmodulin dependent protein kinase II del... [more]
CAMK2D0.000e+064.36calcium/calmodulin dependent protein kinase II del... [more]
CAMK2D0.000e+064.36calcium/calmodulin dependent protein kinase II del... [more]
CAMK2D0.000e+064.36calcium/calmodulin dependent protein kinase II del... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-430.000e+058.25Calcium/calmodulin-dependent protein kinase type I... [more]
unc-430.000e+058.25Calcium/calmodulin-dependent protein kinase type I... [more]
unc-430.000e+058.25Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.222e-17851.88Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.222e-17851.88Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaMKII0.000e+062.95gene:FBgn0264607 transcript:FBtr0300377[more]
CaMKII0.000e+062.95gene:FBgn0264607 transcript:FBtr0089217[more]
CaMKII0.000e+062.95gene:FBgn0264607 transcript:FBtr0089218[more]
CaMKII0.000e+062.83gene:FBgn0264607 transcript:FBtr0333673[more]
CaMKII0.000e+059.26gene:FBgn0264607 transcript:FBtr0100147[more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk2a0.000e+062.01calcium/calmodulin-dependent protein kinase II alp... [more]
camk2d10.000e+062.25calcium/calmodulin-dependent protein kinase (CaM k... [more]
camk2d20.000e+060.50calcium/calmodulin-dependent protein kinase (CaM k... [more]
camk2d10.000e+059.94calcium/calmodulin-dependent protein kinase (CaM k... [more]
camk2d10.000e+060.51calcium/calmodulin-dependent protein kinase (CaM k... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1d0.000e+064.57ATPase, H+ transporting, lysosomal 34kDa, V1 subun... [more]
atp6v1d0.000e+059.09ATPase, H+ transporting, lysosomal 34kDa, V1 subun... [more]
camk2a0.000e+060.32calcium/calmodulin dependent protein kinase (CaM k... [more]
camk2a0.000e+056.33calcium/calmodulin dependent protein kinase (CaM k... [more]
camk2a0.000e+055.56calcium/calmodulin dependent protein kinase (CaM k... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camk2d0.000e+063.23calcium/calmodulin-dependent protein kinase II, de... [more]
Camk2d0.000e+064.36calcium/calmodulin-dependent protein kinase II, de... [more]
Camk2d0.000e+064.36calcium/calmodulin-dependent protein kinase II, de... [more]
Camk2d0.000e+062.74calcium/calmodulin-dependent protein kinase II, de... [more]
Camk2a0.000e+061.97calcium/calmodulin-dependent protein kinase II alp... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DG02|KCC2D_XENLA0.000e+064.24Calcium/calmodulin-dependent protein kinase type I... [more]
sp|Q2HJF7|KCC2D_BOVIN0.000e+063.23Calcium/calmodulin-dependent protein kinase type I... [more]
sp|Q5ZKI0|KCC2D_CHICK0.000e+064.36Calcium/calmodulin-dependent protein kinase type I... [more]
sp|Q95266|KCC2D_PIG0.000e+064.36Calcium/calmodulin-dependent protein kinase type I... [more]
sp|Q6PHZ2|KCC2D_MOUSE0.000e+064.36Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1E1X3Q60.000e+065.69Putative calcium/calmodulin-dependent protein kina... [more]
A0A210QTQ80.000e+066.12Calcium/calmodulin-dependent protein kinase type I... [more]
A0A2R5L7F70.000e+065.69Putative calcium/calmodulin-dependent protein kina... [more]
T1DCJ30.000e+064.71Putative calcium-calmodulin-dependent protein kina... [more]
A0A4D5RDB30.000e+065.69Putative calcium/calmodulin-dependent protein kina... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk2a0.000e+061.31calcium/calmodulin-dependent protein kinase type I... [more]
camk2a0.000e+059.68calcium/calmodulin-dependent protein kinase type I... [more]
camk2b10.000e+060.00calcium/calmodulin-dependent protein kinase type I... [more]
camk2b20.000e+059.68calcium/calmodulin-dependent protein kinase type I... [more]
camk2g20.000e+058.81calcium/calmodulin dependent protein kinase II gam... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008748.14.733e-15276.61pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
camk2a5.489e-12163.01calcium/calmodulin-dependent protein kinase II alp... [more]
phkg1b1.140e-5238.93phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
ENSPMAT00000003135.11.563e-4745.00pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
ENSPMAT00000010548.15.541e-4733.52pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK27.789e-4739.33Calmodulin-dependent protein kinase; may play a ro... [more]
