Peregrin

Overview
NamePeregrin
Smed IDSMED30033182
Length (bp)3768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peregrin (SMED30033182) t-SNE clustered cells

Violin plots show distribution of expression levels for Peregrin (SMED30033182) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peregrin (SMED30033182) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peregrin (SMED30033182) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Peregrin vs. Ensembl Human
Match: BRPF1 (bromodomain and PHD finger containing 1 [Source:HGNC Symbol;Acc:HGNC:14255])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 287/641 (44.77%), Postives = 392/641 (61.15%), Query Frame = 3
Query:  699 NEESKEILSNPEDKTKEMKNKEQEK-----------VLQTPIPIFIEDI--NLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSI 2516
            N  +KE    P    K  K+K +EK           V  +  P   E +   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 ++ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    S+
Sbjct:  132 NGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSL 753          
BLAST of Peregrin vs. Ensembl Human
Match: BRPF1 (bromodomain and PHD finger containing 1 [Source:HGNC Symbol;Acc:HGNC:14255])

HSP 1 Score: 554.673 bits (1428), Expect = 4.820e-177
Identity = 290/653 (44.41%), Postives = 395/653 (60.49%), Query Frame = 3
Query:  699 NEESKEILSNPEDKTKEMKNKEQEK-----------VLQTPIPIFIEDI--NLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            N  +KE    P    K  K+K +EK           V  +  P   E +   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 ++ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    S+         EDA
Sbjct:  132 NGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDA 765          

HSP 2 Score: 122.865 bits (307), Expect = 1.635e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct:  988 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1110          
BLAST of Peregrin vs. Ensembl Human
Match: BRPF1 (bromodomain and PHD finger containing 1 [Source:HGNC Symbol;Acc:HGNC:14255])

HSP 1 Score: 556.214 bits (1432), Expect = 1.490e-176
Identity = 290/653 (44.41%), Postives = 395/653 (60.49%), Query Frame = 3
Query:  699 NEESKEILSNPEDKTKEMKNKEQEK-----------VLQTPIPIFIEDI--NLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            N  +KE    P    K  K+K +EK           V  +  P   E +   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 ++ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    S+         EDA
Sbjct:  132 NGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDA 765          

HSP 2 Score: 123.25 bits (308), Expect = 1.492e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1082 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1204          
BLAST of Peregrin vs. Ensembl Human
Match: BRPF1 (bromodomain and PHD finger containing 1 [Source:HGNC Symbol;Acc:HGNC:14255])

HSP 1 Score: 556.214 bits (1432), Expect = 1.643e-176
Identity = 290/653 (44.41%), Postives = 395/653 (60.49%), Query Frame = 3
Query:  699 NEESKEILSNPEDKTKEMKNKEQEK-----------VLQTPIPIFIEDI--NLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            N  +KE    P    K  K+K +EK           V  +  P   E +   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 ++ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    S+         EDA
Sbjct:  132 NGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDA 765          

HSP 2 Score: 123.25 bits (308), Expect = 1.493e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1083 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1205          
BLAST of Peregrin vs. Ensembl Human
Match: BRPF1 (bromodomain and PHD finger containing 1 [Source:HGNC Symbol;Acc:HGNC:14255])

HSP 1 Score: 555.829 bits (1431), Expect = 5.363e-176
Identity = 290/653 (44.41%), Postives = 395/653 (60.49%), Query Frame = 3
Query:  699 NEESKEILSNPEDKTKEMKNKEQEK-----------VLQTPIPIFIEDI--NLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            N  +KE    P    K  K+K +EK           V  +  P   E +   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 ++ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    S+         EDA
Sbjct:  130 NGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDA 763          

HSP 2 Score: 122.865 bits (307), Expect = 1.806e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1115 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1237          
BLAST of Peregrin vs. Ensembl Celegans
Match: lin-49 (pep chromosome:WBcel235:IV:8620683:8626149:1 gene:WBGene00003034.1 transcript:F42A9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-49)

HSP 1 Score: 281.567 bits (719), Expect = 1.601e-78
Identity = 171/529 (32.33%), Postives = 272/529 (51.42%), Query Frame = 3
Query:  903 VEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDE--DAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKN---VGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRR-XXXXXXXXXXXXXXIDEGSSEMISNLKFWQQ---IRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQ 2462
            V+Y +DE D+ W+   N   T L                    I   A  E+ +DR EK C ++      L ++  E  D VC++CLDG   N N I++CD CNL+VHQ+CYG+P++PEG   CR+C  SP+  V+C LCP+  GAFKQ +  RW HV+C +W+ E  F N IF+E ++NVEK    R  L+C LCK +    +GACIQC ++ C  +FHVTCA+ +GL M+I ++E       + +  +C  H+P             ++D E+       RQ  L++ R+  N+R+     IS P +    +K +   I V       + I  +W  KR  R G PLL+     +S    L   S   G  + +   +  +Q   +++ L     + ++  +RE+ K+++  ++I + +    PT  L +++I+ L+T+D GK+FAEPV       Y+ II+ P+    + +K  S +Y  +  L  D  LM+SNC  +N  N +Y    +  R +S P+ E  E++
Sbjct:  133 VDYSVDEFDMSWMSIMNAKRTKLGL-----------------EIFSVAIYEHWVDRLEKMCIWKPKEFHKLKDENGEELDDVCNICLDGDTSNCNQIVYCDRCNLSVHQDCYGIPFIPEGCLECRRCGISPAGRVNCVLCPSTTGAFKQVDQKRWVHVLCVIWVDETHFGNTIFMENVQNVEKALHDRRALSCLLCKNRQNARMGACIQCSETKCTASFHVTCARDSGLVMRINETED----GQVNRFVWCPKHAPP----------LTDADREM-------RQLMLRNARR-ENERKGPM--ISMPTL----MKSMISTICVERPFSDYSEIIYFWYEKRLNRLGAPLLKNFTQGASKSRRLLPKSTICGQLKNVETCEMKKQVNAVKESLASGLEIFDMIVRREERKKDMLNSYIRMFERGFKPTELLCQEVIEALKTIDAGKVFAEPVELV---GYTDIIENPICLKDMSEKAASGKYSTVAALSADVQLMLSNCATFNKGNRVYIKYGNTYRKDSTPILEIAEKE 613          
BLAST of Peregrin vs. Ensembl Celegans
Match: phf-15 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9N3F6])

HSP 1 Score: 130.954 bits (328), Expect = 1.103e-30
Identity = 61/160 (38.12%), Postives = 90/160 (56.25%), Query Frame = 3
Query: 1122 DIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQ--WLCRKCLHSPSHPVDCCLCPNKGGAFKQTND-NRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQ 1592
            D  EDA CDVC    CD ++ ++FCD+CN  VH  C G+  +P+    W C KC H  +    C LCP  GG+   + D  +WAH  C L+IPEI+F N     P+ + E++   RW   C +C  +  GAC+ C   +C   +HV CA +AG+ ++I++
Sbjct:  274 DGGEDAECDVCRISDCDVADEMVFCDMCNTCVHMVCAGIEELPDPAEPWKCAKCAHMGTPCPPCVLCPALGGSMTYSADKTQWAHHSCALFIPEIIFENEELRAPMTSFERVAEERWSQMCSVCDTRQ-GACVTCSWVDCEETYHVCCALRAGMTVRIQE 432          
BLAST of Peregrin vs. Ensembl Celegans
Match: phf-15 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9N3F6])

HSP 1 Score: 130.183 bits (326), Expect = 1.380e-30
Identity = 61/160 (38.12%), Postives = 90/160 (56.25%), Query Frame = 3
Query: 1122 DIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQ--WLCRKCLHSPSHPVDCCLCPNKGGAFKQTND-NRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQ 1592
            D  EDA CDVC    CD ++ ++FCD+CN  VH  C G+  +P+    W C KC H  +    C LCP  GG+   + D  +WAH  C L+IPEI+F N     P+ + E++   RW   C +C  +  GAC+ C   +C   +HV CA +AG+ ++I++
Sbjct:  233 DGGEDAECDVCRISDCDVADEMVFCDMCNTCVHMVCAGIEELPDPAEPWKCAKCAHMGTPCPPCVLCPALGGSMTYSADKTQWAHHSCALFIPEIIFENEELRAPMTSFERVAEERWSQMCSVCDTRQ-GACVTCSWVDCEETYHVCCALRAGMTVRIQE 391          
BLAST of Peregrin vs. Ensembl Celegans
Match: zfp-1 (Uncharacterized protein F54F2.2, isoform a [Source:UniProtKB/Swiss-Prot;Acc:P34447])

HSP 1 Score: 130.183 bits (326), Expect = 2.732e-30
Identity = 65/159 (40.88%), Postives = 92/159 (57.86%), Query Frame = 3
Query: 1143 CDVCLDGTCDNSNVILFCDV--CNLAVHQECYGVPYVPEGQWLCRKCLHSPS-------HPVDCC-LCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNV-----GACIQCHKSNCYTAFHVTCAQQAGL 1574
            C VC D      N +++CD   C +AVHQ CYG+  VPEG+W C KC  + +           CC LCP   GA K+T+ N WAHV+C L+IPE+ F N+  +EP+  +  +   ++   CY+C ++       GAC+ C+KS C  +FHVTCAQ+ GL
Sbjct:    8 CCVCADENGWTDNPLIYCDGENCEVAVHQGCYGIQEVPEGEWFCAKCTKASAMMPGSINEATFCCQLCPFDYGALKKTDRNGWAHVICALYIPEVRFGNVHSMEPVI-LNDVPTDKFNKLCYICNEERPNDAKKGACMSCNKSTCKRSFHVTCAQRKGL 165          
BLAST of Peregrin vs. Ensembl Celegans
Match: zfp-1 (Uncharacterized protein F54F2.2, isoform a [Source:UniProtKB/Swiss-Prot;Acc:P34447])

HSP 1 Score: 130.183 bits (326), Expect = 2.732e-30
Identity = 65/159 (40.88%), Postives = 92/159 (57.86%), Query Frame = 3
Query: 1143 CDVCLDGTCDNSNVILFCDV--CNLAVHQECYGVPYVPEGQWLCRKCLHSPS-------HPVDCC-LCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNV-----GACIQCHKSNCYTAFHVTCAQQAGL 1574
            C VC D      N +++CD   C +AVHQ CYG+  VPEG+W C KC  + +           CC LCP   GA K+T+ N WAHV+C L+IPE+ F N+  +EP+  +  +   ++   CY+C ++       GAC+ C+KS C  +FHVTCAQ+ GL
Sbjct:    8 CCVCADENGWTDNPLIYCDGENCEVAVHQGCYGIQEVPEGEWFCAKCTKASAMMPGSINEATFCCQLCPFDYGALKKTDRNGWAHVICALYIPEVRFGNVHSMEPVI-LNDVPTDKFNKLCYICNEERPNDAKKGACMSCNKSTCKRSFHVTCAQRKGL 165          
BLAST of Peregrin vs. Ensembl Fly
Match: Br140 (gene:FBgn0033155 transcript:FBtr0089021)

HSP 1 Score: 517.309 bits (1331), Expect = 3.211e-160
Identity = 249/560 (44.46%), Postives = 355/560 (63.39%), Query Frame = 3
Query:  819 EYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESIT-GSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG--IRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGS---SEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGF 2480
            +Y   + P     Y +++EK+ EELD  VEYD+DEED  WL   NE    L                   + V   TME ++DR EKE HF++   G+    ++D+DAVC +CLDG C N+NVILFCD+CNLAVHQ+CYGVPY+PEGQWLCR+CL SPS PV+C LCPN GGAFKQT+  +WAHVVC LWIPE+ FAN +FLEPI+++E I  ARWRL CY+CK+K +GACIQCH+++CY AFHVTCAQQAGLYM ++  +     +   ++K A+C  H+P+  K  ++   + ++            + K+K+ RK L K+R+    +  P IPP++++EI   + ++ K+EF++RI AYW +KR YR+GVPLLRRL +  +   +   +  EGS    E+   LK+WQ +RQDLE+ARLL EL RKREK+K    R    +    L P    +  L+D L+  D+ +IF EPV  +  P+Y+ I++ PMD   +R K K  +Y ++E+L  DFDLM+ NC  YN ++T++Y    ++R ++ P+F +  ++    G 
Sbjct:  194 DYRVSDAPPRPLAYYRFIEKSLEELDGEVEYDVDEEDSAWLEHMNEERQRLGL-----------------NAVGIDTMELLMDRLEKESHFQAAANGTPTGVEVDDDAVCCICLDGECQNTNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLQSPSKPVNCVLCPNAGGAFKQTDHGQWAHVVCALWIPEVRFANTVFLEPIDSIETIPPARWRLTCYVCKEKGLGACIQCHRNSCYAAFHVTCAQQAGLYMTMDTVKDGHNDSSMHVQKFAYCHAHTPADAKLKMNVPDFEDT------------RHKMKEARKALAKKRSTAPVVLIPTIPPDRVQEIATMVTMQRKKEFLDRIIAYWTLKRHYRNGVPLLRRLQSQGNNHGVIQRNGIEGSPDTGELYRQLKYWQCLRQDLERARLLCELVRKREKLKVAFVRISEEVVMLQLNPLEAALNKLLDALEARDSMQIFREPVDTSEVPDYTDIVKQPMDLGTMRAKLKECQYNSLEQLEADFDLMIQNCLAYNNKDTVFYRAGIRMRDQAAPLFVQVRKELQRDGL 724          

HSP 2 Score: 114.39 bits (285), Expect = 4.106e-25
Identity = 54/113 (47.79%), Postives = 73/113 (64.60%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRH 3494
            LEPL LVWAKCRGYPW+P LI+DP  +  G   N VP+P PP +V  L +   ++  FLVLFFD KRTWQWL   KL+   + + +D+  L    K  + K+V +AY+DA+ +
Sbjct: 1303 LEPLQLVWAKCRGYPWYPALILDP-KTPKGFVYNGVPLPAPPTDVLALRKNCLDEIVFLVLFFDVKRTWQWLPANKLDILGIDKQLDQQKLVESRKPAERKAVKKAYQDALHY 1414          
BLAST of Peregrin vs. Ensembl Fly
Match: Br140 (gene:FBgn0033155 transcript:FBtr0345370)

HSP 1 Score: 517.309 bits (1331), Expect = 3.211e-160
Identity = 249/560 (44.46%), Postives = 355/560 (63.39%), Query Frame = 3
Query:  819 EYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESIT-GSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG--IRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGS---SEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGF 2480
            +Y   + P     Y +++EK+ EELD  VEYD+DEED  WL   NE    L                   + V   TME ++DR EKE HF++   G+    ++D+DAVC +CLDG C N+NVILFCD+CNLAVHQ+CYGVPY+PEGQWLCR+CL SPS PV+C LCPN GGAFKQT+  +WAHVVC LWIPE+ FAN +FLEPI+++E I  ARWRL CY+CK+K +GACIQCH+++CY AFHVTCAQQAGLYM ++  +     +   ++K A+C  H+P+  K  ++   + ++            + K+K+ RK L K+R+    +  P IPP++++EI   + ++ K+EF++RI AYW +KR YR+GVPLLRRL +  +   +   +  EGS    E+   LK+WQ +RQDLE+ARLL EL RKREK+K    R    +    L P    +  L+D L+  D+ +IF EPV  +  P+Y+ I++ PMD   +R K K  +Y ++E+L  DFDLM+ NC  YN ++T++Y    ++R ++ P+F +  ++    G 
Sbjct:  194 DYRVSDAPPRPLAYYRFIEKSLEELDGEVEYDVDEEDSAWLEHMNEERQRLGL-----------------NAVGIDTMELLMDRLEKESHFQAAANGTPTGVEVDDDAVCCICLDGECQNTNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLQSPSKPVNCVLCPNAGGAFKQTDHGQWAHVVCALWIPEVRFANTVFLEPIDSIETIPPARWRLTCYVCKEKGLGACIQCHRNSCYAAFHVTCAQQAGLYMTMDTVKDGHNDSSMHVQKFAYCHAHTPADAKLKMNVPDFEDT------------RHKMKEARKALAKKRSTAPVVLIPTIPPDRVQEIATMVTMQRKKEFLDRIIAYWTLKRHYRNGVPLLRRLQSQGNNHGVIQRNGIEGSPDTGELYRQLKYWQCLRQDLERARLLCELVRKREKLKVAFVRISEEVVMLQLNPLEAALNKLLDALEARDSMQIFREPVDTSEVPDYTDIVKQPMDLGTMRAKLKECQYNSLEQLEADFDLMIQNCLAYNNKDTVFYRAGIRMRDQAAPLFVQVRKELQRDGL 724          

HSP 2 Score: 114.39 bits (285), Expect = 4.106e-25
Identity = 54/113 (47.79%), Postives = 73/113 (64.60%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRH 3494
            LEPL LVWAKCRGYPW+P LI+DP  +  G   N VP+P PP +V  L +   ++  FLVLFFD KRTWQWL   KL+   + + +D+  L    K  + K+V +AY+DA+ +
Sbjct: 1303 LEPLQLVWAKCRGYPWYPALILDP-KTPKGFVYNGVPLPAPPTDVLALRKNCLDEIVFLVLFFDVKRTWQWLPANKLDILGIDKQLDQQKLVESRKPAERKAVKKAYQDALHY 1414          
BLAST of Peregrin vs. Ensembl Fly
Match: rno (gene:FBgn0035106 transcript:FBtr0305549)

HSP 1 Score: 198.364 bits (503), Expect = 9.949e-51
Identity = 144/443 (32.51%), Postives = 198/443 (44.70%), Query Frame = 3
Query:  909 YDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESIT-----GSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNR-WAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMK--IEQSEKISGPAGIRKSAFCDVHSPSGYK---AGVSRGMYANSDEEL-----------------------TSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDN------IDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFR 2117
            YD+D  D  WL   N               + RA     P  ++    E VI+  E  C +E I         L  + DE+ +CDVC     + +N ++FCD CN+ VHQ CYG+  +P GQWLCR C  S     DC LCPNKGGA K     + WAHV C LWIPE+    +  +EPI  +  I  +RW L C LC+ K VG+CIQC    C TA+HVTCA Q GL M+  IE+        G++  ++C  HS S  K   AG   G  A+    +                       T E P +R+   K   +L ++ RN         +  E  K +  N       DV   ++ +  I+ YWK+KR+ R    L+                 D      + N K    +RQDLE+ R L  +  +REK+ R LF+
Sbjct:  250 YDIDPIDEAWLRLYN---------------SDRAQCGAFP--INATQFERVIEELEVRC-WEQIQVILKLEEGLGIEFDENVICDVCRSPDSEEANEMVFCDNCNICVHQACYGITAIPSGQWLCRTC--SMGIKPDCVLCPNKGGAMKSNKSGKHWAHVSCALWIPEVSIGCVDRMEPITKISSIPQSRWSLICVLCR-KRVGSCIQCSVKPCKTAYHVTCAFQHGLEMRAIIEEGNAED---GVKLRSYCQKHSMSKGKKENAGSHGGGSASVASAMQKANRYGSGAGGGADDGNNACGTTGEDPRRRKNHRKT--ELTSEERNQARAQRLQEVEAEFDKHVNFNDISCHLFDV--DDDAIVAIYNYWKLKRKSRHNRELIPPKSEDVEMIARKQEQQD------MENHKLVVHLRQDLERVRNLCYMVSRREKLSRSLFK 658          
BLAST of Peregrin vs. Ensembl Fly
Match: rno (gene:FBgn0035106 transcript:FBtr0305548)

HSP 1 Score: 198.364 bits (503), Expect = 9.949e-51
Identity = 144/443 (32.51%), Postives = 198/443 (44.70%), Query Frame = 3
Query:  909 YDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESIT-----GSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNR-WAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMK--IEQSEKISGPAGIRKSAFCDVHSPSGYK---AGVSRGMYANSDEEL-----------------------TSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDN------IDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFR 2117
            YD+D  D  WL   N               + RA     P  ++    E VI+  E  C +E I         L  + DE+ +CDVC     + +N ++FCD CN+ VHQ CYG+  +P GQWLCR C  S     DC LCPNKGGA K     + WAHV C LWIPE+    +  +EPI  +  I  +RW L C LC+ K VG+CIQC    C TA+HVTCA Q GL M+  IE+        G++  ++C  HS S  K   AG   G  A+    +                       T E P +R+   K   +L ++ RN         +  E  K +  N       DV   ++ +  I+ YWK+KR+ R    L+                 D      + N K    +RQDLE+ R L  +  +REK+ R LF+
Sbjct:  250 YDIDPIDEAWLRLYN---------------SDRAQCGAFP--INATQFERVIEELEVRC-WEQIQVILKLEEGLGIEFDENVICDVCRSPDSEEANEMVFCDNCNICVHQACYGITAIPSGQWLCRTC--SMGIKPDCVLCPNKGGAMKSNKSGKHWAHVSCALWIPEVSIGCVDRMEPITKISSIPQSRWSLICVLCR-KRVGSCIQCSVKPCKTAYHVTCAFQHGLEMRAIIEEGNAED---GVKLRSYCQKHSMSKGKKENAGSHGGGSASVASAMQKANRYGSGAGGGADDGNNACGTTGEDPRRRKNHRKT--ELTSEERNQARAQRLQEVEAEFDKHVNFNDISCHLFDV--DDDAIVAIYNYWKLKRKSRHNRELIPPKSEDVEMIARKQEQQD------MENHKLVVHLRQDLERVRNLCYMVSRREKLSRSLFK 658          
BLAST of Peregrin vs. Ensembl Fly
Match: rno (gene:FBgn0035106 transcript:FBtr0072532)