CMK11.312e-4338.46Calmodulin-dependent protein kinase; may play a ro... [more]
RAD531.571e-4236.31DNA damage response protein kinase; required for c... [more]
SNF12.043e-4145.64AMP-activated S/T protein kinase; forms a complex ... [more]
DUN14.213e-4038.93Cell-cycle checkpoint S/T protein kinase; required... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498985.851e-16656.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305372.471e-12858.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422761.306e-6242.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362531.086e-5942.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445941.001e-5543.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000016110.20.000e+061.97calcium/calmodulin dependent protein kinase II alp... [more]
ENSORLT00000033503.10.000e+062.38calcium/calmodulin-dependent protein kinase type I... [more]
ENSORLT00000046433.10.000e+059.56calcium/calmodulin-dependent protein kinase type I... [more]
camk2g20.000e+057.76calcium/calmodulin-dependent protein kinase type I... [more]
camk2d20.000e+058.10calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase type II vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029689.10.000e+0100.00SMESG000029689.1[more]
SMESG000029689.10.000e+097.77SMESG000029689.1[more]
SMESG000062800.11.532e-14664.20SMESG000062800.1[more]
SMESG000062800.11.447e-14564.29SMESG000062800.1[more]
SMESG000008997.11.347e-12157.98SMESG000008997.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033189 ID=SMED30033189|Name=Calcium/calmodulin-dependent protein kinase type II|organism=Schmidtea mediterranea sexual|type=transcript|length=2443bp
CATTTTAAAATATTTATTTAATTATAATTTTTCTATCAATTTTACATAAT
TAATAATGACTACTGTGATATTGGCCAAAGTCTCAGATCTTTATGACATC
AAGGAAGAATTAGGAAGAGGGGCGTTCTCCATCGTGCGCAGATGTGTACA
AAAGTCCACCAGTTTGGAATTTGCAGCAAAAATAATTAATACTAAGAAAT
TAAATGCAAGAGATATGCAAAAATTGGAACGGGAAGCTCGGATCTGCCGT
TTATTGAAGCATCCGAATATTGTAAGACTTCATGACAATATTCAAGATGA
AGGATTTCATTACATGATTTTCGACTTAATAACCGGAGGCGAATTATTTG
AGGATATTGTGGCCCGCGAATTTTACAGTGAAGCTGATGCAAGTAACTGT
ATGCAGCAGATCCTGGAGAGCGTCAACTACTGCCATATGCACAATATTGT
CCATCGAGATTTGAAGCCAGAAAATCTGATTTTAGCTAGCAAAACTAAAG
GAGCAGCCGTAAAATTAGCCGATTTTGGGCTTGCAATTGAAGTTCAAGCT
GACGCTTTGTCGTGGTTTCGCTGGAACTCCTGGATATTTATCACCGGAAG
TTCTTAGAAAAGATCCATATGGGAAGCTTGTTGATGTATGGGCGTGTGGT
GTAATTCTTTATATTCTTTTGGTTGGATATCCTCCATTTTGGGATGAAGA
TCAGAGTAAATTATATTCTCAAATAAAATCTGGCGCTTTTGATTATCCGT
CGCCGGAGTGGGATACCGTAACGAGTGAGGCGAAACATTTAATCAACTCG
ATGCTTCAGATAAACACATCAAAACGAATTTCAGCCGCAGACGCACTTAG
GCACCCTTGGATATGTCAAAGAGAAAGAGTAGCTTCAGCATTCCACCGAC
AGGAAACCGTAGACTGCTTGAAAAAATTTAATGCTCGTAGAAAATTAAAA
GGTGCTATTTTGACCACTATGATTGCCACAAGGAATTTCTCAAATAAAAG
CATCACAAGTGCGAACTCAGGGAAGAAAACCATTACGGATACGACGGAGG
TTACGAGCACTAATGACGAATCTGATGACCTTAGAATCAAAAAGCAAGAG
GTACTCAAGGTGACAGAACTGCTTGAATCACATATTGCAACGGGCGATTA
CGCCTCATTTGCCAAACTTGTTGATCCCCAAATTACTTACTTTGAACCCT
TGAGTAAAGGTAACTTAATGGAAGGAATTGAATTTCAGAAATTTTTCTTT
GATACAGCCTTCGCTAAGCGGGACGGCAAATCTATCAACATAAACATCCT
GAGCCCGGCCGTCCACCTGCTGAATGATGATAACGCGTTCATTGCGTACA
TCAAGGTTACACAATATGTGGACAGACAAGGCATGCCCAATGTGAAACAA
AGTGAAGAAACTCGAGTTTGGTGCAAGAAAGAAGGAAAATGGATGAATGT
GCACTGGCACAGTTCCGGTGACAGTTCGGCACAAATTTGAATATCTATCA
CTTTGTCTAGCAGTTTTTTTTTATTATCTATTATTGTGCTGGAGTTGGTA
CCGAATTTTAGCAGCTCTAATCTTCAATAAAACAATTCGATTTCAATATG
TCAGTCAATATGTCAATCTTTGCTAGGTCGTCTATTACTTCGTGAACTTT
CGGTTGTTTTAATCAATCTATTCCCAAATGCTTTATTGTTTCTCTGGACG
CGCTCTTGGTTGAGTGGTTTATTGGTCGGTTATAAAACTTTTATAATTTT
TATTTGACTTACCTCTTGCATGACCACTGAAAGGTTTTAATGAAGCACGG
ATGGTTGGATTTATCAATTTTTCTTATTCATTTTATTACTATTATCATTA
TTTATTATTATTGTTATTAATATTATTATTTCGTTTATTATATAAAACAA
TGACTAAATAAAATTATTATTAATAAAATTTGTTAATTACTAAAAACAAA
TCAAAAAACAAAACAAAGTCAAACTGTAAAACAAAAAGATGTAACACAAA
ACATTTATTGTCTTAAAAGTTGAAGGTTACAAAAATTCCTTACGGATTTA
ACCAGGCACTATTCTACGTACCTTTGGTAACGGAAATTGCAACAGCTAAA
ATCCAAAATACATGGTATTCTGTTGCCATTTCCATCTCCAATCTGTTTAT
TTGGTTGTCCCATAGTGCCTGATTGATCAGCTCCGAAATCCGTATTCTCG
TCTCATTAAATATGAGCTCGGGAATCATTGCTGCTAGATTATCTTTTATT
GTCGCATTGAGTTGAAGATAATAATACTGTAATCTACCAATTACCAGGGT
TTCATATTTTCTAAATAAAATAATAATAATAAAAGAAAATAAATAAATAA
TAAATTTACCATATCGAATGTTATTTTTCAACTGTAAATTTACCATATTG
AATGTTATTTTTCATCGGTAAATCGTACATATTTTTCTTCGGC
back to top