HSP 1 Score: 198.364 bits (503), Expect = 9.949e-51
Identity = 144/443 (32.51%), Postives = 198/443 (44.70%), Query Frame = 3
Query:  909 YDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESIT-----GSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNR-WAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMK--IEQSEKISGPAGIRKSAFCDVHSPSGYK---AGVSRGMYANSDEEL-----------------------TSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDN------IDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFR 2117
            YD+D  D  WL   N               + RA     P  ++    E VI+  E  C +E I         L  + DE+ +CDVC     + +N ++FCD CN+ VHQ CYG+  +P GQWLCR C  S     DC LCPNKGGA K     + WAHV C LWIPE+    +  +EPI  +  I  +RW L C LC+ K VG+CIQC    C TA+HVTCA Q GL M+  IE+        G++  ++C  HS S  K   AG   G  A+    +                       T E P +R+   K   +L ++ RN         +  E  K +  N       DV   ++ +  I+ YWK+KR+ R    L+                 D      + N K    +RQDLE+ R L  +  +REK+ R LF+
Sbjct:  250 YDIDPIDEAWLRLYN---------------SDRAQCGAFP--INATQFERVIEELEVRC-WEQIQVILKLEEGLGIEFDENVICDVCRSPDSEEANEMVFCDNCNICVHQACYGITAIPSGQWLCRTC--SMGIKPDCVLCPNKGGAMKSNKSGKHWAHVSCALWIPEVSIGCVDRMEPITKISSIPQSRWSLICVLCR-KRVGSCIQCSVKPCKTAYHVTCAFQHGLEMRAIIEEGNAED---GVKLRSYCQKHSMSKGKKENAGSHGGGSASVASAMQKANRYGSGAGGGADDGNNACGTTGEDPRRRKNHRKT--ELTSEERNQARAQRLQEVEAEFDKHVNFNDISCHLFDV--DDDAIVAIYNYWKLKRKSRHNRELIPPKSEDVEMIARKQEQQD------MENHKLVVHLRQDLERVRNLCYMVSRREKLSRSLFK 658          
BLAST of Peregrin vs. Ensembl Zebrafish
Match: brpf3b (bromodomain and PHD finger containing, 3b [Source:ZFIN;Acc:ZDB-GENE-081104-468])

HSP 1 Score: 547.74 bits (1410), Expect = 2.035e-173
Identity = 303/736 (41.17%), Postives = 434/736 (58.97%), Query Frame = 3
Query:  438 LSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEIL-SNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEK-ETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIE--QSEKISGPA-GIRKSAFCDVHSPS--------------GYKAGVSRGMYANSDE--------ELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRR-XXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLF----ANKSIYDLVINSTFED 2549
            L+YA ++K V +  D R  R ++  P+ +  ++++    I E N+N    ENS  TS S + S+ +R    R +       K +++L+        S+ + +T+   N     +   P P F E    E++E  E P     Y +Y++K++E+ D   EYD+DEED+ WL   NE                +  S   P I    T E +IDR EKE   ES + ++  + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL SPS PVDC LCPN+GGAFKQT+D RWAHVVC +WIPE+ FAN +FLEPIE V+ I  ARW+L CYLCKQK  GA IQCHK+NCYTAFHVTCAQ+AGL+MKI+  +   ++G    ++K+AFC+ HSP+              G +A   R  Y  + E        ++ S++P K+ KK ++V K     +  T  ++ P IP ++L +I+ ++ ++ K +FM R+H YW +KR+ R+GVPL+RR       + +      DE  + +   LK+WQ++R DLE+ARLL EL RKREK+KRE  +   ++ +  L P + L+   +++LQ  DT KIFA+PV     P+Y + I  PMDF+ ++ K ++++Y ++  L  DF+LM+SNC  YNA++T++Y  A +LR     +    +RQ    GFD +TG+      NK+ Y      TFED
Sbjct:   47 LTYAQAQKIVEVDLDGRLHRISIFDPLVVITEDEMTAQDIAECNSN---KENSEQTSVSTVVSSPRRSVANRGKK------KDVKQLSSSQNHCSNSHGQSQTQSSGNSHHGTL---PKPTFKEH---EFYEPVEAPPRPSAYYRYIDKSSEDPDTDAEYDMDEEDVAWLELVNE----------------KRDSDGQPHISPD-TFELLIDRLEKESFLESRSQASSQSVIDEDAFCCVCLDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNRGGAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPIEGVDNIPPARWKLTCYLCKQKGCGASIQCHKANCYTAFHVTCAQRAGLFMKIDPVRETTVNGTTFSVKKTAFCEAHSPAVNGSDDEETGGRVLGCRANRGRSAYMQTPELKKQKGSNKVDSKQPQKKGKK-EEVSK-----KTTTLLVTVPEIPAQRLNKISKDVIIQKKNQFMQRLHNYWLLKRQSRNGVPLIRRLHSHLQGQRSAEQAEPDEKLNAVREELKYWQKLRHDLERARLLIELIRKREKLKREQVKIHQAVTEHQLTPVLVLLSSTLEQLQEKDTAKIFAQPVNLKEVPDYLEFITHPMDFSTMQSKLEAHKYRSVTDLEADFNLMISNCLLYNAKDTVFYQAAIRLRDLGGAILRHAQRQAQNTGFDLDTGMHLAESPNKNDY---YRCTFED 741          

HSP 2 Score: 119.398 bits (298), Expect = 1.236e-26
Identity = 58/119 (48.74%), Postives = 75/119 (63.03%), Query Frame = 3
Query: 3159 EPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIV 3506
            EPLDLVWAK RGYP +P LI+DP M  +G+  N VPIP PP +V  LG   +  + +  FLVLFFD KRTWQWL ++K+ P  V +  D+  +    K+   KSV  AY  A++HL  V
Sbjct: 1092 EPLDLVWAKSRGYPSYPALIIDPDMPQDGLLHNGVPIPVPPLDVLRLGEQRQEEAGERLFLVLFFDNKRTWQWLSKDKVIPLGVDDTTDKLRIMEGKKTSIRKSVQVAYDRAMKHLSRV 1210          
BLAST of Peregrin vs. Ensembl Zebrafish
Match: brpf3b (bromodomain and PHD finger containing, 3b [Source:ZFIN;Acc:ZDB-GENE-081104-468])

HSP 1 Score: 546.969 bits (1408), Expect = 3.066e-173
Identity = 303/736 (41.17%), Postives = 434/736 (58.97%), Query Frame = 3
Query:  438 LSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEIL-SNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEK-ETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIE--QSEKISGPA-GIRKSAFCDVHSPS--------------GYKAGVSRGMYANSDE--------ELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRR-XXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLF----ANKSIYDLVINSTFED 2549
            L+YA ++K V +  D R  R ++  P+ +  ++++    I E N+N    ENS  TS S + S+ +R    R +       K +++L+        S+ + +T+   N     +   P P F E    E++E  E P     Y +Y++K++E+ D   EYD+DEED+ WL   NE                +  S   P I    T E +IDR EKE   ES + ++  + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL SPS PVDC LCPN+GGAFKQT+D RWAHVVC +WIPE+ FAN +FLEPIE V+ I  ARW+L CYLCKQK  GA IQCHK+NCYTAFHVTCAQ+AGL+MKI+  +   ++G    ++K+AFC+ HSP+              G +A   R  Y  + E        ++ S++P K+ KK ++V K     +  T  ++ P IP ++L +I+ ++ ++ K +FM R+H YW +KR+ R+GVPL+RR       + +      DE  + +   LK+WQ++R DLE+ARLL EL RKREK+KRE  +   ++ +  L P + L+   +++LQ  DT KIFA+PV     P+Y + I  PMDF+ ++ K ++++Y ++  L  DF+LM+SNC  YNA++T++Y  A +LR     +    +RQ    GFD +TG+      NK+ Y      TFED
Sbjct:   47 LTYAQAQKIVEVDLDGRLHRISIFDPLVVITEDEMTAQDIAECNSN---KENSEQTSVSTVVSSPRRSVANRGKK------KDVKQLSSSQNHCSNSHGQSQTQSSGNSHHGTL---PKPTFKEH---EFYEPVEAPPRPSAYYRYIDKSSEDPDTDAEYDMDEEDVAWLELVNE----------------KRDSDGQPHISPD-TFELLIDRLEKESFLESRSQASSQSVIDEDAFCCVCLDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNRGGAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPIEGVDNIPPARWKLTCYLCKQKGCGASIQCHKANCYTAFHVTCAQRAGLFMKIDPVRETTVNGTTFSVKKTAFCEAHSPAVNGSDDEETGGRVLGCRANRGRSAYMQTPELKKQKGSNKVDSKQPQKKGKK-EEVSK-----KTTTLLVTVPEIPAQRLNKISKDVIIQKKNQFMQRLHNYWLLKRQSRNGVPLIRRLHSHLQGQRSAEQAEPDEKLNAVREELKYWQKLRHDLERARLLIELIRKREKLKREQVKIHQAVTEHQLTPVLVLLSSTLEQLQEKDTAKIFAQPVNLKEVPDYLEFITHPMDFSTMQSKLEAHKYRSVTDLEADFNLMISNCLLYNAKDTVFYQAAIRLRDLGGAILRHAQRQAQNTGFDLDTGMHLAESPNKNDY---YRCTFED 741          

HSP 2 Score: 119.398 bits (298), Expect = 1.330e-26
Identity = 58/119 (48.74%), Postives = 75/119 (63.03%), Query Frame = 3
Query: 3159 EPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIV 3506
            EPLDLVWAK RGYP +P LI+DP M  +G+  N VPIP PP +V  LG   +  + +  FLVLFFD KRTWQWL ++K+ P  V +  D+  +    K+   KSV  AY  A++HL  V
Sbjct: 1086 EPLDLVWAKSRGYPSYPALIIDPDMPQDGLLHNGVPIPVPPLDVLRLGEQRQEEAGERLFLVLFFDNKRTWQWLSKDKVIPLGVDDTTDKLRIMEGKKTSIRKSVQVAYDRAMKHLSRV 1204          
BLAST of Peregrin vs. Ensembl Zebrafish
Match: brpf3a (bromodomain and PHD finger containing, 3a [Source:ZFIN;Acc:ZDB-GENE-130530-730])

HSP 1 Score: 493.426 bits (1269), Expect = 2.380e-158
Identity = 255/594 (42.93%), Postives = 350/594 (58.92%), Query Frame = 3
Query:  855 GYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKA------GVSRGMYANSDEELTSEKP----------GKRQKKLKDVRKLLNKRRNYTAPISF-PVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL-FANKSI-YDLVINSTFEDAHIYQL 2567
             Y +Y+EK+ EELD   EYD+DEED+ WL   N+               +R S     + V   T E +IDR E+E   ES + +   + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS PVDC LCPN+GGAFKQT+D  WAHV+C +WIPE+ FAN +FLEP+E V+ I  ARW+L CYLCKQK  GA IQCHK+NCY AFHVTCAQ+AGLYMKI+   + +G  G    ++K+A+C+ HSP G         G+  G         T   P          G   ++ K  +      R    P+   P IP  +L +I   + V  K +FM R+H YW +KR  R+GVPL+RRL +            D     +   LK+WQ++RQDLEKARLL EL RKRE++KRE  +   +  +  L P +  ++  +++L+  DT  IF  PV     P+Y + +  PMDF+ +  K ++++Y ++  L  DF+LM+SNC RYN+ +T+++  A +LR     +    + Q   IG D  TG+   +K I ++  ++   E  H+++L
Sbjct:  159 AYYRYMEKSGEELDNEAEYDMDEEDMAWLEMVNQ---------------KRVSDGH--ASVPPDTFELLIDRLERESILESRSQALSQSTIDEDAYCCVCLDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRRCLQSPSRPVDCVLCPNRGGAFKQTSDGSWAHVICAIWIPEVCFANTVFLEPVEGVKNIPPARWKLTCYLCKQKGRGASIQCHKANCYRAFHVTCAQRAGLYMKIDPVRE-TGTNGTTFTVKKTAYCENHSPPGTGTEGYEDNGLVGGRGNRGQRSYTLGPPLQQNQNGRKKGSAAQQKKTQKNSGGGSRKTGVPLLLVPQIPSFRLNKICTGVSVERKNQFMQRLHNYWLLKRHSRNGVPLIRRLHSHLQAQKSEQREPDAKLQAVREELKYWQKLRQDLEKARLLIELIRKRERLKREQMKLQQAALELQLTPALVFLRATLEQLKEKDTDHIFTTPVNLKEVPDYLEFVTVPMDFSTMHDKLEAHKYSSVADLENDFNLMVSNCLRYNSNDTVFHKAAMQLREVGGAILRHAQHQALSIGLDPSTGMHLPDKPIPHNTTVSWCDEGEHLHKL 734          
BLAST of Peregrin vs. Ensembl Zebrafish
Match: brpf3a (bromodomain and PHD finger containing, 3a [Source:ZFIN;Acc:ZDB-GENE-130530-730])

HSP 1 Score: 493.426 bits (1269), Expect = 2.380e-158
Identity = 255/594 (42.93%), Postives = 350/594 (58.92%), Query Frame = 3
Query:  855 GYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKA------GVSRGMYANSDEELTSEKP----------GKRQKKLKDVRKLLNKRRNYTAPISF-PVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL-FANKSI-YDLVINSTFEDAHIYQL 2567
             Y +Y+EK+ EELD   EYD+DEED+ WL   N+               +R S     + V   T E +IDR E+E   ES + +   + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS PVDC LCPN+GGAFKQT+D  WAHV+C +WIPE+ FAN +FLEP+E V+ I  ARW+L CYLCKQK  GA IQCHK+NCY AFHVTCAQ+AGLYMKI+   + +G  G    ++K+A+C+ HSP G         G+  G         T   P          G   ++ K  +      R    P+   P IP  +L +I   + V  K +FM R+H YW +KR  R+GVPL+RRL +            D     +   LK+WQ++RQDLEKARLL EL RKRE++KRE  +   +  +  L P +  ++  +++L+  DT  IF  PV     P+Y + +  PMDF+ +  K ++++Y ++  L  DF+LM+SNC RYN+ +T+++  A +LR     +    + Q   IG D  TG+   +K I ++  ++   E  H+++L
Sbjct:  159 AYYRYMEKSGEELDNEAEYDMDEEDMAWLEMVNQ---------------KRVSDGH--ASVPPDTFELLIDRLERESILESRSQALSQSTIDEDAYCCVCLDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRRCLQSPSRPVDCVLCPNRGGAFKQTSDGSWAHVICAIWIPEVCFANTVFLEPVEGVKNIPPARWKLTCYLCKQKGRGASIQCHKANCYRAFHVTCAQRAGLYMKIDPVRE-TGTNGTTFTVKKTAYCENHSPPGTGTEGYEDNGLVGGRGNRGQRSYTLGPPLQQNQNGRKKGSAAQQKKTQKNSGGGSRKTGVPLLLVPQIPSFRLNKICTGVSVERKNQFMQRLHNYWLLKRHSRNGVPLIRRLHSHLQAQKSEQREPDAKLQAVREELKYWQKLRQDLEKARLLIELIRKRERLKREQMKLQQAALELQLTPALVFLRATLEQLKEKDTDHIFTTPVNLKEVPDYLEFVTVPMDFSTMHDKLEAHKYSSVADLENDFNLMVSNCLRYNSNDTVFHKAAMQLREVGGAILRHAQHQALSIGLDPSTGMHLPDKPIPHNTTVSWCDEGEHLHKL 734          
BLAST of Peregrin vs. Ensembl Zebrafish
Match: brpf3a (bromodomain and PHD finger containing, 3a [Source:ZFIN;Acc:ZDB-GENE-130530-730])

HSP 1 Score: 493.426 bits (1269), Expect = 4.077e-156
Identity = 257/603 (42.62%), Postives = 348/603 (57.71%), Query Frame = 3
Query:  753 KNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKA------GVSRGMYANSDEELT----------SEKPGKRQKKLKDVRKLLNKRRNYTAPISF-PVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            +N EQ K    P+P         +   + P     Y +Y+EK+ EELD   EYD+DEED+ WL   N+               +R S     + V   T E +IDR E+E   ES + +   + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS PVDC LCPN+GGAFKQT+D  WAHV+C +WIPE+ FAN +FLEP+E V+ I  ARW+L CYLCKQK  GA IQCHK+NCY AFHVTCAQ+AGLYMKI+   + +G  G    ++K+A+C+ HSP G         G+  G         T            K G   ++ K  +      R    P+   P IP  +L +I   + V  K +FM R+H YW +KR  R+GVPL+RRL +            D     +   LK+WQ++RQDLEKARLL EL RKRE++KRE  +   +  +  L P +  ++  +++L+  DT  IF  PV     P+Y + +  PMDF+ +  K ++++Y ++  L  DF+LM+SNC RYN+ +T+++  A +LR     +    + Q   IG D  TG+
Sbjct:   82 ENSEQSKKKDAPLPKPTFRKLDNFTVSDAPPLPVAYYRYMEKSGEELDNEAEYDMDEEDMAWLEMVNQ---------------KRVSDGH--ASVPPDTFELLIDRLERESILESRSQALSQSTIDEDAYCCVCLDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRRCLQSPSRPVDCVLCPNRGGAFKQTSDGSWAHVICAIWIPEVCFANTVFLEPVEGVKNIPPARWKLTCYLCKQKGRGASIQCHKANCYRAFHVTCAQRAGLYMKIDPVRE-TGTNGTTFTVKKTAYCENHSPPGTGTEGYEDNGLVGGRGNRGQRSYTLGPPLQQNQNGRKKGSAAQQKKTQKNSGGGSRKTGVPLLLVPQIPSFRLNKICTGVSVERKNQFMQRLHNYWLLKRHSRNGVPLIRRLHSHLQAQKSEQREPDAKLQAVREELKYWQKLRQDLEKARLLIELIRKRERLKREQMKLQQAALELQLTPALVFLRATLEQLKEKDTDHIFTTPVNLKEVPDYLEFVTVPMDFSTMHDKLEAHKYSSVADLENDFNLMVSNCLRYNSNDTVFHKAAMQLREVGGAILRHAQHQALSIGLDPSTGM 666          

HSP 2 Score: 127.487 bits (319), Expect = 3.712e-29
Identity = 63/126 (50.00%), Postives = 79/126 (62.70%), Query Frame = 3
Query: 3138 SQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLH---SNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIV 3506
            SQ++  +EPL LVWAKCRGYP +P +IVDP M   GI  N +PIP PP +V +LG+     S +  FLVLFFD KRTWQWL ++KL    + + +DR  L    K    KSVH AY  A+ HL  V
Sbjct:  792 SQNDGEMEPLTLVWAKCRGYPSYPAMIVDPKMPQEGILHNGIPIPVPPTDVLDLGKRRQEESEEKLFLVLFFDTKRTWQWLPQDKLHHMGIDDTVDRLRLMEGKKPNVRKSVHTAYDRAMTHLSHV 917          
BLAST of Peregrin vs. Ensembl Xenopus
Match: brpf1 (bromodomain and PHD finger containing 1 [Source:NCBI gene;Acc:100127652])

HSP 1 Score: 560.451 bits (1443), Expect = 3.226e-178
Identity = 325/845 (38.46%), Postives = 468/845 (55.38%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNV--NVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMIS-NLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDA------MAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVIN-----STFEDAHIYQLEKEL 2579
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL   H       + +   I    K          +   SA  + P     S+     + ++YA +++ V ++   R  R ++  N+ + +S D+D       E   N  + EN NDT  +   S   +   KRK S    ++        +  E+                         ++ E   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   N               +RR +     + + Q   EY++DR EKE +FES    + ++ IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL            +     + ++   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  ++ LQ  DT  IF EPV  +        P+Y + ++ PMDF  +++  ++  Y N ++   DF+L+++NC +YNA++TI+Y  AS+LR +   +  +  +Q ++IG D ETG+  +  I    I      + FE AH+    K+L
Sbjct:    3 VDFDVKTFCHNLRATKPPYECPVETCRKIYKSYSGIEYHLY--HYDHDNPPLQQQTPIRKSKK--------KGRHPRSANKQSPTNSEVSQSPTREV-MTYAQAQRLVEVELHGRVHRISIFDNLDV-VSEDDD----PPEETPENGSNKEN-NDTPATTPKSGKHKNKDKRKDSNHHHHHSATAGAATKLPEV-------------------------VYRE---LELDSPDAPPRPSSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMN---------------DRRKNDGV--NHIPQEIFEYLMDRLEKESYFESHNKGDPNSLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSVCKLPALSHSEGEEEDDEEEEDGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQNDPTDKNWVLKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQMALEMQLTPFLILLRKTLELLQEKDTSNIFTEPVPLSEVTEIYEVPDYLEHVKKPMDFQTMKRNLEAFRYQNFDQFEEDFNLIVNNCIKYNAKDTIFYRAASRLREQGAALLRQARKQAEKIGIDFETGMHIHPVITGNEIGRHEAPNNFERAHLSDSRKQL 783          

HSP 2 Score: 102.449 bits (254), Expect = 2.887e-21
Identity = 60/124 (48.39%), Postives = 77/124 (62.10%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            LE LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP +V +LG      + +H +LVLFFD KRTWQWL R KL P  +  ++D+  +    KS   KSV  AY  A++H   V  +P
Sbjct: 1087 LEALDLVWAKCRGYPSYPALIIDPKMPREGVFHHGVPIPVPPVDVLKLGEQMAQEAQEHLYLVLFFDNKRTWQWLPRTKLVPLGMNRELDKEKMLEGRKSNIRKSVQIAYDRAMQHRNKVQGDP 1210          
BLAST of Peregrin vs. Ensembl Xenopus
Match: brpf1 (bromodomain and PHD finger containing 1 [Source:NCBI gene;Acc:100127652])

HSP 1 Score: 553.132 bits (1424), Expect = 5.643e-175
Identity = 330/880 (37.50%), Postives = 472/880 (53.64%), Query Frame = 3
Query:  135 MDDIDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNV--NVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXI-------DEGSSEM----ISN----------------------LKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDA------MAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVIN-----STFEDAHIYQLEKEL 2579
            M  +D DV  F   +R  KPP+ CP + C K+++S+S I  HL   H       + +   I    K          +   SA  + P     S+     + ++YA +++ V ++   R  R ++  N+ + +S D+D       E   N  + EN NDT  +   S   +   KRK S    ++        +  E+                         ++ E   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   N               +RR +     + + Q   EY++DR EKE +FES    + ++ IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL             +       D+    +    ISN                      LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  ++ LQ  DT  IF EPV  +        P+Y + ++ PMDF  +++  ++  Y N ++   DF+L+++NC +YNA++TI+Y  AS+LR +   +  +  +Q ++IG D ETG+  +  I    I      + FE AH+    K+L
Sbjct:    1 MMGVDFDVKTFCHNLRATKPPYECPVETCRKIYKSYSGIEYHLY--HYDHDNPPLQQQTPIRKSKK--------KGRHPRSANKQSPTNSEVSQSPTREV-MTYAQAQRLVEVELHGRVHRISIFDNLDV-VSEDDD----PPEETPENGSNKEN-NDTPATTPKSGKHKNKDKRKDSNHHHHHSATAGAATKLPEV-------------------------VYRE---LELDSPDAPPRPSSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMN---------------DRRKNDGV--NHIPQEIFEYLMDRLEKESYFESHNKGDPNSLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSVCKLPALSHSEGEEEDDEEEEDGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQEMKWRIPISDDTPGHLGTIAISNEEPGDQANKNDPTDKNWVLKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQMALEMQLTPFLILLRKTLELLQEKDTSNIFTEPVPLSEVTEIYEVPDYLEHVKKPMDFQTMKRNLEAFRYQNFDQFEEDFNLIVNNCIKYNAKDTIFYRAASRLREQGAALLRQARKQAEKIGIDFETGMHIHPVITGNEIGRHGRENDFERAHLSDSRKQL 816          

HSP 2 Score: 102.834 bits (255), Expect = 2.715e-21
Identity = 60/124 (48.39%), Postives = 77/124 (62.10%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            LE LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP +V +LG      + +H +LVLFFD KRTWQWL R KL P  +  ++D+  +    KS   KSV  AY  A++H   V  +P
Sbjct: 1120 LEALDLVWAKCRGYPSYPALIIDPKMPREGVFHHGVPIPVPPVDVLKLGEQMAQEAQEHLYLVLFFDNKRTWQWLPRTKLVPLGMNRELDKEKMLEGRKSNIRKSVQIAYDRAMQHRNKVQGDP 1243          
BLAST of Peregrin vs. Ensembl Xenopus
Match: tf (transferrin [Source:Xenbase;Acc:XB-GENE-480506])

HSP 1 Score: 527.324 bits (1357), Expect = 1.996e-168
Identity = 290/704 (41.19%), Postives = 411/704 (58.38%), Query Frame = 3
Query:  438 LSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPA---GIRKSAFCDVHSPSG-------------YKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX-XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            L+YA +++ V ++ + R  R ++  P+ I  ++DL    I E N+N    ENS    Q  L S       KR ++   K   ++             PE K +         V++   P               P+    Y K+ +K+ EELD+ VEYD+DEED  WL   NE               +R S     S V Q   E+++DRFEKE + E+    +  + IDEDAVC +C+DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL S + P+DC LCPNKGGAFK+T+D+RW HVVC LWIPE+ FAN +F+EPI+ V  I  ARW+L CYLCKQK VGACIQCHK+NCYTAFHVTCAQ+AGLYMK+E  ++++G      ++K+A+CD H+P G              K G+ R    +SD+ + S    +R  K    +K LN+  N    I+ P IPP+++ +I + + +  K++F+ R+H+YW +KR  R+G+PLLRRL +S      +     DE    +   LK+ Q++R DLE+ARLL EL RKREK+KRE  +      +  L P   L++ L+++LQ  D  +IFA PV     P+Y   I+ PMDF+ ++K+ +   Y N+     DF+L++ NC +YNA++TI+Y  A +LR     +  +  R+ + IGFD+ETG+
Sbjct:   31 LTYAQAQRMVEIEIEGRLHRISIFDPLEIVSEDDLTAQEINECNSNK---ENSEQPPQVCLRS-------KRHKASKEKKKSEVLPTAHGHTTTSVLPEPKVR---------VIECSPP-------------SAPNRSPSYYKFQDKSPEELDKEVEYDMDEEDYAWLEIINE---------------KRKSEGF--SAVSQDIFEFLMDRFEKESYCENQKQGDQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRNIPIDCVLCPNKGGAFKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGLYMKMEPVKEVAGSITTFSVKKTAYCDAHTPPGCVRRPLNIYEEPESKNGICR---KSSDKNIRSTSKARR--KTTKAKKELNETCNVLPTITVPDIPPQRVNKIINQVSIPRKKQFIERVHSYWMLKRLSRNGIPLLRRLQSSLQSQRNIQESEDDEEVQALKKKLKYLQRLRHDLERARLLIELIRKREKLKREQVKVEQVAMELKLTPLTVLLRSLLEQLQEKDPARIFAHPVNLTEVPDYLDHIKHPMDFSTMKKRLEDQRYRNLNEFEEDFNLIIENCMKYNAKDTIFYRAAVRLRDHGGVLLRQARREANVIGFDEETGM 680          

HSP 2 Score: 109.383 bits (272), Expect = 1.740e-23
Identity = 56/131 (42.75%), Postives = 75/131 (57.25%), Query Frame = 3
Query: 3132 IKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            + + ++  LEPL +VWAKC GYP +P LI+DP M   G   N V IP PP +V + G   +  + +  FLVLFFD KR+WQWL + K+ P  V E ID+  +     S   K+V  AY  A+ HL  V  E
Sbjct:  826 VAASTSAFLEPLKVVWAKCSGYPSYPALIIDPKMPRVGCHHNGVAIPVPPMDVLKTGDQMQTRAEEKLFLVLFFDNKRSWQWLPKSKMVPLGVDETIDKLKMMEGRNSSIRKAVRVAYDRALNHLSRVQGE 956          
BLAST of Peregrin vs. Ensembl Xenopus
Match: tf (transferrin [Source:Xenbase;Acc:XB-GENE-480506])

HSP 1 Score: 526.939 bits (1356), Expect = 1.261e-167
Identity = 290/704 (41.19%), Postives = 412/704 (58.52%), Query Frame = 3
Query:  438 LSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPA---GIRKSAFCDVHSPSG-------------YKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMI-SNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            L+YA +++ V ++ + R  R ++  P+ I  ++DL    I E N+N    ENS    Q  L S       KR ++   K   ++             PE K +         V++   P               P+    Y K+ +K+ EELD+ VEYD+DEED  WL   NE               +R S     S V Q   E+++DRFEKE + E+    +  + IDEDAVC +C+DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL S + P+DC LCPNKGGAFK+T+D+RW HVVC LWIPE+ FAN +F+EPI+ V  I  ARW+L CYLCKQK VGACIQCHK+NCYTAFHVTCAQ+AGLYMK+E  ++++G      ++K+A+CD H+P G              K G+ R    +SD+ + S    +R  K    +K LN+  N    I+ P IPP+++ +I + + +  K++F+ R+H+YW +KR  R+G+PLLRRL +S         S D+   + +   LK+ Q++R DLE+ARLL EL RKREK+KRE  +      +  L P   L++ L+++LQ  D  +IFA PV     P+Y   I+ PMDF+ ++K+ +   Y N+     DF+L++ NC +YNA++TI+Y  A +LR     +  +  R+ + IGFD+ETG+
Sbjct:   31 LTYAQAQRMVEIEIEGRLHRISIFDPLEIVSEDDLTAQEINECNSNK---ENSEQPPQVCLRS-------KRHKASKEKKKSEVLPTAHGHTTTSVLPEPKVR---------VIECSPP-------------SAPNRSPSYYKFQDKSPEELDKEVEYDMDEEDYAWLEIINE---------------KRKSEGF--SAVSQDIFEFLMDRFEKESYCENQKQGDQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRNIPIDCVLCPNKGGAFKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGLYMKMEPVKEVAGSITTFSVKKTAYCDAHTPPGCVRRPLNIYEEPESKNGICR---KSSDKNIRSTSKARR--KTTKAKKELNETCNVLPTITVPDIPPQRVNKIINQVSIPRKKQFIERVHSYWMLKRLSRNGIPLLRRLQSSLQSQRNIQESEDDEEVQALKKKLKYLQRLRHDLERARLLIELIRKREKLKREQVKVEQVAMELKLTPLTVLLRSLLEQLQEKDPARIFAHPVNLTEVPDYLDHIKHPMDFSTMKKRLEDQRYRNLNEFEEDFNLIIENCMKYNAKDTIFYRAAVRLRDHGGVLLRQARREANVIGFDEETGM 680          

HSP 2 Score: 111.694 bits (278), Expect = 4.373e-24
Identity = 64/165 (38.79%), Postives = 89/165 (53.94%), Query Frame = 3
Query: 3033 HESQDVDDEDSTQDNSNNIFDSFDASEEDETE-GIKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            H  +D  +  S  +N N    +  A+E  +T   + + ++  LEPL +VWAKC GYP +P LI+DP M   G   N V IP PP +V + G   +  + +  FLVLFFD KR+WQWL + K+ P  V E ID+  +     S   K+V  AY  A+ HL  V  E
Sbjct:  847 HTIEDRSELISCIENGNYARAARIAAEVGQTNMWVAASTSAFLEPLKVVWAKCSGYPSYPALIIDPKMPRVGCHHNGVAIPVPPMDVLKTGDQMQTRAEEKLFLVLFFDNKRSWQWLPKSKMVPLGVDETIDKLKMMEGRNSSIRKAVRVAYDRALNHLSRVQGE 1011          
BLAST of Peregrin vs. Ensembl Xenopus
Match: tf (transferrin [Source:Xenbase;Acc:XB-GENE-480506])

HSP 1 Score: 528.48 bits (1360), Expect = 1.264e-166
Identity = 290/704 (41.19%), Postives = 411/704 (58.38%), Query Frame = 3
Query:  438 LSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPA---GIRKSAFCDVHSPSG-------------YKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXX-XXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            L+YA +++ V ++ + R  R ++  P+ I  ++DL    I E N+N    ENS    Q  L S       KR ++   K   ++             PE K +         V++   P               P+    Y K+ +K+ EELD+ VEYD+DEED  WL   NE               +R S     S V Q   E+++DRFEKE + E+    +  + IDEDAVC +C+DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL S + P+DC LCPNKGGAFK+T+D+RW HVVC LWIPE+ FAN +F+EPI+ V  I  ARW+L CYLCKQK VGACIQCHK+NCYTAFHVTCAQ+AGLYMK+E  ++++G      ++K+A+CD H+P G              K G+ R    +SD+ + S    K ++K    +K LN+  N    I+ P IPP+++ +I + + +  K++F+ R+H+YW +KR  R+G+PLLRRL +S            DE    +   LK+ Q++R DLE+ARLL EL RKREK+KRE  +      +  L P   L++ L+++LQ  D  +IFA PV     P+Y   I+ PMDF+ ++K+ +   Y N+     DF+L++ NC +YNA++TI+Y  A +LR     +  +  R+ + IGFD+ETG+
Sbjct:   31 LTYAQAQRMVEIEIEGRLHRISIFDPLEIVSEDDLTAQEINECNSN---KENSEQPPQVCLRS-------KRHKASKEKKKSEVLPTAHGHTTTSVLPEPKVR---------VIECSPP-------------SAPNRSPSYYKFQDKSPEELDKEVEYDMDEEDYAWLEIINE---------------KRKSEGF--SAVSQDIFEFLMDRFEKESYCENQKQGDQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRNIPIDCVLCPNKGGAFKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGLYMKMEPVKEVAGSITTFSVKKTAYCDAHTPPGCVRRPLNIYEEPESKNGICR---KSSDKNIRST--SKARRKTTKAKKELNETCNVLPTITVPDIPPQRVNKIINQVSIPRKKQFIERVHSYWMLKRLSRNGIPLLRRLQSSLQSQRNIQESEDDEEVQALKKKLKYLQRLRHDLERARLLIELIRKREKLKREQVKVEQVAMELKLTPLTVLLRSLLEQLQEKDPARIFAHPVNLTEVPDYLDHIKHPMDFSTMKKRLEDQRYRNLNEFEEDFNLIIENCMKYNAKDTIFYRAAVRLRDHGGVLLRQARREANVIGFDEETGM 680          

HSP 2 Score: 111.694 bits (278), Expect = 4.651e-24
Identity = 64/165 (38.79%), Postives = 89/165 (53.94%), Query Frame = 3
Query: 3033 HESQDVDDEDSTQDNSNNIFDSFDASEEDETE-GIKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            H  +D  +  S  +N N    +  A+E  +T   + + ++  LEPL +VWAKC GYP +P LI+DP M   G   N V IP PP +V + G   +  + +  FLVLFFD KR+WQWL + K+ P  V E ID+  +     S   K+V  AY  A+ HL  V  E
Sbjct:  987 HTIEDRSELISCIENGNYARAARIAAEVGQTNMWVAASTSAFLEPLKVVWAKCSGYPSYPALIIDPKMPRVGCHHNGVAIPVPPMDVLKTGDQMQTRAEEKLFLVLFFDNKRSWQWLPKSKMVPLGVDETIDKLKMMEGRNSSIRKAVRVAYDRALNHLSRVQGE 1151          
BLAST of Peregrin vs. Ensembl Mouse
Match: Brpf1 (bromodomain and PHD finger containing, 1 [Source:MGI Symbol;Acc:MGI:1926033])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 324/826 (39.23%), Postives = 462/826 (55.93%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITI-HKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL    H      +   +     + +     N QS   +E +  + P  +           +SYA +++ V +    R  R        ISI ++L+  +  E       +  SN  +    ++  K        S   KN +K +  N       ++   K  E+  +E E+   TP               + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 D+ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    ++    ++   EDA
Sbjct:    3 VDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDSPPPPQQTPLRKHKKKGRQSRPANKQSPSPSEVS--QSPGRE----------VMSYAQAQRMVEVDLHGRVHR--------ISIFDNLDVVSEDEEAPEEAPENGSNKENTETPAATPK--------SGKHKNKEKRKDSNHHHHSAPASAAPKLPEVVYRELEQ--DTP---------------DAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEEEDEEEDEGKSWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCEQVGRDSDDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKIQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHNLAGDEVSHHTEDA 764          

HSP 2 Score: 122.865 bits (307), Expect = 1.179e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1116 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1238          
BLAST of Peregrin vs. Ensembl Mouse
Match: Brpf1 (bromodomain and PHD finger containing, 1 [Source:MGI Symbol;Acc:MGI:1926033])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 324/826 (39.23%), Postives = 462/826 (55.93%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITI-HKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL    H      +   +     + +     N QS   +E +  + P  +           +SYA +++ V +    R  R        ISI ++L+  +  E       +  SN  +    ++  K        S   KN +K +  N       ++   K  E+  +E E+   TP               + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 D+ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    ++    ++   EDA
Sbjct:    3 VDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDSPPPPQQTPLRKHKKKGRQSRPANKQSPSPSEVS--QSPGRE----------VMSYAQAQRMVEVDLHGRVHR--------ISIFDNLDVVSEDEEAPEEAPENGSNKENTETPAATPK--------SGKHKNKEKRKDSNHHHHSAPASAAPKLPEVVYRELEQ--DTP---------------DAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEEEDEEEDEGKSWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCEQVGRDSDDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKIQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHNLAGDEVSHHTEDA 764          

HSP 2 Score: 122.865 bits (307), Expect = 1.253e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct:  987 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1109          
BLAST of Peregrin vs. Ensembl Mouse
Match: Brpf1 (bromodomain and PHD finger containing, 1 [Source:MGI Symbol;Acc:MGI:1926033])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 321/808 (39.73%), Postives = 455/808 (56.31%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITI-HKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL    H      +   +     + +     N QS   +E +  + P  +           +SYA +++ V +    R  R        ISI ++L+  +  E       +  SN  +    ++  K        S   KN +K +  N       ++   K  E+  +E E+   TP               + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 D+ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+
Sbjct:    3 VDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDSPPPPQQTPLRKHKKKGRQSRPANKQSPSPSEVS--QSPGRE----------VMSYAQAQRMVEVDLHGRVHR--------ISIFDNLDVVSEDEEAPEEAPENGSNKENTETPAATPK--------SGKHKNKEKRKDSNHHHHSAPASAAPKLPEVVYRELEQ--DTP---------------DAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEEEDEEEDEGKSWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCEQVGRDSDDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKIQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGM 746          

HSP 2 Score: 122.865 bits (307), Expect = 1.188e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1115 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1237          
BLAST of Peregrin vs. Ensembl Mouse
Match: Brpf1 (bromodomain and PHD finger containing, 1 [Source:MGI Symbol;Acc:MGI:1926033])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 321/808 (39.73%), Postives = 455/808 (56.31%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITI-HKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL    H      +   +     + +     N QS   +E +  + P  +           +SYA +++ V +    R  R        ISI ++L+  +  E       +  SN  +    ++  K        S   KN +K +  N       ++   K  E+  +E E+   TP               + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 D+ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+
Sbjct:    3 VDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDSPPPPQQTPLRKHKKKGRQSRPANKQSPSPSEVS--QSPGRE----------VMSYAQAQRMVEVDLHGRVHR--------ISIFDNLDVVSEDEEAPEEAPENGSNKENTETPAATPK--------SGKHKNKEKRKDSNHHHHSAPASAAPKLPEVVYRELEQ--DTP---------------DAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEEEDEEEDEGKSWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCEQVGRDSDDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKIQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGM 746          

HSP 2 Score: 122.865 bits (307), Expect = 1.153e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1081 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1203          
BLAST of Peregrin vs. Ensembl Mouse
Match: Brpf1 (bromodomain and PHD finger containing, 1 [Source:MGI Symbol;Acc:MGI:1926033])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 324/832 (38.94%), Postives = 462/832 (55.53%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITI-HKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDA------MAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL    H      +   +     + +     N QS   +E +  + P  +           +SYA +++ V +    R  R        ISI ++L+  +  E       +  SN  +    ++  K        S   KN +K +  N       ++   K  E+  +E E+   TP               + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 D+ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +        P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    ++    ++   EDA
Sbjct:    3 VDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDSPPPPQQTPLRKHKKKGRQSRPANKQSPSPSEVS--QSPGRE----------VMSYAQAQRMVEVDLHGRVHR--------ISIFDNLDVVSEDEEAPEEAPENGSNKENTETPAATPK--------SGKHKNKEKRKDSNHHHHSAPASAAPKLPEVVYRELEQ--DTP---------------DAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEEEDEEEDEGKSWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCEQVGRDSDDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKIQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHNLAGDEVSHHTEDA 770          

HSP 2 Score: 123.25 bits (308), Expect = 1.101e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1088 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1210          
BLAST of Peregrin vs. UniProt/SwissProt
Match: sp|B2RRD7|BRPF1_MOUSE (Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 321/808 (39.73%), Postives = 455/808 (56.31%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITI-HKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL    H      +   +     + +     N QS   +E +  + P  +           +SYA +++ V +    R  R        ISI ++L+  +  E       +  SN  +    ++  K        S   KN +K +  N       ++   K  E+  +E E+   TP               + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 D+ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+
Sbjct:    3 VDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDSPPPPQQTPLRKHKKKGRQSRPANKQSPSPSEVS--QSPGRE----------VMSYAQAQRMVEVDLHGRVHR--------ISIFDNLDVVSEDEEAPEEAPENGSNKENTETPAATPK--------SGKHKNKEKRKDSNHHHHSAPASAAPKLPEVVYRELEQ--DTP---------------DAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEEEDEEEDEGKSWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCEQVGRDSDDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKIQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGM 746          

HSP 2 Score: 122.865 bits (307), Expect = 8.064e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1081 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1203          
BLAST of Peregrin vs. UniProt/SwissProt
Match: sp|P55201|BRPF1_HUMAN (Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2)

HSP 1 Score: 556.214 bits (1432), Expect = 7.891e-176
Identity = 290/653 (44.41%), Postives = 395/653 (60.49%), Query Frame = 3
Query:  699 NEESKEILSNPEDKTKEMKNKEQEK-----------VLQTPIPIFIEDI--NLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYKAGVSRGMYAN---------------SDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX---XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDA 2552
            N  +KE    P    K  K+K +EK           V  +  P   E +   LE    + P     Y +Y+EK+AEELDE VEYD+DEED IWL   NE               RR +    P  + Q   EY++DR EKE +FES    + +  +DEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G    +    ++                S E++   K  K + K+K  RK+L ++R     +S P IPP +L +IT+ + ++ K +FM R+H+YW +KR+ R+GVPLLRRL                 ++ +  +   LK WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P + L++  +++LQ  DTG IF+EPV  +  P+Y   I+ PMDF  +++  ++  Y+N +    DF+L++SNC +YNA++TI+Y  A +LR +   V  +  RQ +++G D ETG+    S+         EDA
Sbjct:  132 NGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNE---------------RRKTEGVSP--IPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAK-AKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDA 765          

HSP 2 Score: 123.25 bits (308), Expect = 7.168e-27
Identity = 61/123 (49.59%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRL---HSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            L+ LDLVWAKCRGYP +P LI+DP M   G+  + VPIP PP  V +LG      + +H +LVLFFD KRTWQWL R KL P  V +D+D+  +    KS   KSV  AY  A++H   V  E
Sbjct: 1083 LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE 1205          
BLAST of Peregrin vs. UniProt/SwissProt
Match: sp|G5E8P1|BRD1_MOUSE (Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 1.683e-166
Identity = 289/706 (40.93%), Postives = 409/706 (57.93%), Query Frame = 3
Query:  438 LSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG---IRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPG--KRQKKLKDVRKLLNKRRNYTA-------------PISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX-XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            L+YA +++ V ++ + R  R ++  P+ I +++DL    ++E N+N    ENS              + ++ KR    KN  +++K NE        P   +           L  P    +E     Y     P     Y K++EK+AEELD  VEYD+DEED  WL   NE               R+     C S V Q   E+++DRFEKE + E+       + IDEDAVC +C+DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL S + P DC LCPNKGGAFK+T+D+RW HVVC LWIPE+ FAN +F+EPI+ V  I  ARW+L CYLCKQK VGACIQCHK+NCYTAFHVTCAQ+AGLYMK+E  ++++G +    +RK+A+CDVH+P G      R +    D E+   K G  +++  +K VR     R+                  +  P IPP++L  I + + ++ K++F+ R H+YW +KR  R+G PLLRRL +S            DE        LK+WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P   L++ ++++LQ  D  KIFA+PV+    P+Y   I+ PMDF  +RK+ ++  Y N+     DF+L++ NC +YNA++T++Y  A +LR +   V  +  R+ + IG ++ +G+
Sbjct:   31 LTYAQAQRMVEIEIEGRLHRISIFDPLEIILEDDLTAQEMSECNSN---KENSERPP----------VCLRTKRH---KN-NRVKKKNEVLPSTHGTPASAS----------ALPEPKVRIVE-----YSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIINE--------------KRKGD---CVSAVSQNMFEFLMDRFEKESYCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGSATFSVRKTAYCDVHTPPGC---TRRPLNIYGDVEM---KNGVCRKESSVKTVRSTSKVRKKAKKAKKTLAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYWLLKRLSRNGAPLLRRLQSSLQSQRNTQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIELLRKREKLKREQVKVEQMAMELRLTPLTVLLRSVLEQLQEKDPAKIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHAFEEDFNLIVDNCMKYNAKDTVFYRAAVRLRDQGGVVLRQARREVESIGLEEASGM 681          

HSP 2 Score: 108.612 bits (270), Expect = 2.065e-22
Identity = 68/186 (36.56%), Postives = 93/186 (50.00%), Query Frame = 3
Query: 2970 EETKLNSSISFNDYTKNPEIAHESQDVDDEDSTQDNSNNIFDSFDASEEDETEGIKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            + ++L S I   +Y K   IA E              +N++ S DA+               LEPL +VWAKC GYP +P LI+DP M       N V IP PP +V ++G   +  S +  FLVLFFD KR+WQWL + K+ P  V E ID+  +     S   K+V  A+  A+ HL  V+ EP
Sbjct:  888 DRSELISCIENGNYAKAARIAAEV-----------GQSNMWISTDAAASV------------LEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSEEKLFLVLFFDNKRSWQWLPKSKMVPLGVDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEP 1050          
BLAST of Peregrin vs. UniProt/SwissProt
Match: sp|O95696|BRD1_HUMAN (Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 4.205e-165
Identity = 290/704 (41.19%), Postives = 408/704 (57.95%), Query Frame = 3
Query:  438 LSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPA---GIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTA-------------PISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXI-DEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            L+YA +++ V ++ + R  R ++  P+ I +++DL    ++E N+N    ENS              + ++ KR    KN  +++K NE        P   +           L  P    +E     Y     P     Y K++EK+AEELD  VEYD+DEED  WL   NE               R+     C   V Q+  E+++DRFEKE H E+       + IDEDAVC +C+DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL S + P DC LCPNKGGAFK+T+D+RW HVVC LWIPE+ FAN +F+EPI+ V  I  ARW+L CYLCKQK VGACIQCHK+NCYTAFHVTCAQ+AGLYMK+E  ++++G      +RK+A+CDVH+P G      R +    D E+ +    +++  +K VR     R+                  +  P IPP++L  I + + ++ K++F+ R H+YW +KR  R+G PLLRRL +S      +     DE        LK+WQ++R DLE+ARLL EL RKREK+KRE  +      +  L P   L++ ++D+LQ  D  +IFA+PV+    P+Y   I+ PMDF  +RK+ ++  Y N+     DFDL++ NC +YNAR+T++Y  A +LR +   V  +  R+ D IG ++ +G+
Sbjct:   31 LTYAQAQRMVEIEIEGRLHRISIFDPLEIILEDDLTAQEMSECNSNK---ENSERPP----------VCLRTKRH---KN-NRVKKKNEALPSAHGTPASAS----------ALPEPKVRIVE-----YSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIVNE--------------KRKGD---CVPAVSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGC---TRRPLNIYGDVEMKNGV-CRKESSVKTVRSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYWLLKRLSRNGAPLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIELLRKREKLKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGM 681          

HSP 2 Score: 107.457 bits (267), Expect = 4.186e-22
Identity = 55/124 (44.35%), Postives = 74/124 (59.68%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            LEPL +VWAKC GYP +P LI+DP M       N V IP PP +V ++G   +  S++  FLVLFFD KR+WQWL + K+ P  + E ID+  +     S   K+V  A+  A+ HL  V+ EP
Sbjct:  927 LEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEP 1050          
BLAST of Peregrin vs. UniProt/SwissProt
Match: sp|B2KF05|BRPF3_MOUSE (Bromodomain and PHD finger-containing protein 3 OS=Mus musculus OX=10090 GN=Brpf3 PE=1 SV=1)

HSP 1 Score: 511.531 bits (1316), Expect = 4.268e-159
Identity = 269/597 (45.06%), Postives = 355/597 (59.46%), Query Frame = 3
Query:  828 EKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKIS--GPA-GIRKSAFCDVHSPS----GYKAGVSRGMYANSDEELTS-----------------------------EKPGK---RQKKLKDVRKLLNKRRNYTAP-ISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXX-XXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETG 2495
            + E P     Y +Y+EK  E+LD  VEYD+DEED+ WL   NE               RRA      S V   T E ++DR EKE + ES +     + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL SPS PVDC LCPNKGGAFKQT+D  WAHVVC +WIPE+ FAN +FLEPIE ++ I  ARW+L CY+CKQK +GA IQCHK NCYTAFHVTCAQ+AGL+MKIE   + S  G    +RK+A+C+ HSPS      K    R +    DE+                                 K GK   +QK  K+  +   +  + T P ++ P IP  +L +I   +  + K +FM R+H YW +KR+ R+GVPL+RRL +             DE +S +   LK+WQ++R DLE+ARLL EL RKREK+KRE  +   +  +  L P   L++  +D LQ  D+  IFAEPV+ +  P+Y + I  PMDF+ +R+K +S+ Y  +E    DF+L+++NC +YNA++TI++  A +LR     +     RQ + IG+D E G
Sbjct:  127 QPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDIAWLDMVNE--------------KRRADGH---SSVSADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVCFANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFMKIEPMRETSLNGTTFTVRKTAYCEAHSPSVAVARRKGDSPRSLSEVGDEDGPKEGGGEEEQEEAEEEGQEGQGGVGSPLKGVSKKGKMSLKQKIKKEPEEAGREAPSITLPMVTVPQIPSYRLNKICSGLSFQRKTQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDEKTSAVKEELKYWQKLRHDLERARLLIELIRKREKLKREQVKVQQAAMELELMPFTVLLRTTLDLLQEKDSAHIFAEPVSLSEVPDYLEFISKPMDFSTMRRKLESHLYHTLEEFEEDFNLIVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERG 706          

HSP 2 Score: 124.02 bits (310), Expect = 3.792e-27
Identity = 60/120 (50.00%), Postives = 78/120 (65.00%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIV 3506
            LEPL+LVWAKCRGYP +P LI+DP M   G+  N VPIP PP +V +LG   +  + +  FLVLFFD KRTWQWL R+K+ P  V++ +D+  +    K+   KSV  AY  A+ HL  V
Sbjct: 1073 LEPLELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGERLFLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRV 1192          
BLAST of Peregrin vs. TrEMBL
Match: A0A5K4F181 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 359/826 (43.46%), Postives = 506/826 (61.26%), Query Frame = 3
Query:  132 IMDDIDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDN--ESAYLKIPN-----MKHTSKFVIDTIQLSYADSKKFVILQ----NDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIR--KLNEESKEILSNPEDKTKEMKN-KEQEKVLQTPIPIFIEDINLEYFEKETPHDVEG--YVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESIT-------------GSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNID--VRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXI-----DEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLF 2501
            +   +D D+D+FL+RI+GNKPPF CP + C K+ RS++ + KH++ +H+    I+I    V  + + +  C +   N  +  E A + + +      +H SK       +++ D+   V+ +        +FRCN+ VP+ I   ++++N    +  T+T       + S+SE     K+    R +    KN  +I+  K  + S +  S+   K     N  E   V++ P  ++   I+ E+  +++ H  EG  Y++++EKT++ELDE+VEYDLDEEDL WL + N                +R S    P  V ++T+E+++DRFEK+  F   T             G N H+ IDEDAVC VC DGTC+N+NVILFCDVCNLAVHQECYGVPYVPEG WLCRKCLHSPS PV C LCPN+GGAFK+T D+RWAHV+CGLW+PE+MFANL FLEP+E +++I AARWRL C++CKQ+NVGACIQCHKS+CY AFHVTCAQ AGLYMKIE ++   G  GIRKSAFCD H P  + +  ++GMYA+SD +         +  L+  RK+L +RRN    +  P++   K+  I   +     +K EF+ + +A+WK+KRE+R GVPLL+RL A S   + A  ++     D  S +M ++LKFWQQ+RQDLE+ RLLSEL RKRE+IKR++FR F++  D  + P +      ID+LQ LDT + FAEPV  ++AP+YS II+ PMDF+ +RKK ++ EY  I  L  DF+LM+ NC  YN   +IYY  A KLR  S P+         +I F  +TGL 
Sbjct:    2 VYHPVDFDIDDFLSRIQGNKPPFVCPSETCQKVCRSYNYMQKHML-LHRPPAPIDIPGPLVNGEVSSNFKCASALENGSDQIEKAPIVVGHPTENLCRHQSK-----TPMTFTDAHTSVVFEASPATKGHTFRCNICVPLTICF-QNMSNKVDHDSCTST------QELSKSEGIPINKKQPSSRSKMPHHKNKGRIKNNKSGQISDKQQSDLGGKGSLYTNGTEVNNVIEIPKAVY--SIDPEFSIRKSIHLKEGSSYIRFIEKTSDELDEVVEYDLDEEDLFWLKRINA---------------KRNSLSLPP--VSESTLEWIMDRFEKKARFRLFTSNGCETTDVLPDIGGN-HSGIDEDAVCAVCQDGTCENTNVILFCDVCNLAVHQECYGVPYVPEGPWLCRKCLHSPSEPVSCVLCPNRGGAFKKTTDDRWAHVICGLWVPEVMFANLTFLEPLEGIDRIAAARWRLQCFICKQRNVGACIQCHKSSCYRAFHVTCAQHAGLYMKIEHTDD-PGDLGIRKSAFCDQHCPPDHFSSSNKGMYAHSDSDGPQSPERAARIHLRKARKILAERRNSKPSVCVPIVSKAKIDLILSKLSGVSGDKMEFLKQTYAFWKLKREFRRGVPLLKRLQACSLHRSAANFAVAATTGDAESHQMRAHLKFWQQLRQDLERGRLLSELIRKRERIKRDIFRLFVTEIDFKIKPLVVFQLRFIDQLQALDTNQFFAEPVEPSLAPDYSLIIKKPMDFSTMRKKIENFEYCTINELLSDFNLMLENCFEYNRETSIYYTAAMKLRERSKPIISEALTIAKQINFCPKTGLL 793          

HSP 2 Score: 128.257 bits (321), Expect = 7.005e-26
Identity = 61/131 (46.56%), Postives = 84/131 (64.12%), Query Frame = 3
Query: 3153 RLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG-RLHSNQHK-----FLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPY 3527
            +  PLD+VWAKC G PW+P +IVDP  ++ G   N VPIP PPE+V + G R+  N+        LVLFFD KRTWQWL  +KL+P  + +++D   L+   KS+   SV +AY+ A+ H+C V+  PYPY
Sbjct: 1304 QFSPLDIVWAKCLGSPWYPAIIVDP-DANEGYSHNGVPIPLPPESVLKWGKRIAFNKSTDDSELLLVLFFDTKRTWQWLSPQKLQPLGINKELDYERLREGRKSKMKHSVTKAYRRAVEHICKVHGRPYPY 1433          
BLAST of Peregrin vs. TrEMBL
Match: A0A4Z2DLA2 (Peregrin OS=Schistosoma japonicum OX=6182 GN=EWB00_011311 PE=4 SV=1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 355/829 (42.82%), Postives = 503/829 (60.68%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDC-NNVQSNKDNESAYLKIPNMKHTSKFVIDTIQ------LSYADSKKFVILQ----NDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFS----LKNYKKIRKLNEESKEILSNPEDKTK-------EMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEG--YVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNL------------HNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNID--VRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXI-----DEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLF 2501
            +D D+D+FL+RI+GNKPPF CP + C K+ RS++ + KH++ +H+    I+I    V  + +  + C +++++  D  S  L +    +TSK   D  Q      + + D+   V+ +        +FRCN+ VP+ +     L NT       N + D+    T   +  S  + I I +K++F     L +  K R  N ++  ++ +  DK K              E      IP  +  I+ E+  +++    EG  Y++++EKTA+ELDE+VEYDLDEEDL WL + N                +R S    P  V ++T+E+++DRFEK+  F   + S              H+ IDEDAVC VC DGTC+N+NVILFCDVCNLAVHQECYGVPYVPEG WLCRKCLHSPS PV C LCPN+GGAFK+T D+RWAHV+CGLW+PE+MFANL FLEP+E +++I  ARWRL C++CKQ+NVGACIQCHKS+CY AFHVTCAQ AGLYMKIE ++   G +GIRKSAFCD H P  + +  ++GMYA+SD +         +  L+  RK+L +RRN    +  P++   K+  I   +     +K EF+ + +A+WK+KRE+R GVPLL+RL A S   + A  ++     D  S +M + LKFWQQ+RQDLE+ RLLSEL RKRE+IKR++FR+F+   +  + P +      ID+LQ LDT + FA+PV  ++AP+Y+ II+ PMDF+ IRKK ++ +YI ++ +  DF+LM+ NC  YN   +IYY  A KLR  S P+         +I F  +TGL 
Sbjct:   38 VDFDIDDFLSRIQGNKPPFVCPSETCQKVCRSYNYMQKHML-LHRPPTPIDIPGPLVNGNISAGLKCISSLKNASDQTSKELIL--FSNTSK---DFYQQQNRNSMVFTDAHSSVVFEASPATKGHTFRCNIYVPLTVR----LQNTP------NQIEDDPLIST---QTLSKPESISINKKQTFGRSKILHHKNKGRIKNNKNGLVMGHSSDKQKYESCDKGSFHTSGVEVNSAVEIPKAVYSIDPEFSIRKSIRLKEGSSYIRFIEKTADELDEVVEYDLDEEDLFWLERINA---------------KRKSLSLLP--VTESTLEWIMDRFEKKARFRMSSSSGYETTDVYPDIGGNHSGIDEDAVCAVCQDGTCENTNVILFCDVCNLAVHQECYGVPYVPEGPWLCRKCLHSPSEPVSCVLCPNRGGAFKKTTDDRWAHVICGLWVPEVMFANLTFLEPLEGIDRIAPARWRLQCFICKQRNVGACIQCHKSSCYRAFHVTCAQHAGLYMKIEHTDD-PGDSGIRKSAFCDQHCPPDHFSSSNKGMYAHSDSDGPQSPERAARIHLRKARKILAERRNSKPSVCVPIVSKAKMNLILSKLSGVSGDKMEFLKQTYAFWKLKREFRRGVPLLKRLQACSLHRSAANFAVAATTGDAESHQMRAQLKFWQQLRQDLERGRLLSELIRKRERIKRDIFRSFVKETELKIKPFVVFQLRFIDKLQALDTNQFFAKPVEPSLAPDYALIIKNPMDFSTIRKKIENFDYITMDDMLSDFNLMLENCFEYNRETSIYYTAAVKLRERSRPIISEALALMKQINFCPKTGLL 829          

HSP 2 Score: 129.798 bits (325), Expect = 2.137e-26
Identity = 62/131 (47.33%), Postives = 84/131 (64.12%), Query Frame = 3
Query: 3153 RLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG-RLHSNQHK-----FLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPY 3527
            +L PLD VWAKC G PW+P +IVDP  +S G   N VPIP PPE+V + G R+  N+        LVLFFD KRTWQWL  +KL+P  + +++D   L+   +S+   SV +AY+ A+ H+C V+  PYPY
Sbjct: 1348 QLSPLDTVWAKCLGSPWYPAIIVDP-DASEGYSHNGVPIPQPPESVLKWGKRIVCNKSTDDLELLLVLFFDTKRTWQWLSPQKLQPLGMNKELDCEKLREGRRSKMKHSVTKAYRRAVEHICKVHGRPYPY 1477          
BLAST of Peregrin vs. TrEMBL
Match: A0A5K3FIJ2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 349/804 (43.41%), Postives = 494/804 (61.44%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDK---RSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETP-HDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFES-------ITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVH-SPSGYKAGVSRGMYANSDEELTSEKPGK---RQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDV--RNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXI-----DEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVF-ERYERQYDEIGFDK 2486
            +D D+ EFL RI GNKPP+ CP DGC + F+SF AI +H+   H+    +             DI    + + +   SA+ +  ++   SKF      + + DS+K V+         S RC+++VP++ S D                   NS+D    +L +  + + ++R ++   +   +   +  +S   +S   ++   ++N ++    + PIP F  D N     K  P  D   Y++++E++ +ELDEIVEYDLDEEDL WL K N                 R S    P  ++Q+T+E+V+DRFEKE  F +       +T S +   ID+DAVC VC DGTC+N+NVILFCDVCNLAVHQECYGVPYVPEG WLCRKCLHSPS P+ CCLCPN GGAFK+T+D+RWAHV+CGLW+PE+MFANL FLEP+E+++KI  ARWRL C++CKQ+NVGACIQCHK +CY AFHVTCAQQAGLYMKIEQS+  S   GIRK+AFCD+H  PS +KA   +GMYA+SDEE  S+   +   ++ K+++ RK+L +RRN    +  P++P  K   I   +    R   EF  R++A+WK+KRE R GVPLL+RL ASS    +A L+      DE + +M S L FWQ++RQDLE+ARLLSEL+RKRE++KRE+ R  ++  +  L PT   + DLI +LQ+ D    FA PV+  +AP+Y  +I+ PMDF  +++K   ++Y+ +  +  DF L+++NC  YN  +T YY  A  L  +   +F E YE ++ ++ FD+
Sbjct:    6 VDFDIYEFLTRIHGNKPPYRCPADGCRRTFKSFKAIQQHM-ECHRAPDPV-------------DIPATFISAPEHTSSAHSR--SLYRNSKFP----SMLFPDSQKCVVFNLTGVGISSVRCSIHVPLHFSFDFS-----------------NSDD----QLLNKLEPVALRRMKNIKSR-VSQPALMPIDSCNSISQSSNECSAVENHDRSSA-KVPIPQFEIDQNFICQRKPAPWKDGCAYMRFIERSFDELDEIVEYDLDEEDLFWLEKINA---------------DRMSKMMEP--IEQSTLEWVLDRFEKEARFRTTTENGAGLTTSVMMAGIDDDAVCAVCQDGTCENTNVILFCDVCNLAVHQECYGVPYVPEGPWLCRKCLHSPSEPISCCLCPNIGGAFKKTSDDRWAHVICGLWVPEVMFANLTFLEPLEDIDKIAPARWRLQCFICKQRNVGACIQCHKPSCYRAFHVTCAQQAGLYMKIEQSDDPSD-LGIRKNAFCDLHCPPSHFKANAHKGMYAHSDEEGASKDADEETVKRTKIRNARKVLAERRNSKPLVCVPMVPKSKTDLIFSELTGVKRGSVEFFQRVYAFWKLKREVRCGVPLLKRLQASSVNRGVASLAAAAAAGDEEAQKMRSQLIFWQRLRQDLERARLLSELTRKRERVKREILRTTLAQLECRLRPTFRALTDLITQLQSKDVRNFFANPVSTDVAPDYCTVIKQPMDFETMKRKCADHQYLCVADVFNDFSLIVNNCCTYNGSDTTYYKAAVSLSDQCASIFKEAYENEHFDL-FDE 747          