protein sequence of SMED30033189-orf-1

>SMED30033189-orf-1 ID=SMED30033189-orf-1|Name=SMED30033189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MVNLQLKNNIRYGKFIIYLFSFIIIILFRKYETLVIGRLQYYYLQLNATI
KDNLAAMIPELIFNETRIRISELINQALWDNQINRLEMEMATEYHVFWIL
AVAISVTKGT*
back to top

protein sequence of SMED30033189-orf-2

>SMED30033189-orf-2 ID=SMED30033189-orf-2|Name=SMED30033189-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=230bp
MLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFNARRKLK
GAILTTMIATRNFSNKSITSANSGKKTITDTTEVTSTNDESDDLRIKKQE
VLKVTELLESHIATGDYASFAKLVDPQITYFEPLSKGNLMEGIEFQKFFF
DTAFAKRDGKSININILSPAVHLLNDDNAFIAYIKVTQYVDRQGMPNVKQ
SEETRVWCKKEGKWMNVHWHSSGDSSAQI*
back to top

protein sequence of SMED30033189-orf-3

>SMED30033189-orf-3 ID=SMED30033189-orf-3|Name=SMED30033189-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MTTVILAKVSDLYDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLN
ARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFED
IVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGA
AVKLADFGLAIEVQADALSWFRWNSWIFITGSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0030424axon
GO:0042995cell projection
GO:0043204perikaryon
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0014704intercalated disc
GO:0016020membrane
GO:0016529sarcoplasmic reticulum
GO:0030315T-tubule
GO:0031594neuromuscular junction
GO:0033017sarcoplasmic reticulum membrane
GO:0034704calcium channel complex
GO:0042383sarcolemma
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043194axon initial segment
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004683calmodulin-dependent protein kinase activity
GO:0005516calmodulin binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0044325ion channel binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
IPR013543Ca/CaM-dep_prot_kinase-assoc
IPR032710NTF2-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000082G1/S transition of mitotic cell cycle
GO:0002028regulation of sodium ion transport
GO:0006816calcium ion transport
GO:0007399nervous system development
GO:0010613positive regulation of cardiac muscle hypertrophy
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0030154cell differentiation
GO:0035556intracellular signal transduction
GO:0046777protein autophosphorylation
GO:0060048cardiac muscle contraction
GO:0060341regulation of cellular localization
GO:1901897regulation of relaxation of cardiac muscle