HSP 2 Score: 130.954 bits (328), Expect = 9.738e-27
Identity = 75/217 (34.56%), Postives = 102/217 (47.00%), Query Frame = 3
Query: 3036 ESQDVDDEDSTQDNSNNIFDS---FDASEEDETEGIKSQSNIR-------LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR------------------------------------LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPYDQFHFDE 3548
            + +++ +E   Q  +    D+     +++E   +G  +QS ++        EPLDLVWAKCRG PW+P LI+DP  S+     N VPIP PPE+V  +G                                     ++     FLVLFFD KRTWQWL REKL P A    ID   L    +S+  +SV +AY  AI H C V+  PYP+     DE
Sbjct: 1049 QQKEISEERGQQRPNTGTVDTNRPLGSTKEGPQKGQSAQSGVKPGHGEGNFEPLDLVWAKCRGSPWYPALIIDPTASTEDYNHNGVPIPTPPESVLNVGSGAPSSFVNALRGPGSLSPSSVTCSSPAPVAAPNSPPVNQQPPTFLVLFFDGKRTWQWLPREKLLPLATNTAIDDEKLHEAKRSKLKQSVVKAYGRAIEHYCKVHGRPYPFTDSCSDE 1265          
BLAST of Peregrin vs. TrEMBL
Match: A0A158QDI9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3109 PE=4 SV=1)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 355/804 (44.15%), Postives = 499/804 (62.06%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGC-SKLFRSFSAISKHLITIHKKSKEIEIC-EIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQ---NDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEG-YVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSN---------LHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVH-SPSGYKAGVSRGMYANSDEELTSEKPGK---RQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNID--VRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSS---------EMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVF-ERYERQ 2462
            +D D+ EFL RIRGNKPPFTCP + C  K F++F AI +H+   H+    ++I   I V  +EN  ++              ++  N ++          + + DS+K V+     ++ +S RC++NV I+++  E L N     LNT       SND + SE+SS        R R    KN  +I K+ E+        E+ T  +K + +  V+  P+P F  D    Y +++ P  V+G Y++++E +AEEL+EIVEYDLDEEDLIWL K N+               ++   +T    + Q+ +E+V+DRFEK+  F + TG N         L+N  +EDAVC VC DG C+N NVILFCDVCNLAVHQ+CYGVPY+PEG WLCRKCL SPS PV CCLCPN GGAFK+T+D+RWAHV+CGLWIPE+MFANL FLEP+++++KI   RW L C++CKQKNVGACIQCHK NCY +FHVTCAQQAGLYMKIEQS+     +G+RK A+CD+H  PS +KA   RGMYANSD+++  E+P +   ++  +   R++L KRRN    +  P++   K+ +I        R KEEF  R++A+WK+KRE R GVPLL+RL A+S     A LS    ++         +M S L F Q++R DLE+ARLL EL RKRE++K+EL  N  +  +  + PT + + +LI +LQ  DT + F EPVT  +AP+Y +II+ PMDF+ ++KK   +EY  + +++  FDL++SNC  YNA+ T+YY  A  L  +  P+F E +E++
Sbjct:    6 VDFDIPEFLNRIRGNKPPFTCPAEPCKQKPFKNFKAIQQHM-HFHRPPDPVDISNTIGVTFEENSKLE-------------VIEPSNSRYRP--------MRFLDSQKNVVFNLTGDNAQSVRCSINVLIHLT-SEPLPNDHQIPLNT-------SNDLNGSEVSS------AHRGRR---KNKHRISKVPEQPPV-----ENGTALVKQEPKLPVISIPVPKFEVDSCFAY-QRKPPTWVKGAYLRFIEHSAEELEEIVEYDLDEEDLIWLEKINDI-------------RKKQGFET----IKQSQLEWVLDRFEKKAVFRT-TGENGANVSTTMLLNNSEEEDAVCAVCQDGNCENLNVILFCDVCNLAVHQDCYGVPYIPEGSWLCRKCLISPSEPVSCCLCPNTGGAFKKTSDDRWAHVICGLWIPEVMFANLTFLEPLDDIDKISPQRWALRCFICKQKNVGACIQCHKQNCYKSFHVTCAQQAGLYMKIEQSDDPDD-SGVRKLAYCDMHCPPSHFKANAHRGMYANSDDDIAGEEPDEESIKRTTINKARRVLAKRRNSKPQVCVPIVTKSKMVDILSEFTGPARGKEEFFKRVYAFWKLKREARRGVPLLKRLQAASRLRGAASLSEAAAAALAASSEEQEKMRSQLIFTQRLRHDLERARLLCELVRKRERVKQELVLNSRAQLNMRIQPTFDFLGELIKKLQARDTRRFFCEPVTTDIAPDYLEIIKHPMDFSTMKKKLAEHEYFTVAQVKEHFDLIVSNCCEYNAKETVYYKAAVALADQCAPIFKEAFEKE 745          

HSP 2 Score: 82.8037 bits (203), Expect = 4.941e-12
Identity = 53/147 (36.05%), Postives = 71/147 (48.30%), Query Frame = 3
Query: 3213 LIVDPFMSSNGICDNKVPIPDPPENV--RELGRLHS--NQH-------------------------------KFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPYDQFHFDE 3548
            L++DP  SS+    N VPIP PPE++   + G + S  NQ                                 FLV+FFD KRTWQ L REKL P A    ID   LQ   +S+  +SV +AY+ A+ H C VN  PYP+++   D+
Sbjct: 1084 LVIDPAASSDQYTQNGVPIPVPPESLLNGQSGEVGSPLNQRGGGLDAAPASPSSNGTSNSPIATTPPPVGGPTFLVVFFDGKRTWQRLPREKLFPLATNTVIDEEKLQEARRSKLRQSVVKAYQRAVEHYCKVNRRPYPFNENSADD 1230          
BLAST of Peregrin vs. TrEMBL
Match: A0A3R7JZ53 (Peregrin OS=Clonorchis sinensis OX=79923 GN=BRPF1 PE=4 SV=1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 343/815 (42.09%), Postives = 494/815 (60.61%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEI--CEIDVINDENKDIDCNNVQSNKDN--ESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQND---KRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVE---GYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITG---SNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKL----KEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXI-----DEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYD 2522
            +D D+D+FLAR +GNKPPF CP + C K+ +SF+ I KH++ IH+    I+I     D++         +   SN  +          +  HT+        +S+ DS   V   +     ++FRC++ VP+   + E +  T  + + T TV ++++N+TSQ  L +N K     R     +KN   + +  + +     N   ++++ ++      L+ P P++  +++ E+  K+    V+   GY++++EKT +ELDE+VEYDLDEEDL WL + N               N R         VD+ T+E+ IDRFEKE  F  ++      L + IDEDAVC +C DG+C+N+NVILFCDVCNLAVHQECYGVPYVPEG WLCRKCLHSPS PV C LCPN GGAFK+T+D+RWAHV+CGLW+PE+MFANL FLEP+E +++I  ARWRL C++CKQ+N GACIQCHK++CY AFHVTCAQQAGLYMKIE ++     AGIRK+AFCD+H P  +    ++GMYANS+ E T       + +L+  RK L +RRN    I  P++P  K+      + D+I   +  +F+ + +A+WK+KRE R GVPLL+RL A S   + A  ++     D  + +M   L+FWQQ+RQDLEKARLLSEL RKRE++KR++FR F +  +  +      +  L++ LQ LD    FAEPV   +AP+Y  II+ PMDF  +R K + + Y++I+    D++LM++NC +YN R +IYY  A+++  +   +F         IG    TGL A    +D
Sbjct:    6 VDFDIDDFLARTQGNKPPFICPAETCQKVHKSFAHIQKHML-IHRPPAPIDIPASPSDLVQSTTAPYGLSASPSNGYSLTHRGVRNSSSASHTNHLST----ISHTDSCAVVFGPSSITHGQTFRCSIYVPLTFRL-EPIRKTE-SAIKTETV-NQSTNNTSQ--LDNNGKSSNRSR-----VKNRNGLMRTRDTNGYTEENCISQSQQQQHTNGMTELRLPQPVY--EVDPEFVFKKPSLLVKEGHGYIRFIEKTLDELDEVVEYDLDEEDLFWLERIN---------------NERKLKGLM--AVDETTLEWTIDRFEKEAKFRQLSSDEDGPLTHSIDEDAVCSICQDGSCENTNVILFCDVCNLAVHQECYGVPYVPEGPWLCRKCLHSPSEPVSCVLCPNTGGAFKKTSDDRWAHVICGLWVPEVMFANLTFLEPLEGIDRIAPARWRLQCFICKQRNAGACIQCHKTSCYRAFHVTCAQQAGLYMKIEDTDD-PKEAGIRKNAFCDLHCPPDHFTKGNKGMYANSESENTHSPEQAARIQLRKARKALAERRNSKPSICVPIVPKAKIDLMCTMLADDIS-GDVMDFLGKAYAFWKLKREARRGVPLLKRLQACSIHRSAANFAMAATTGDGEAKQMRKQLQFWQQLRQDLEKARLLSELIRKRERVKRDIFRVFTTEAELQIKSINIFLLRLLEILQDLDKNGFFAEPVGPELAPDYHLIIKHPMDFATMRSKIEQSCYLSIKEFESDYNLMLNNCFQYNRRESIYYAAATRISEQGKQIFREAFAIAQRIGLSPHTGLLAVMEPHD 784          

HSP 2 Score: 132.494 bits (332), Expect = 3.141e-27
Identity = 66/145 (45.52%), Postives = 90/145 (62.07%), Query Frame = 3
Query: 3120 ETEGIKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLHSN---------QHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPY 3527
            E   + S S+  + PLD+VWAKCRG PW+P L++DP  +S+G   N VP+P PPE+V   GR  ++         +   LVLFFD KRTWQWL R KL+P  +  D+DR  L+   +S+   SV +AY+ A+ HLC V+  PYPY
Sbjct: 1232 ELGAVDSLSDRHIGPLDVVWAKCRGSPWYPALVIDP-GASDGYSHNGVPVPIPPESVLRWGRRITDGSNAVADEEKPNLLVLFFDTKRTWQWLSRYKLQPLGLCVDVDRERLRESRRSKMKNSVIKAYRRAVEHLCKVHGRPYPY 1375          
BLAST of Peregrin vs. Ensembl Cavefish
Match: brpf1 (bromodomain and PHD finger containing, 1 [Source:ZFIN;Acc:ZDB-GENE-040426-731])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 317/813 (38.99%), Postives = 444/813 (54.61%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYK---AGVSRGMYANS---------------------DEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL                  + +N     +  Q  +      + +           +   ++YA +++ V L+   +  R        ISI EDL+           V +E+S+       ++  K  G   K        KK    +      ++ P               ++ P  +F E   L+    + P     Y +Y++K+ EELDE VEYD+DEED IWL   N+               RR    T    + Q   EY++DR EKE +FES    + ++ IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D+RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G      GV     ++S                       E       K ++K+K  RK+L +RR     +S P IPP +L +IT N+ V  K +FM R+HAYW +KR+ R+GVPLLRR + +  +S       +E  + +   LK WQ++R DLE+ARLL EL RKREKIKRE  +    + +  L P + L++  +++LQ  DT   F EPV     P+Y   IQ PMDF  +    +S+ Y++ E    DF L+++NC +YNA++T++Y  A +LR     +  +  RQ + IG++ ETG+
Sbjct:    3 LDFDVKTFCHNLRATKPPYECPIETCRKVYKSYSGIEYHLYHY---------------DHDNPPPIQSTPQKKRKGRPPRVSLSGSHSEHSHSPERETMTYAQAQRMVELEIGGKVHR--------ISIFEDLD----------VVSEEDSDAEDAPASANGGKGTGATPKSGKHKSKEKKKEGSHHHGN--MAGP--------------AVKLPEAVFRE---LDQERPDAPPRTLSYYRYIDKSVEELDEEVEYDIDEEDYIWLDIMND--------------KRRIDGVT---PIPQEVFEYLMDRLEKESYFESHNKGDPNSLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDSRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARPLGGVGGASTSHSEGEAEDEEEVSAVGEEEGKGWSSERAKRAKAKSRRKMKRARKILAERRAAAPVVSVPCIPPHRLSKITANLTVPRKSQFMQRLHAYWTLKRQSRNGVPLLRR-LQTHLQSQRNPEDTEEKHAALKEQLKAWQRLRHDLERARLLVELIRKREKIKREAIKVQQLVLEMQLTPFLVLLRSTLEQLQERDTNNFFTEPVPLNEVPDYLDHIQQPMDFQTMWLSLESHHYLSFEAFEGDFLLIVNNCLKYNAKDTVFYRAALRLREAGGAILRQARRQAERIGYEYETGM 744          

HSP 2 Score: 120.168 bits (300), Expect = 7.021e-27
Identity = 65/163 (39.88%), Postives = 89/163 (54.60%), Query Frame = 3
Query: 3030 AHESQDVDDEDSTQDNSNNIFDSFDASEEDETEG-----IKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRH 3494
            A +    ++   T+++S ++  S   S    + G     + S     L+ LDLVWAKCRGYP +P LI+DP M   G+    VPIP PP  V +LG      + +H FLVLFFD KRTW WL R KL P  V +++D+  +    KS   KSV  AY  A++H
Sbjct: 1004 AFQEDSSEETSGTENDSYSVGGSRGVSHLVRSRGRSSCWMSSTDYSSLDALDLVWAKCRGYPSYPALIIDPKMPREGVFHRGVPIPVPPLEVLKLGEQMTQEAREHLFLVLFFDNKRTWLWLPRSKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQH 1166          
BLAST of Peregrin vs. Ensembl Cavefish
Match: brpf3a (bromodomain and PHD finger-containing protein 3-like [Source:NCBI gene;Acc:103021900])

HSP 1 Score: 517.694 bits (1332), Expect = 1.272e-167
Identity = 289/731 (39.53%), Postives = 405/731 (55.40%), Query Frame = 3
Query:  417 FVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEK-ETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPS--------GYKAG--------VSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISF-PVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLF-------ANKSIYD 2522
            F +    L+YA S+K V ++ + R  R N+  P+ +  +++L    + E N+N  + E  N                 R R     +  K R+                K+ KN         P P F +   L+ F   E P     Y +YVEKT+EEL+   EYD+DEED+ WL   N+               +R S     + V   T E +IDR E+E   ES + +   N IDEDA C VC+D  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS PVDC LCPN+GGAFKQT+D RWAHVVC +WIPE+ FAN +FLEPIE V+ I  ARW+L CYLCKQ+  GA IQCHK+NCY AFHVTCAQ+AGL+MKI+   + +G  G    ++K+AFC  HSP+        G+  G         + G  A  ++    + P   Q+K K  +      R    P+   P IP  +L +I   + V+ K +FM R+H YW +KR  R+GVPL+RRL              D     +   LK+WQ++RQDLEKARLL EL RKRE++KRE  +      +  L P + L++  +++LQ  DT +IF  P      P+Y + +  PMDF+ +R+K ++++Y ++  L  DF+LM+SNC +YN+ +T+++  A++L+     +    +RQ   +G D +TG+        A+KS +D
Sbjct:   28 FSVTRETLTYAQSQKMVEVELEGRIHRINIFDPLAVVTEDELLAQEVQECNSNKENSEQEN-----------------RGRHVHHTSTNKARR----------------KDGKNGP------LPKPTFRK---LDAFTPNEAPPLPVAYYRYVEKTSEELETEAEYDMDEEDMAWLEMVNQ---------------KRVSDGH--ASVQPDTFELLIDRLERESILESRSQALSQNTIDEDAFCCVCMDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRRCLQSPSRPVDCVLCPNRGGAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPIEGVKNIPPARWKLTCYLCKQRGRGASIQCHKANCYRAFHVTCAQRAGLFMKIDPVRE-TGTNGTTFTVKKTAFCGSHSPATAEGDEDGGFAGGRNNRGQRAYTLGPAAQQNQRGNKKAPPTPQQK-KTRKSADGVSRKTGVPLLLVPQIPSYRLNKICTGVSVQRKNQFMQRLHNYWLLKRHSRNGVPLIRRLHTHLQTQKTEQREPDARLQAVREELKYWQKLRQDLEKARLLIELIRKRERLKREQMKLQQVSLELQLTPALVLLRSTLEQLQEKDTAQIFTSPTFFLHVPDYLEFVSDPMDFSTMREKLEAHKYCSVLDLEADFNLMVSNCLKYNSTDTVFHKAATQLKEVGGAILRNAQRQAVSVGLDPKTGMHLPDSKPNASKSCWD 697          
BLAST of Peregrin vs. Ensembl Cavefish
Match: brpf3a (bromodomain and PHD finger-containing protein 3-like [Source:NCBI gene;Acc:103021900])

HSP 1 Score: 527.709 bits (1358), Expect = 4.731e-166
Identity = 292/739 (39.51%), Postives = 414/739 (56.02%), Query Frame = 3
Query:  417 FVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSN------DTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFE-KETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPS--------GYKAG--------VSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISF-PVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLF-------ANKSIYDLV 2528
            F +    L+YA S+K V ++ + R  R N+  P+ +  +++L    + E N+N  + E  N       TS ++      + G  R R F  + +        + ++  + PE                 P P F +   L+ F   E P     Y +YVEKT+EEL+   EYD+DEED+ WL   N+               +R S     + V   T E +IDR E+E   ES + +   N IDEDA C VC+D  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS PVDC LCPN+GGAFKQT+D RWAHVVC +WIPE+ FAN +FLEPIE V+ I  ARW+L CYLCKQ+  GA IQCHK+NCY AFHVTCAQ+AGL+MKI+   + +G  G    ++K+AFC  HSP+        G+  G         + G  A  ++    + P   Q+K K  +      R    P+   P IP  +L +I   + V+ K +FM R+H YW +KR  R+GVPL+RRL              D     +   LK+WQ++RQDLEKARLL EL RKRE++KRE  +      +  L P + L++  +++LQ  DT +IF  PV     P+Y + +  PMDF+ +R+K ++++Y ++  L  DF+LM+SNC +YN+ +T+++  A++L+     +    +RQ   +G D +TG+        A+KS +D V
Sbjct:   46 FSVTRETLTYAQSQKMVEVELEGRIHRINIFDPLAVVTEDELLAQEVQECNSNKENSEQENRGRHVHHTSTNKARRKDGKNGGGRARRFGSQQF-------SQHQDHQTQPEGPL--------------PKPTFRK---LDAFTPNEAPPLPVAYYRYVEKTSEELETEAEYDMDEEDMAWLEMVNQ---------------KRVSDGH--ASVQPDTFELLIDRLERESILESRSQALSQNTIDEDAFCCVCMDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRRCLQSPSRPVDCVLCPNRGGAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPIEGVKNIPPARWKLTCYLCKQRGRGASIQCHKANCYRAFHVTCAQRAGLFMKIDPVRE-TGTNGTTFTVKKTAFCGSHSPATAEGDEDGGFAGGRNNRGQRAYTLGPAAQQNQRGNKKAPPTPQQK-KTRKSADGVSRKTGVPLLLVPQIPSYRLNKICTGVSVQRKNQFMQRLHNYWLLKRHSRNGVPLIRRLHTHLQTQKTEQREPDARLQAVREELKYWQKLRQDLEKARLLIELIRKRERLKREQMKLQQVSLELQLTPALVLLRSTLEQLQEKDTAQIFTSPVNLKEVPDYLEFVSDPMDFSTMREKLEAHKYCSVLDLEADFNLMVSNCLKYNSTDTVFHKAATQLKEVGGAILRNAQRQAVSVGLDPKTGMHLPDSKPNASKSCWDEV 741          

HSP 2 Score: 117.087 bits (292), Expect = 6.363e-26
Identity = 63/135 (46.67%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 3108 SEEDETEGIKSQSNIR--LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLHSNQHK---FLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHL 3497
            S   E++ +KS S     LEPL LVWAKCRGYP +P + VDP M   G+  N +PIP PP+ V  LG     + +   FLVLFFD KRTWQWL  +KL P  V + +D+  L    K    KSV+ AY+ A+ HL
Sbjct: 1060 SSNPESDSVKSSSQQSEDLEPLSLVWAKCRGYPSYPAMTVDPEMPKEGVLHNGIPIPVPPKEVLRLGERRRRETEDKLFLVLFFDTKRTWQWLPLDKLHPMGVDDTVDKLRLMEGKKRNVRKSVNTAYERAMNHL 1194          
BLAST of Peregrin vs. Ensembl Cavefish
Match: brpf3b (bromodomain and PHD finger containing, 3b [Source:ZFIN;Acc:ZDB-GENE-081104-468])

HSP 1 Score: 509.99 bits (1312), Expect = 1.536e-159
Identity = 288/714 (40.34%), Postives = 403/714 (56.44%), Query Frame = 3
Query:  480 DKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNE-ESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIE--QSEKISGPA-GIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDV----------------------------RKLLNKRRNYTAP-ISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXX-XXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIY 2519
            D R  R ++  P+ I  ++++    I E N+N    EN+  TS S  ++N  R     K          I  LN   S +  S+ +        K   +VL + +P             + P     Y +Y+EK+ EEL+   EYD+DEED+ WL   NE                + +S+  P IV   T E ++DR EKE   ES +     + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL SPS PVDC LCPN+GGAFKQT+D RWAHVVC +WIPE+ FAN +FLEP+E V+ I  ARW+L CYLCKQK  GA IQCHK+NCYTAFHVTCAQ+AGL+MKI+  +   ++G    ++K+AFC+ HSP   K G       + DEE      G R K+                                +++++K+   T P ++ P IP  +L ++   I ++ K  FM R+H YW +KR+ R+GVPL+RRL +       A     DE  S +   LK+WQ++R DLE+ARLL EL RKREK+KRE  +   ++ +  L P + L + ++D+LQ  D+ +IFA+PV     P+Y + +  PMDF+ +R K ++++Y +I  L  DF+LM++NC  YNA++T+++  A +LR     +    +RQ    G D  TG+   +S +
Sbjct:    7 DGRLHRISIFDPLPIITEDEMTAQDIAECNSNK---ENTEQTSASS-AANLSRRTASNKNKKKDIKNAYISILNHFPSSQGQSHSQHGNHCPLPKPTFRVLDSFVPT------------DAPPLPSAYYRYMEKSQEELENEAEYDMDEEDVSWLEMVNE----------------KRTSEGQP-IVSPDTFELLMDRMEKESFLESRSQVPSQSSIDEDAFCSVCLDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNRGGAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPVEGVDNIPPARWKLTCYLCKQKGRGASIQCHKANCYTAFHVTCAQRAGLFMKIDPVRETTVNGTTFSVKKTAFCEAHSPE-QKEG-------SDDEETGGRVVGGRAKRGSSAYVPTPQLKKSGRSNKKEEESPKKKGKKSQEVISKK--LTTPVVAVPEIPSNRLNKVFKGIIMQKKNYFMQRLHKYWLLKRQSRNGVPLIRRLHSHLQAQKSADQAEPDEKVSAVREELKYWQKLRHDLERARLLVELIRKREKLKREQMKVQQAVMELQLTPALMLQRSILDQLQEKDSAEIFAQPVDLKEVPDYLEFVSQPMDFSTMRSKLEAHKYRSILDLEADFNLMIANCLLYNAKDTVFHRAAVRLRELGGAILRHAQRQAQNTGLDPNTGMHLPESPH 677          

HSP 2 Score: 128.642 bits (322), Expect = 1.481e-29
Identity = 63/125 (50.40%), Postives = 79/125 (63.20%), Query Frame = 3
Query: 3141 QSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIV 3506
            +S+  LEPLDLVWAKCRGYP +P LI+DP M   G+  N VPIP PP +V  LG   +  + +  FLVLFFD KRTWQWL R+KL P  + + +D+  L    K+   KSV  AY  A+ HL  V
Sbjct: 1064 ESDAELEPLDLVWAKCRGYPSYPALIIDPDMPEEGLLHNGVPIPVPPADVLRLGDQRQEEAGEKLFLVLFFDNKRTWQWLPRDKLLPLGMDDTVDKLRLMEGRKTSIRKSVQVAYDRAMMHLSRV 1188          
BLAST of Peregrin vs. Ensembl Cavefish
Match: brpf3b (bromodomain and PHD finger containing, 3b [Source:ZFIN;Acc:ZDB-GENE-081104-468])

HSP 1 Score: 506.523 bits (1303), Expect = 1.033e-158
Identity = 264/603 (43.78%), Postives = 370/603 (61.36%), Query Frame = 3
Query:  786 PIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIE--QSEKISGPA-GIRKSAFCDVHSP----------SGYKAGVSRGMYANSDEELTSE--KPGKRQKKLKDV--------RKLLNKRRNYTAP-ISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXX-XXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIY 2519
            P+P     +   +   + P     Y +Y+EK+ EEL+   EYD+DEED+ WL   NE                + +S+  P IV   T E ++DR EKE   ES +     + IDEDA C VCLD  C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR CL SPS PVDC LCPN+GGAFKQT+D RWAHVVC +WIPE+ FAN +FLEP+E V+ I  ARW+L CYLCKQK  GA IQCHK+NCYTAFHVTCAQ+AGL+MKI+  +   ++G    ++K+AFC+ HSP          +G +    R    +S    T +  K G+  KK ++         +++++K+   T P ++ P IP  +L ++   I ++ K  FM R+H YW +KR+ R+GVPL+RRL +       A     DE  S +   LK+WQ++R DLE+ARLL EL RKREK+KRE  +   ++ +  L P + L + ++D+LQ  D+ +IFA+PV     P+Y + +  PMDF+ +R K ++++Y +I  L  DF+LM++NC  YNA++T+++  A +LR     +    +RQ    G D  TG+   +S +
Sbjct:  127 PLPKPTFRVLDSFVPTDAPPLPSAYYRYMEKSQEELENEAEYDMDEEDVSWLEMVNE----------------KRTSEGQP-IVSPDTFELLMDRMEKESFLESRSQVPSQSSIDEDAFCSVCLDDECLNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNRGGAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPVEGVDNIPPARWKLTCYLCKQKGRGASIQCHKANCYTAFHVTCAQRAGLFMKIDPVRETTVNGTTFSVKKTAFCEAHSPEQKEGSDDEETGGRVVGGRAKRGSSAYVPTPQLKKSGRSNKKEEESPKKKGKKSQEVISKK--LTTPVVAVPEIPSNRLNKVFKGIIMQKKNYFMQRLHKYWLLKRQSRNGVPLIRRLHSHLQAQKSADQAEPDEKVSAVREELKYWQKLRHDLERARLLVELIRKREKLKREQMKVQQAVMELQLTPALMLQRSILDQLQEKDSAEIFAQPVDLKEVPDYLEFVSQPMDFSTMRSKLEAHKYRSILDLEADFNLMIANCLLYNAKDTVFHRAAVRLRELGGAILRHAQRQAQNTGLDPNTGMHLPESPH 710          

HSP 2 Score: 126.716 bits (317), Expect = 5.954e-29
Identity = 62/120 (51.67%), Postives = 76/120 (63.33%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELG---RLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIV 3506
            LEPLDLVWAKCRGYP +P LI+DP M   G+  N VPIP PP +V  LG   +  + +  FLVLFFD KRTWQWL R+KL P  + + +D+  L    K+   KSV  AY  A+ HL  V
Sbjct: 1028 LEPLDLVWAKCRGYPSYPALIIDPDMPEEGLLHNGVPIPVPPADVLRLGDQRQEEAGEKLFLVLFFDNKRTWQWLPRDKLLPLGMDDTVDKLRLMEGRKTSIRKSVQVAYDRAMMHLSRV 1147          
BLAST of Peregrin vs. Ensembl Sea Lamprey
Match: brpf3a (bromodomain and PHD finger containing, 3a [Source:ZFIN;Acc:ZDB-GENE-130530-730])

HSP 1 Score: 183.341 bits (464), Expect = 3.247e-48
Identity = 92/226 (40.71%), Postives = 149/226 (65.93%), Query Frame = 3
Query: 1824 KLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXX-XXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGL 2498
            +LK+I   + ++ K+EFM R+ +YW +KR+ R+GVPLLRRL +   S+ +      DE +S +   LK+WQ++RQDLE+ARLL EL RKREK+KRE  +   ++ +  L P + L++  +++LQ  DT  IFAEPV+    P+Y   I+ PMDF+ +R + +++ Y  ++    DFDL+++NC +YN+++TI+Y  A +LR +   +  +  RQ ++IGFD  TG+
Sbjct:    1 RLKKIVSRVTMQRKKEFMTRLQSYWTLKRQSRNGVPLLRRLQSHLQSQRSAEQRENDEKNSALKEQLKYWQRLRQDLERARLLIELIRKREKLKREQIKVQQAVLEMQLTPFLVLLRRSLEQLQERDTNNIFAEPVSIEEVPDYLDYIKKPMDFSGMRARLEAHGYCTLDDFENDFDLIVANCMQYNSKDTIFYKAAVRLRDQGGAILRQARRQAEKIGFDYATGM 226          

HSP 2 Score: 123.635 bits (309), Expect = 5.874e-29
Identity = 61/123 (49.59%), Postives = 74/123 (60.16%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCE 3515
            +EPLDLVWAKCRGYP +P LI+DP +   G   N VPIP PP +V  LG      + +  FLVLFFD KRTWQWL R KL P  ++E +D+  +    KS   KSV  AY  A+ H   V  E
Sbjct:  577 MEPLDLVWAKCRGYPSYPALIIDPKIPREGFYHNSVPIPLPPMDVLTLGEAMAAEAGESLFLVLFFDNKRTWQWLPRSKLMPLGIEESLDKLKMMEGRKSNIRKSVQIAYDRAMTHRSRVQGE 699          
BLAST of Peregrin vs. Ensembl Sea Lamprey
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:ZFIN;Acc:ZDB-GENE-041114-176])

HSP 1 Score: 144.821 bits (364), Expect = 3.155e-35
Identity = 89/248 (35.89%), Postives = 130/248 (52.42%), Query Frame = 3
Query: 1143 CDVCLDGTCDNSNVILFCDV--CNLAVHQECYGVPYVPEGQWLCRKC-LHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKN------VGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVH-------SPSG---YKAGVSRGMYANSDEELTSEKPG------KRQKKLKDVRKLL-----NKRRNYTAP 1796
            C VC D      N +++CD   C++AVHQ CYG+ +VP G W CRKC     +  V C LCP+K GA K+T++  WAHVVC L+IPE+ FAN+  +EPI  ++ +   R+   CYLC+++        GAC+ C+K  C  AFHVTCAQ AGL  +    E+  G   ++   +C  H        P+G   + AG+      + D+    +K        KR K++ +   LL        + YT+P
Sbjct:    9 CCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVHVPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIV-LQYVPHDRYNKTCYLCEEQGRESKAATGACMTCNKHGCRQAFHVTCAQMAGLLCE----EEGVGADNVKYCGYCKYHYSKMQKGRPAGRSAFDAGLGEAPSHSQDKHERDKKKNREKEKQKRHKRVGEPSPLLPSLTVTTEKTYTSP 251          
BLAST of Peregrin vs. Ensembl Sea Lamprey
Match: KDM4C (lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC:17071])

HSP 1 Score: 123.25 bits (308), Expect = 8.556e-29
Identity = 58/143 (40.56%), Postives = 86/143 (60.14%), Query Frame = 3
Query: 1170 DNSNVILFCDVCNLAVHQECYGVPY--VPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKN---VGACIQCHKSNCYTAFHVTCAQQAGLYMK 1583
            D ++ ++ C  C L VH  CYGV    + +G W C +C  + +  VDCCLC  +GGA +QT DNRW HV+C + + E  F N++   P+ ++ +I   RW+L C  C++++    GAC+QC    C T FHVTCA  AG+ M+
Sbjct:  469 DGTSTLISCAKCCLQVHASCYGVGAQSLSDG-WKCSRCA-AEAWTVDCCLCNLRGGALQQTTDNRWVHVMCAVAVTEARFVNVMERRPV-DISRIPPPRWKLKCIFCRKQHRKVQGACVQCSYGRCPTPFHVTCAHAAGVLME 608          
BLAST of Peregrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008687.1 (pep scaffold:Pmarinus_7.0:GL495059:436:1819:-1 gene:ENSPMAG00000007864.1 transcript:ENSPMAT00000008687.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 5.023e-28
Identity = 52/126 (41.27%), Postives = 72/126 (57.14%), Query Frame = 3
Query: 1035 VDQATMEYVIDRFEKECHFESI----TGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQT-NDNRWAHVVCGLWIPEI 1397
            V + ++E  + R E+ C   ++    T + L  + D D VCDVC     ++ N ++FCD C++ VHQ CYG+  VP G WLCR C    + P  C LCP + GA K T    +WAHV C LWIPE+
Sbjct:   24 VRERSLEAALSRLERRCADSALRALSTEAALGIEFDADVVCDVCRSPHAEDGNEMVFCDKCDVCVHQACYGIACVPAGSWLCRVCDRGVAAP-RCQLCPRRDGAMKPTRGGGKWAHVSCALWIPEV 148          
BLAST of Peregrin vs. Ensembl Sea Lamprey
Match: KDM4C (lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC:17071])

HSP 1 Score: 101.679 bits (252), Expect = 1.285e-23
Identity = 46/109 (42.20%), Postives = 68/109 (62.39%), Query Frame = 3
Query: 1266 CRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKN---VGACIQCHKSNCYTAFHVTCAQQAGLYMK 1583
            C +C  + +  VDCCLC  +GGA +QT DNRW HV+C + + E  F N++   P++ + +I   RW+L C  C++++    GAC+QC    C T FHVTCA  AG+ M+
Sbjct:    2 CSRCA-AEAWTVDCCLCNLRGGALQQTTDNRWVHVMCAVAVTEARFVNVMERRPVD-ISRIPPPRWKLKCIFCRKQHRKVQGACVQCSYGRCPTPFHVTCAHAAGVLME 108          
BLAST of Peregrin vs. Ensembl Yeast
Match: NTO1 (Subunit of the NuA3 histone acetyltransferase complex; this complex acetylates histone H3; contains PHD finger domain that interacts with methylated histone H3 [Source:SGD;Acc:S000006235])

HSP 1 Score: 241.891 bits (616), Expect = 9.836e-68
Identity = 133/378 (35.19%), Postives = 204/378 (53.97%), Query Frame = 3
Query: 1077 KECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYM---KIEQSEKISGPAGIRKS--AFCDVHSPSGYKA---GVSRGM-YANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIP---PEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMI-SNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMK 2171
            ++C    + GS+    +  D  C VCL    DN N I+FCD C++AVHQECYG+ ++PEG+WLCR+C+ S ++   C +CP+  GAFKQT+   W H +C LW+PE+ F+NL ++EPIE V+ +  +RW+L CY+CK+K +GACIQC + NC+TA+HVTCA++AGLYM   K    E  S     + S  +FC  H+P G++    G+++   Y +    L +E P   +   +   K    +  +  P   PV P    E L+++ D   + N       I  YW MKRE   G PL          +     S+   + E + + + F     +DL + + L+ L +KR +    L R+   + D +  P   L+K
Sbjct:  244 RDCKNYELYGSDDGTGLSMDQACAVCLGTDSDNLNTIVFCDGCDIAVHQECYGIIFIPEGKWLCRRCMISKNNFATCLMCPSHTGAFKQTDTGSWVHNICALWLPELYFSNLHYMEPIEGVQNVSVSRWKLNCYICKKK-MGACIQCFQRNCFTAYHVTCARRAGLYMSKGKCTIQELASNQFSQKYSVESFCHKHAPRGWQTSIEGINKARKYFSLLSTLQTETPQHNEANDRTNSKF--NKTIWKTPNQTPVAPHVFAEILQKVVDFFGLANPPAGAFDICKYWSMKRELTGGTPL---------TACFENNSLGSLTEEQVQTRIDFANDQLEDLYRLKELTTLVKKRTQASNSLSRSRKKVFDIVKSPQKYLLK 609          
BLAST of Peregrin vs. Ensembl Yeast
Match: SNT2 (Subunit of Snt2C complex, RING finger ubiquitin ligase (E3); physically associates with Ecm5p and Rpd3p; along with Ecm5p, recruits Rpd3p to small number of promoters; colocalizes with Ecm5p, independently of Rpd3p, to promoters of stress response genes upon oxidative stress; involved in ubiquitination, degradation of excess histones; interacts with Ubc4p; role in regulating genes encoding amine transporters; relocalizes from nucleus to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000003099])

HSP 1 Score: 72.4034 bits (176), Expect = 4.307e-13
Identity = 49/185 (26.49%), Postives = 78/185 (42.16%), Query Frame = 3
Query: 1137 AVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPY---------VPEGQWLCRKCLH--SP--SHPVDCCLCPNKG---------------GAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKIS 1607
              C VC +   DN N  + C  C L VH  CY +           +   +WLC  C +  +P  S    C +CP K                 A K T+   W H+VC L+  +I + N   ++P  N   +     R  C +C+  N G  ++C+K  C   +H+TCAQ +  +  + + + +S
Sbjct: 1039 TFCSVCKEKFNDNDNYEVVCGNCGLTVHYFCYAIKLPKDMKKNTNLKTFKWLCDPCSNDLNPIISTTYQCSMCPTKDYDYDRYRSQSFKICPDALKCTSLGTWVHLVCSLFNEDIKYGNGQSMQPALNTTAVLIKHSRFTCGVCRI-NGGGLVKCNK--CQYRYHITCAQNSSNFKLMFEKKNMS 1220          
BLAST of Peregrin vs. Ensembl Yeast
Match: GCN5 (Catalytic subunit of ADA and SAGA histone acetyltransferase complexes; modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; relocalizes to the cytosol in response to hypoxia; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; greater involvement in repression of RNAPII-dependent transcription than in activation [Source:SGD;Acc:S000003484])

HSP 1 Score: 58.151 bits (139), Expect = 5.423e-9
Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 3
Query: 2166 MKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKL 2420
            +++++ ELQ       F +PV     P+Y   I+ PMD + +  K +SN+Y  +E    D  L+ +NC+ YN  NT YY  A++L
Sbjct:  336 IQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRL 420          
BLAST of Peregrin vs. Ensembl Yeast
Match: BDF2 (Protein involved in transcription initiation; acts at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p; protein abundance increases in response to DNA replication stress; BDF2 has a paralog, BDF1, that arose from the whole genome duplication [Source:SGD;Acc:S000002228])

HSP 1 Score: 49.2914 bits (116), Expect = 3.244e-6
Identity = 27/85 (31.76%), Postives = 46/85 (54.12%), Query Frame = 3
Query: 2178 IDELQTLDTGKIFAEPVTDAMA---PNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLR 2423
            I   + L   + F +PV D +A   P+Y   +Q PMD +LI  K + N Y ++E++  DF  M+ NC  +N   +   +MA +++
Sbjct:  146 IKATKRLKDARPFLKPV-DPIALNIPHYFNYVQTPMDLSLIETKLQGNVYHSVEQVTSDFKTMVDNCLNFNGPESSISSMAKRIQ 229          
BLAST of Peregrin vs. Ensembl Nematostella
Match: EDO40569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q6])

HSP 1 Score: 525.783 bits (1353), Expect = 1.971e-170
Identity = 269/590 (45.59%), Postives = 371/590 (62.88%), Query Frame = 3
Query:  771 KVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSD-EELTSE---KPGKRQKK-LKDVRKLLNKRRNYTAP-ISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSE---MISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKS 2513
            K  + P+ ++ E  +  +   + P     Y +++E+T EE+DE+VEYD+DEED  WL   N               ++R +    P  V Q   E ++DR EKE +FES T  + +  IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNK GAFKQT+D RW HV C LWIPE+ FAN +FLEPI++++ I +ARW+L CY+CK++  GACIQC K+NCYTAFHVTCAQQAGLYMKIE  +  +G   +RK+AFCD+HSP+  +             +E+ S+   K GK  K+ +K  RKLL++++    P ++ P IP  +L +I   + +  K +F++ + +YW +KR+ R+GVPLLRRL A+            E S     M   L FWQ++R DLE+ARLL EL RKREK+KRE  +    + D  L P   +++  +D++QT D G+IF++PV      +Y  +I+ PMDF+ +R +  SN Y  IE+   DF+L++ NC  YNA++TIYY  A KLR +  P+     RQ +  G D  TGL   ++
Sbjct:  154 KKTELPLAVYCE-ADEAFCLPDAPARPTTYFRFIEQTTEEMDEMVEYDMDEEDYAWLDFVN---------------DKRKADSIAP--VSQEVFETLMDRLEKESYFESQTTCDPNQYIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRVVDCVLCPNKTGAFKQTDDGRWGHVSCALWIPEVCFANTVFLEPIDSIDNIPSARWKLTCYICKRRQ-GACIQCFKTNCYTAFHVTCAQQAGLYMKIEPVKGENGHITVRKNAFCDIHSPNSSEENEGEERSEEEKTKEVKSKAAVKTGKTNKRSIKKFRKLLSEKKTMPVPVVNIPFIPAHRLGKIVSRVAMAKKAQFVHALQSYWMLKRQSRNGVPLLRRLQATHLSQKGTGDESSERSERIRAMKEQLHFWQRLRHDLERARLLVELIRKREKLKREHVKVKQHVVDLKLQPLNIVLRKTLDQVQTKDPGEIFSDPVDTNEVLDYLDVIKQPMDFSTMRSRIDSNFYHTIEQFEADFNLIIENCMAYNAQDTIYYRAALKLRDQGRPIIRAARRQIERAGIDPVTGLHTKEA 724          
BLAST of Peregrin vs. Ensembl Nematostella
Match: EDO49715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFG5])

HSP 1 Score: 217.624 bits (553), Expect = 1.800e-61
Identity = 138/415 (33.25%), Postives = 207/415 (49.88%), Query Frame = 3
Query:  909 YDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECH----FESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNR-WAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMK--IEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLK-DVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKF----WQQIRQDLEKARLLSELSRKREKIKRELFR 2117
            YDL+  D+ WL   N    +                      +D+ T+E  I   E +C+    +  +T   L  + DE   CDVC     +  N ++FCD C++ VHQ CYG+  +P G WLC+ C    + P  C LC   GGA K+    + + HV C LW+PE+ F N+  +EPI  VEKI  +RW L CYLCK+K VGACIQC   +C TAFHVTC  Q GL M+  ++ +E      G+R  ++C  H       G S G    S  +  ++ P +  +K+K D  +  N+R+     +         + EI  ++ +   +E  + IHAYW +KR+ R  VPL+        K +       +G++++  NL+       ++R DLE+ R L  +  KREK++RELFR
Sbjct:   73 YDLNRTDVEWLTALNSITLSCLGKTE----------------LDEGTLEKAIAYMEDKCYENMGYAIVTQKGLSIEYDESVCCDVCQSPESEEGNEMVFCDSCDICVHQACYGIQSIPSGSWLCQPCRWGVAKP-PCKLCSACGGAMKKAKGGKTYIHVSCALWVPEVGFGNVERMEPIIKVEKIPTSRWNLVCYLCKEK-VGACIQCSVKSCVTAFHVTCGFQEGLDMRTILDDTEV----DGVRHVSYCSKHGYKNKSPGKSPGRPPKSPRKSPNKSPPRSPEKIKQDKEEAENQRQKRLKQMEGEFYNYVDVGEIAKDLAL--PKELASHIHAYWTLKRKARDDVPLVPPTPQQQEKLSGK-----QGAADISKNLQVQIERLMKMRCDLERLRNLCYMVGKREKMRRELFR 458          
BLAST of Peregrin vs. Ensembl Nematostella
Match: EDO43778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXH9])

HSP 1 Score: 140.198 bits (352), Expect = 7.477e-38
Identity = 73/178 (41.01%), Postives = 103/178 (57.87%), Query Frame = 3
Query: 1143 CDVCLDGTCDNSNVILFCDV--CNLAVHQECYGVPYVPEGQWLCRKCLHSPS-HPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNV------GACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVH 1649
            C VC D    + N +++CD   CN+AVHQ CYG+  VP+G W CRKC        V C LCP+K GA K+T++  WAHVVC L+IPE+ F N+  +EPI  +  +   R+   CY+C+++        G C+ C+K  C   FHVTCAQ  GL    E+++  SGP  ++   +C  H
Sbjct:    9 CCVCSDERGWDENPLVYCDGHGCNVAVHQACYGIVQVPKGPWFCRKCESQERIARVKCELCPSKVGALKRTDNGGWAHVVCALYIPEVRFGNVSTMEPIL-LASVPHERYLKTCYICEERGKESRTAHGGCMNCNKLGCKQTFHVTCAQSCGLL--CEENDGQSGPT-VKYVGYCQFH 182          
BLAST of Peregrin vs. Ensembl Nematostella
Match: EDO45971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR96])

HSP 1 Score: 82.8037 bits (203), Expect = 4.762e-16
Identity = 44/108 (40.74%), Postives = 60/108 (55.56%), Query Frame = 3
Query: 2163 LMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVF--ERYERQYDEIGF 2480
             +++L   LQ  D    FA PV DA+AP YS++I  PMDF+ I+ K  SN Y  IE  R DF LM +N   YNA +TIY+  A ++      +   +R +  Y  IGF
Sbjct:  164 CLENLHITLQRKDIQGFFAYPVNDAIAPGYSRVITHPMDFSTIKTKIDSNSYTTIEAFRDDFYLMCNNAMVYNAPDTIYFKAAKRIMQIGAKMMTNDRIKNMYRSIGF 271          
BLAST of Peregrin vs. Ensembl Nematostella
Match: EDO44902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUH0])

HSP 1 Score: 52.373 bits (124), Expect = 9.106e-8
Identity = 26/85 (30.59%), Postives = 43/85 (50.59%), Query Frame = 3
Query: 2166 MKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKL 2420
            +K ++  LQ+      F EPV+    P Y  +I+ PMD + +  K  S +Y  +E+   D   +  NC+ +N ++T YY  A  L
Sbjct:   56 LKRMLRSLQSHKMAWPFLEPVSGLDVPGYYDVIKEPMDLSTVEDKITSKKYATLEQFVSDVTRIFDNCRFFNGKDTPYYRCAEVL 140          
BLAST of Peregrin vs. Ensembl Medaka
Match: brpf1 (bromodomain and PHD finger containing 1 [Source:NCBI gene;Acc:100302418])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 330/846 (39.01%), Postives = 460/846 (54.37%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLI-----------TIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRS--FSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYK------AGVSRGMYANSDEEL-----------------TSEKPGKRQK-----KLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMIS------------NLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANK 2510
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL            T+ +K ++       +    + D D           +        +H+     +T  ++YA ++  V L+   R  R ++   I +  +ED  + A   L + T +                +  G  + RS   S    K   K  +   +      D +    N +    ++ P  +F E   L+    + P     Y +Y++K+AEELDE VEYD+DEED IWL   N+             K RR      P    Q   EY++DR EKE +FES   ++    IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D+RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G         G S G  ++S+ EL                 +SE+  KR K     K+K  RK+L +RR     +S P IPP +L +IT N+ V  K +FM R+H+YW +KR+ R+GVPLLRRL               + S+++ S             LK WQ++R DLE+ARLL EL RKREK+KRE  +    + +  L P + L++  +++LQ  DT   F EPV     P+Y + I  PMDF  +    +S+ Y+  E    DF L+++NC +YNA++T++Y  A +LR     V    +RQ D IGFD E+G+  ++
Sbjct:    3 LDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPTPAQTMPQKKRKGRPPRASLTGSADTD-DGGGNGGQGHEGNTPGSPSRSEHSHSPGRET--MTYAQAQSMVELEIQGRVHRISIFENIDVVSEED--SDADDALPSGTGNSTGGVCNGGDGGGGGSEVGGSCKDRSDITSSNGAKATPKTGKHKSKAKKK--DGSSHHHNSQSGPAVKLPEAVFRE---LDQDRPDAPPRPSSYYRYIDKSAEELDEEVEYDIDEEDYIWLGIMND-------------KRRRDGVPPIP----QEVFEYLMDRLEKESYFESHNKTDPSTLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDSRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARPLGGVGGASMGS-SHSEGELEDDDEPSLCNDDDSKGWSSER-AKRAKAKSRLKMKKARKILAERRAAAPVVSVPCIPPHRLSKITSNLTVPRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLPSHRHVEPHPPQPSAQVASRDSEEKQTALKEQLKAWQRLRHDLERARLLVELIRKREKLKRETIKVQQMVLEMQLTPFLVLLRSTLEQLQERDTNNFFTEPVPLEEVPDYLEHIDTPMDFQTMWNLLESHRYLTFEAFEGDFGLIVNNCLKYNAKDTVFYRAALRLREMGGAVIRAAKRQADRIGFDYESGMHLHR 818          

HSP 2 Score: 106.686 bits (265), Expect = 1.085e-22
Identity = 62/124 (50.00%), Postives = 77/124 (62.10%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            LE LDLVWAKCRGYP +P LI+DP M   G+    VPIP PP +V +LG      + +H FLVLFFD KRTWQWL R KL P  V +++D+  +    KS   KSV  AY  A++H   V  +P
Sbjct: 1152 LEALDLVWAKCRGYPSYPALIIDPKMPREGVFHRGVPIPVPPVDVLKLGEQMTQEAREHLFLVLFFDNKRTWQWLPRSKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQHRSKVQGDP 1275          
BLAST of Peregrin vs. Ensembl Medaka
Match: brpf1 (bromodomain and PHD finger containing 1 [Source:NCBI gene;Acc:100302418])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 330/846 (39.01%), Postives = 460/846 (54.37%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLI-----------TIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRS--FSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYK------AGVSRGMYANSDEEL-----------------TSEKPGKRQK-----KLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMIS------------NLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANK 2510
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL            T+ +K ++       +    + D D           +        +H+     +T  ++YA ++  V L+   R  R ++   I +  +ED  + A   L + T +                +  G  + RS   S    K   K  +   +      D +    N +    ++ P  +F E   L+    + P     Y +Y++K+AEELDE VEYD+DEED IWL   N+             K RR      P    Q   EY++DR EKE +FES   ++    IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D+RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G         G S G  ++S+ EL                 +SE+  KR K     K+K  RK+L +RR     +S P IPP +L +IT N+ V  K +FM R+H+YW +KR+ R+GVPLLRRL               + S+++ S             LK WQ++R DLE+ARLL EL RKREK+KRE  +    + +  L P + L++  +++LQ  DT   F EPV     P+Y + I  PMDF  +    +S+ Y+  E    DF L+++NC +YNA++T++Y  A +LR     V    +RQ D IGFD E+G+  ++
Sbjct:    3 LDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPTPAQTMPQKKRKGRPPRASLTGSADTD-DGGGNGGQGHEGNTPGSPSRSEHSHSPGRET--MTYAQAQSMVELEIQGRVHRISIFENIDVVSEED--SDADDALPSGTGNSTGGVCNGGDGGGGGSEVGGSCKDRSDITSSNGAKATPKTGKHKSKAKKK--DGSSHHHNSQSGPAVKLPEAVFRE---LDQDRPDAPPRPSSYYRYIDKSAEELDEEVEYDIDEEDYIWLGIMND-------------KRRRDGVPPIP----QEVFEYLMDRLEKESYFESHNKTDPSTLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDSRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARPLGGVGGASMGS-SHSEGELEDDDEPSLCNDDDSKGWSSER-AKRAKAKSRLKMKKARKILAERRAAAPVVSVPCIPPHRLSKITSNLTVPRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLPSHRHVEPHPPQPSAQVASRDSEEKQTALKEQLKAWQRLRHDLERARLLVELIRKREKLKRETIKVQQMVLEMQLTPFLVLLRSTLEQLQERDTNNFFTEPVPLEEVPDYLEHIDTPMDFQTMWNLLESHRYLTFEAFEGDFGLIVNNCLKYNAKDTVFYRAALRLREMGGAVIRAAKRQADRIGFDYESGMHLHR 818          

HSP 2 Score: 106.686 bits (265), Expect = 1.085e-22
Identity = 62/124 (50.00%), Postives = 77/124 (62.10%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            LE LDLVWAKCRGYP +P LI+DP M   G+    VPIP PP +V +LG      + +H FLVLFFD KRTWQWL R KL P  V +++D+  +    KS   KSV  AY  A++H   V  +P
Sbjct: 1152 LEALDLVWAKCRGYPSYPALIIDPKMPREGVFHRGVPIPVPPVDVLKLGEQMTQEAREHLFLVLFFDNKRTWQWLPRSKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQHRSKVQGDP 1275          
BLAST of Peregrin vs. Ensembl Medaka
Match: brpf1 (bromodomain and PHD finger containing 1 [Source:NCBI gene;Acc:100302418])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 329/845 (38.93%), Postives = 458/845 (54.20%), Query Frame = 3
Query:  144 IDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLI-----------TIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRS--FSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYK------AGVSRGMYANSDEELT----------------SEKPGKRQK-----KLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMIS------------NLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANK 2510
            +D DV  F   +R  KPP+ CP + C K+++S+S I  HL            T+ +K ++       +    + D D           +        +H+     +T  ++YA ++  V L+   R  R ++   I +  +ED  + A   L + T +                +  G  + RS   S    K   K  +   +      D +    N +    ++ P  +F E   L+    + P     Y +Y++K+AEELDE VEYD+DEED IWL   N+             K RR      P    Q   EY++DR EKE +FES   ++    IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D+RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G         G S G  ++S+ EL                 S +  KR K     K+K  RK+L +RR     +S P IPP +L +IT N+ V  K +FM R+H+YW +KR+ R+GVPLLRRL               + S+++ S             LK WQ++R DLE+ARLL EL RKREK+KRE  +    + +  L P + L++  +++LQ  DT   F EPV     P+Y + I  PMDF  +    +S+ Y+  E    DF L+++NC +YNA++T++Y  A +LR     V    +RQ D IGFD E+G+  ++
Sbjct:    3 LDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPTPAQTMPQKKRKGRPPRASLTGSADTD-DGGGNGGQGHEGNTPGSPSRSEHSHSPGRET--MTYAQAQSMVELEIQGRVHRISIFENIDVVSEED--SDADDALPSGTGNSTGGVCNGGDGGGGGSEVGGSCKDRSDITSSNGAKATPKTGKHKSKAKKK--DGSSHHHNSQSGPAVKLPEAVFRE---LDQDRPDAPPRPSSYYRYIDKSAEELDEEVEYDIDEEDYIWLGIMND-------------KRRRDGVPPIP----QEVFEYLMDRLEKESYFESHNKTDPSTLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDSRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARPLGGVGGASMGS-SHSEGELEDDDEPSLCNDDDSKGWSSERAKRAKAKSRLKMKKARKILAERRAAAPVVSVPCIPPHRLSKITSNLTVPRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLPSHRHVEPHPPQPSAQVASRDSEEKQTALKEQLKAWQRLRHDLERARLLVELIRKREKLKRETIKVQQMVLEMQLTPFLVLLRSTLEQLQERDTNNFFTEPVPLEEVPDYLEHIDTPMDFQTMWNLLESHRYLTFEAFEGDFGLIVNNCLKYNAKDTVFYRAALRLREMGGAVIRAAKRQADRIGFDYESGMHLHR 818          

HSP 2 Score: 106.301 bits (264), Expect = 1.170e-22
Identity = 62/124 (50.00%), Postives = 77/124 (62.10%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            LE LDLVWAKCRGYP +P LI+DP M   G+    VPIP PP +V +LG      + +H FLVLFFD KRTWQWL R KL P  V +++D+  +    KS   KSV  AY  A++H   V  +P
Sbjct: 1130 LEALDLVWAKCRGYPSYPALIIDPKMPREGVFHRGVPIPVPPVDVLKLGEQMTQEAREHLFLVLFFDNKRTWQWLPRSKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQHRSKVQGDP 1253          
BLAST of Peregrin vs. Ensembl Medaka
Match: brpf1 (bromodomain and PHD finger containing 1 [Source:NCBI gene;Acc:100302418])

HSP 1 Score: 555.058 bits (1429), Expect = 1.033e-176
Identity = 287/623 (46.07%), Postives = 381/623 (61.16%), Query Frame = 3
Query:  735 DKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYK------AGVSRGMYANSDEELT----------------SEKPGKRQK-----KLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANK 2510
            D +    N +    ++ P  +F E   L+    + P     Y +Y++K+AEELDE VEYD+DEED IWL   N+             K RR      P    Q   EY++DR EKE +FES   ++    IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D+RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G         G S G  ++S+ EL                 S +  KR K     K+K  RK+L +RR     +S P IPP +L +IT N+ V  K +FM R+H+YW +KR+ R+GVPLLRRL              +E  + +   LK WQ++R DLE+ARLL EL RKREK+KRE  +    + +  L P + L++  +++LQ  DT   F EPV     P+Y + I  PMDF  +    +S+ Y+  E    DF L+++NC +YNA++T++Y  A +LR     V    +RQ D IGFD E+G+  ++
Sbjct:  156 DGSSHHHNSQSGPAVKLPEAVFRE---LDQDRPDAPPRPSSYYRYIDKSAEELDEEVEYDIDEEDYIWLGIMND-------------KRRRDGVPPIP----QEVFEYLMDRLEKESYFESHNKTDPSTLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDSRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARPLGGVGGASMGS-SHSEGELEDDDEPSLCNDDDSKGWSSERAKRAKAKSRLKMKKARKILAERRAAAPVVSVPCIPPHRLSKITSNLTVPRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLPSHRHRDS--EEKQTALKEQLKAWQRLRHDLERARLLVELIRKREKLKRETIKVQQMVLEMQLTPFLVLLRSTLEQLQERDTNNFFTEPVPLEEVPDYLEHIDTPMDFQTMWNLLESHRYLTFEAFEGDFGLIVNNCLKYNAKDTVFYRAALRLREMGGAVIRAAKRQADRIGFDYESGMHLHR 754          

HSP 2 Score: 108.997 bits (271), Expect = 1.755e-23
Identity = 70/163 (42.94%), Postives = 90/163 (55.21%), Query Frame = 3
Query: 3057 EDSTQDNSNNIFDSFDASEEDETEGIKSQSNI------RLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            EDS+++ S    DS+           KS   +       LE LDLVWAKCRGYP +P LI+DP M   G+    VPIP PP +V +LG      + +H FLVLFFD KRTWQWL R KL P  V +++D+  +    KS   KSV  AY  A++H   V  +P
Sbjct: 1019 EDSSEETSGTENDSYSVGGSRSVSHCKSGCWMTSDDYSSLEALDLVWAKCRGYPSYPALIIDPKMPREGVFHRGVPIPVPPVDVLKLGEQMTQEAREHLFLVLFFDNKRTWQWLPRSKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQHRSKVQGDP 1181          
BLAST of Peregrin vs. Ensembl Medaka
Match: brpf1 (bromodomain and PHD finger containing 1 [Source:NCBI gene;Acc:100302418])

HSP 1 Score: 554.288 bits (1427), Expect = 5.533e-176
Identity = 286/634 (45.11%), Postives = 380/634 (59.94%), Query Frame = 3
Query:  735 DKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAG----IRKSAFCDVHSPSGYK---AGVSRGMYANS------------------DEELTSEKPGKRQK-----KLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMIS------------NLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANK 2510
            D +    N +    ++ P  +F E   L+    + P     Y +Y++K+AEELDE VEYD+DEED IWL   N+             K RR      P    Q   EY++DR EKE +FES   ++    IDEDAVC +C DG C NSNVILFCD+CNLAVHQECYGVPY+PEGQWLCR+CL SPS  VDC LCPNKGGAFKQT+D+RWAHVVC LWIPE+ FAN +FLEPI+++E I  ARW+L CY+CKQ+  GACIQCHK+NCYTAFHVTCAQQAGLYMK+E   + +G  G    +RK+A+CD+H+P G      GV      +S                  D +  S +  KR K     K+K  RK+L +RR     +S P IPP +L +IT N+ V  K +FM R+H+YW +KR+ R+GVPLLRRL               + S+++ S             LK WQ++R DLE+ARLL EL RKREK+KRE  +    + +  L P + L++  +++LQ  DT   F EPV     P+Y + I  PMDF  +    +S+ Y+  E    DF L+++NC +YNA++T++Y  A +LR     V    +RQ D IGFD E+G+  ++
Sbjct:  151 DGSSHHHNSQSGPAVKLPEAVFRE---LDQDRPDAPPRPSSYYRYIDKSAEELDEEVEYDIDEEDYIWLGIMND-------------KRRRDGVPPIP----QEVFEYLMDRLEKESYFESHNKTDPSTLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDSRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRE-TGANGTSFSVRKTAYCDIHTPPGSARPLGGVGGASMGSSHSEGELEDDDEPSLCNDDDSKGWSSERAKRAKAKSRLKMKKARKILAERRAAAPVVSVPCIPPHRLSKITSNLTVPRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLPSHRHVEPHPPQPSAQVASRDSEEKQTALKEQLKAWQRLRHDLERARLLVELIRKREKLKRETIKVQQMVLEMQLTPFLVLLRSTLEQLQERDTNNFFTEPVPLEEVPDYLEHIDTPMDFQTMWNLLESHRYLTFEAFEGDFGLIVNNCLKYNAKDTVFYRAALRLREMGGAVIRAAKRQADRIGFDYESGMHLHR 763          

HSP 2 Score: 106.686 bits (265), Expect = 9.472e-23
Identity = 62/124 (50.00%), Postives = 77/124 (62.10%), Query Frame = 3
Query: 3156 LEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGR---LHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEP 3518
            LE LDLVWAKCRGYP +P LI+DP M   G+    VPIP PP +V +LG      + +H FLVLFFD KRTWQWL R KL P  V +++D+  +    KS   KSV  AY  A++H   V  +P
Sbjct: 1097 LEALDLVWAKCRGYPSYPALIIDPKMPREGVFHRGVPIPVPPVDVLKLGEQMTQEAREHLFLVLFFDNKRTWQWLPRSKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQHRSKVQGDP 1220          
BLAST of Peregrin vs. Planmine SMEST
Match: SMESG000047551.1 (SMESG000047551.1)

HSP 1 Score: 2257.64 bits (5849), Expect = 0.000e+0
Identity = 1150/1156 (99.48%), Postives = 1152/1156 (99.65%), Query Frame = 3
Query:  135 MDDIDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLXXXXXXXXXNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDAHIYQLEKELNKVPQPSFGKLLIETHNQIYPPRXXXXXXXXXXXXXXMKTGKESNSSNVLSEQQSKTEEHLESIEEMADSQQNYSLRKMPAXXXXXXXXXXXXXXXXXXKTDNNEESSNNYFRVSSTHTDPDSTFDAYKSEETKLNSSISFNDYTKNPEIAHESQDVDDEDSTQDNSNNIFDSFDASEEDETEGIKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPYDQFHFDEEISSPFLPRAAASAQFRS 3602
            MDDIDIDVDEFLARIRGNKPPFTCPFD CSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLK PNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLEPPKPEKKKNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRLVASSSKSNLALLSID+ SSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMK+LIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDAHIYQLEKELNKVPQ SFGKLLIETHNQIYPPRSLESYSSSQDESYSMKTGKESNSSNVLSEQQSKTEEHLESIEEMADSQQNYSLRKMPATSSTTINSISSSLRRRNNKTDNNEESSNNYFRVSSTHTDPDSTFDAYKSEETKLNSSISFNDYTKNPEIAHESQDVDDEDSTQDNSNNIFDSFDASEEDETEGIKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPYDQFHFDEEISSPFLPRAAASAQFRS
Sbjct:    1 MDDIDIDVDEFLARIRGNKPPFTCPFDDCSKLFRSFSAISKHLITIHKKSKEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKTPNMKHTSKFVIDTIQLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVHDENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPEDKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTAEELDEIVEYDLDEEDLIWLPKCNEYLTTLEPPKPEKKKNRRASSKTCPSIVDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRLVASSSKSNLALLSIDKDSSEMISNLKFWQQIRQDLEKARLLSELSRKREKIKRELFRNFISINDTLLYPTMNLMKNLIDELQTLDTGKIFAEPVTDAMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNARNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVINSTFEDAHIYQLEKELNKVPQSSFGKLLIETHNQIYPPRSLESYSSSQDESYSMKTGKESNSSNVLSEQQSKTEEHLESIEEMADSQQNYSLRKMPATSSTTINSISSSLRRRNNKTDNNEESSNNYFRVSSTHTDPDSTFDAYKSEETKLNSSISFNDYTKNPEIAHESQDVDDEDSTQDNSNNIFDSFDASEEDETEGIKSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPENVRELGRLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQLINKSRKSKSVHQAYKDAIRHLCIVNCEPYPYDQFHFDEEISSPFLPRAAASAQFRS 1156          
BLAST of Peregrin vs. Planmine SMEST
Match: SMESG000051958.1 (SMESG000051958.1)

HSP 1 Score: 196.823 bits (499), Expect = 7.738e-52
Identity = 110/334 (32.93%), Postives = 170/334 (50.90%), Query Frame = 3
Query: 1128 DEDAVCDVCLDGTCDNSNVILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGAFKQ--TNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRNYTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPLLRRXXXXXXXXXXXXXXIDEGSSEMISN---LKFWQQIRQDLEKARLLSELSRKREKIKRELF 2114
            DE++ CDVC     ++ N ++FC+ C + VHQ CYG+P +P G W+CR C   P+    C LCPN+GGA KQ  +++++WAH+ C +WIPE+ F N+  +EPI  +  I  ARW L C+LCK  N GA IQC +  C  AFHVTCA Q  L MK    ++      ++  A+C  HS    +   S         ++   +  K+++  +   K +N +        FP    + LK I  +I         ++I  YW +KR       L++     S          +E   + I+N   +  + +IR  L++ARL+ ++  +REK K  LF
Sbjct:  186 DENSKCDVCQSPEGEDGNELVFCEDCFVCVHQACYGIPELPSGSWICRHCDKCPNESSQCILCPNRGGAMKQLESDEDKWAHLSCAVWIPEVGFGNIDLMEPITRLNTIPQARWNLRCHLCKTSNTGAPIQCSEKKCKMAFHVTCAIQNSLVMK----QEFQANMDVKLLAYCKQHSKKYQEPNTSESSVNMGPRDIKELRIQKQKEFEQKFSKFVNAKELSETLHEFPKQLIDPLKSIPSDIK--------DKIFTYWTLKRTSNHFQCLIKPPSIWS----------EENLKQRINNRSIMNAFCKIRFGLDRARLVVDMMVRREKKKAHLF 497          
BLAST of Peregrin vs. Planmine SMEST
Match: SMESG000057438.1 (SMESG000057438.1)

HSP 1 Score: 127.872 bits (320), Expect = 1.222e-29
Identity = 68/178 (38.20%), Postives = 96/178 (53.93%), Query Frame = 3
Query: 1143 CDVCLDGTCDNSNVILFCDV--CNLAVHQECYGVPYVPEGQWLCRKCLHSP-SHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKN------VGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVH 1649
            C VCL      +N I+ CD   C+  VH+ CYG+  +P+G W C+KC+    +  V C LCP++ GA K TN   W H++C L++P   F +   LE I +V+K+   +    C +C++ N       GACIQC KS C   FHVTCAQ  GL  +I  S+       +R  A+C  H
Sbjct:    7 CCVCLKEEPFENNPIVSCDGKNCSTTVHKACYGIQQIPDGAWFCQKCISQERTARVRCELCPSRDGALKHTNKGGWCHIICALFVPGAEFLDTERLESI-SVDKVLTDKLNKMCTICEKNNRLDRATTGACIQCVKSGCKVLFHVTCAQAQGLLTEIVNSKD-----SVRYVAYCFAH 178          
BLAST of Peregrin vs. Planmine SMEST
Match: SMESG000057438.1 (SMESG000057438.1)

HSP 1 Score: 127.872 bits (320), Expect = 1.223e-29
Identity = 68/178 (38.20%), Postives = 96/178 (53.93%), Query Frame = 3
Query: 1143 CDVCLDGTCDNSNVILFCDV--CNLAVHQECYGVPYVPEGQWLCRKCLHSP-SHPVDCCLCPNKGGAFKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKN------VGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSAFCDVH 1649
            C VCL      +N I+ CD   C+  VH+ CYG+  +P+G W C+KC+    +  V C LCP++ GA K TN   W H++C L++P   F +   LE I +V+K+   +    C +C++ N       GACIQC KS C   FHVTCAQ  GL  +I  S+       +R  A+C  H
Sbjct:    7 CCVCLKEEPFENNPIVSCDGKNCSTTVHKACYGIQQIPDGAWFCQKCISQERTARVRCELCPSRDGALKHTNKGGWCHIICALFVPGAEFLDTERLESI-SVDKVLTDKLNKMCTICEKNNRLDRATTGACIQCVKSGCKVLFHVTCAQAQGLLTEIVNSKD-----SVRYVAYCFAH 178          
BLAST of Peregrin vs. Planmine SMEST
Match: SMESG000036910.1 (SMESG000036910.1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.356e-12
Identity = 48/138 (34.78%), Postives = 69/138 (50.00%), Query Frame = 3
Query: 1185 ILFCDVCNLAVHQECYGVPYV----------PEGQWLCRKCL-HSPSHPVDCCLCPNKGGAFKQ-TNDNR-WAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLCKQKNVGACIQCHKSNCYTAFHVTCA 1559
            IL C  CNL VH  CYG   V          P+  W C +C+  +P   + C LC  +GGA K+ TN N  WAH+VC L   E++F +L+  +P    +  E    +  C +CK +      +C   +C ++ HVTCA
Sbjct:  571 ILKCSHCNLTVHARCYGNVEVDRSLSKGECEPDQNWTCDRCVKFNPL--IHCSLCSVRGGALKKLTNRNSGWAHIVCTLACQEMVFEDLLHRKPRIRDKSTEYTSNK--CSICKGRQSQPICKCAFPDCRSSVHVTCA 704          
The following BLAST results are available for this feature:
BLAST of Peregrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRPF10.000e+044.77bromodomain and PHD finger containing 1 [Source:HG... [more]
BRPF14.820e-17744.41bromodomain and PHD finger containing 1 [Source:HG... [more]
BRPF11.490e-17644.41bromodomain and PHD finger containing 1 [Source:HG... [more]
BRPF11.643e-17644.41bromodomain and PHD finger containing 1 [Source:HG... [more]
BRPF15.363e-17644.41bromodomain and PHD finger containing 1 [Source:HG... [more]
back to top
BLAST of Peregrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-491.601e-7832.33pep chromosome:WBcel235:IV:8620683:8626149:1 gene:... [more]
phf-151.103e-3038.13PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
phf-151.380e-3038.13PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
zfp-12.732e-3040.88Uncharacterized protein F54F2.2, isoform a [Sourc... [more]
zfp-12.732e-3040.88Uncharacterized protein F54F2.2, isoform a [Sourc... [more]
back to top
BLAST of Peregrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Br1403.211e-16044.46gene:FBgn0033155 transcript:FBtr0089021[more]
Br1403.211e-16044.46gene:FBgn0033155 transcript:FBtr0345370[more]
rno9.949e-5132.51gene:FBgn0035106 transcript:FBtr0305549[more]
rno9.949e-5132.51gene:FBgn0035106 transcript:FBtr0305548[more]
rno9.949e-5132.51gene:FBgn0035106 transcript:FBtr0072532[more]
back to top
BLAST of Peregrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brpf3b2.035e-17341.17bromodomain and PHD finger containing, 3b [Source:... [more]
brpf3b3.066e-17341.17bromodomain and PHD finger containing, 3b [Source:... [more]
brpf3a2.380e-15842.93bromodomain and PHD finger containing, 3a [Source:... [more]
brpf3a2.380e-15842.93bromodomain and PHD finger containing, 3a [Source:... [more]
brpf3a4.077e-15642.62bromodomain and PHD finger containing, 3a [Source:... [more]
back to top
BLAST of Peregrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brpf13.226e-17838.46bromodomain and PHD finger containing 1 [Source:NC... [more]
brpf15.643e-17537.50bromodomain and PHD finger containing 1 [Source:NC... [more]
tf1.996e-16841.19transferrin [Source:Xenbase;Acc:XB-GENE-480506][more]
tf1.261e-16741.19transferrin [Source:Xenbase;Acc:XB-GENE-480506][more]
tf1.264e-16641.19transferrin [Source:Xenbase;Acc:XB-GENE-480506][more]
back to top
BLAST of Peregrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Brpf11.179e-2739.23bromodomain and PHD finger containing, 1 [Source:M... [more]
Brpf11.253e-2739.23bromodomain and PHD finger containing, 1 [Source:M... [more]
Brpf11.188e-2739.73bromodomain and PHD finger containing, 1 [Source:M... [more]
Brpf11.153e-2739.73bromodomain and PHD finger containing, 1 [Source:M... [more]
Brpf11.101e-2738.94bromodomain and PHD finger containing, 1 [Source:M... [more]
back to top
BLAST of Peregrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RRD7|BRPF1_MOUSE8.064e-2739.73Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV... [more]
sp|P55201|BRPF1_HUMAN7.891e-17644.41Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=... [more]
sp|G5E8P1|BRD1_MOUSE1.683e-16640.93Bromodomain-containing protein 1 OS=Mus musculus O... [more]
sp|O95696|BRD1_HUMAN4.205e-16541.19Bromodomain-containing protein 1 OS=Homo sapiens O... [more]
sp|B2KF05|BRPF3_MOUSE4.268e-15945.06Bromodomain and PHD finger-containing protein 3 OS... [more]
back to top
BLAST of Peregrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F1817.005e-2643.46Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2DLA22.137e-2642.82Peregrin OS=Schistosoma japonicum OX=6182 GN=EWB00... [more]
A0A5K3FIJ29.738e-2743.41Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QDI94.941e-1244.15Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3R7JZ533.141e-2742.09Peregrin OS=Clonorchis sinensis OX=79923 GN=BRPF1 ... [more]
back to top
BLAST of Peregrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brpf17.021e-2738.99bromodomain and PHD finger containing, 1 [Source:Z... [more]
brpf3a1.272e-16739.53bromodomain and PHD finger-containing protein 3-li... [more]
brpf3a4.731e-16639.51bromodomain and PHD finger-containing protein 3-li... [more]
brpf3b1.536e-15940.34bromodomain and PHD finger containing, 3b [Source:... [more]
brpf3b1.033e-15843.78bromodomain and PHD finger containing, 3b [Source:... [more]
back to top
BLAST of Peregrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brpf3a3.247e-4840.71bromodomain and PHD finger containing, 3a [Source:... [more]
mllt103.155e-3535.89MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
KDM4C8.556e-2940.56lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC... [more]
ENSPMAT00000008687.15.023e-2841.27pep scaffold:Pmarinus_7.0:GL495059:436:1819:-1 gen... [more]
KDM4C1.285e-2342.20lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Peregrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
NTO19.836e-6835.19Subunit of the NuA3 histone acetyltransferase comp... [more]
SNT24.307e-1326.49Subunit of Snt2C complex, RING finger ubiquitin li... [more]
GCN55.423e-934.12Catalytic subunit of ADA and SAGA histone acetyltr... [more]
BDF23.244e-631.76Protein involved in transcription initiation; acts... [more]
back to top
BLAST of Peregrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405691.971e-17045.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497151.800e-6133.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437787.477e-3841.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459714.762e-1640.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449029.106e-830.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peregrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brpf11.085e-2239.01bromodomain and PHD finger containing 1 [Source:NC... [more]
brpf11.085e-2239.01bromodomain and PHD finger containing 1 [Source:NC... [more]
brpf11.170e-2238.93bromodomain and PHD finger containing 1 [Source:NC... [more]
brpf11.033e-17646.07bromodomain and PHD finger containing 1 [Source:NC... [more]
brpf15.533e-17645.11bromodomain and PHD finger containing 1 [Source:NC... [more]
back to top
BLAST of Peregrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047551.10.000e+099.48SMESG000047551.1[more]
SMESG000051958.17.738e-5232.93SMESG000051958.1[more]
SMESG000057438.11.222e-2938.20SMESG000057438.1[more]
SMESG000057438.11.223e-2938.20SMESG000057438.1[more]
SMESG000036910.11.356e-1234.78SMESG000036910.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033182 ID=SMED30033182|Name=Peregrin|organism=Schmidtea mediterranea sexual|type=transcript|length=3768bp
CCAGTTTAAAATTTATAAATTTTTAAAAAAAAGGATTTTTATATTCATAA
TTATTTTCTACAAACTATTTTTCCAGTAATTCTATTGAACTTTCCAACAC
ACGAATATAATAAAATAAAAATTTAAATTGTATAATGGATGATATAGATA
TCGACGTTGATGAATTTTTGGCTCGTATTCGAGGTAATAAACCACCATTT
ACATGTCCGTTTGATGGTTGTTCCAAATTGTTTCGAAGCTTTTCTGCGAT
TTCCAAGCATCTTATTACTATTCACAAAAAATCGAAAGAAATTGAAATAT
GTGAAATAGATGTCATTAACGATGAAAATAAAGATATTGATTGTAACAAC
GTTCAATCTAATAAGGACAATGAAAGTGCATATTTAAAAATCCCAAATAT
GAAACATACTTCCAAATTTGTAATCGACACTATTCAGCTGTCTTATGCAG
ATTCCAAAAAATTTGTTATACTTCAAAATGATAAACGCAGTTTTAGATGT
AATGTTAACGTTCCTATTTATATTTCAATTGATGAAGATCTCAATAACAC
TGCAATTACGGAATTAAACACTAATACTGTGCATGACGAAAATTCTAACG
ATACGTCTCAATCGGAATTATCAAGTAATTTCAAACGAATCGGTATTAAG
CGCAAACGTTCGTTTTCTTTAAAAAATTATAAAAAGATCAGAAAATTAAA
TGAAGAATCAAAAGAAATCTTATCAAATCCGGAAGATAAAACAAAGGAAA
TGAAAAATAAAGAACAAGAGAAAGTTTTACAAACTCCTATACCAATATTC
ATTGAAGATATTAATCTGGAGTATTTTGAAAAAGAAACACCTCATGATGT
TGAAGGATACGTAAAATATGTTGAGAAAACTGCCGAAGAATTAGATGAAA
TCGTTGAATATGATCTCGATGAAGAAGATTTAATATGGCTTCCAAAATGC
AATGAATATTTGACAACTTTGGAACCACCGAAACCAGAGAAAAAAAAGAA
TCGCAGGGCATCATCAAAAACTTGTCCATCAATTGTTGACCAAGCAACCA
TGGAATATGTTATTGATAGGTTCGAAAAGGAATGCCATTTTGAATCGATT
ACAGGCAGCAATTTGCACAATGATATTGATGAAGATGCAGTTTGTGACGT
TTGCCTCGATGGAACATGTGATAATAGCAATGTTATTTTGTTTTGTGACG
TTTGTAACCTGGCCGTTCATCAGGAATGTTATGGGGTACCGTATGTGCCT
GAAGGTCAGTGGCTGTGTAGAAAATGTTTACATTCACCCAGTCATCCCGT
GGATTGTTGTTTGTGTCCGAATAAAGGTGGTGCTTTTAAACAAACAAACG
ACAATCGATGGGCTCATGTAGTTTGTGGTCTATGGATTCCGGAAATTATG
TTCGCAAATCTTATATTTTTGGAGCCTATTGAAAATGTTGAAAAGATTGA
AGCAGCTAGATGGCGGCTTGCATGTTATCTATGTAAGCAGAAAAATGTTG
GCGCATGCATTCAATGCCACAAAAGTAATTGTTATACAGCATTCCATGTC
ACTTGTGCACAACAAGCTGGCTTGTACATGAAAATTGAGCAAAGCGAAAA
AATCAGTGGACCAGCAGGAATTAGAAAAAGTGCTTTCTGTGATGTCCATT
CGCCATCGGGATATAAAGCGGGGGTAAGTCGAGGCATGTACGCAAATTCT
GACGAAGAGCTGACATCAGAAAAACCAGGAAAGCGACAAAAGAAACTTAA
AGACGTTCGAAAGTTGCTAAATAAGCGTCGCAATTACACAGCACCAATTT
CATTTCCCGTCATTCCGCCGGAAAAGTTAAAAGAAATCACTGATAATATT
GATGTTCGAAATAAAGAAGAATTCATGAATCGAATTCATGCCTATTGGAA
GATGAAAAGAGAATATAGAAGTGGAGTTCCTTTACTACGACGACTCGTTG
CTTCATCTTCCAAATCGAATCTAGCTTTGTTATCTATCGATGAAGGCAGC
AGTGAAATGATTTCCAATCTTAAATTTTGGCAACAAATACGCCAAGATCT
AGAGAAAGCTCGACTACTTTCAGAACTCAGTCGAAAAAGGGAAAAAATAA
AACGAGAATTATTTAGAAATTTTATTTCAATTAATGACACGCTTTTATAT
CCGACAATGAATCTTATGAAGGATCTCATCGATGAATTACAGACATTAGA
TACTGGGAAAATATTCGCGGAACCAGTGACCGATGCCATGGCACCTAATT
ATTCCAAAATTATCCAATGTCCAATGGATTTCACATTAATTCGCAAAAAA
CATAAATCTAATGAATATATCAACATAGAAAGATTGCGAGTTGATTTCGA
TTTGATGATGAGCAATTGCCAGAGATATAACGCTAGGAACACTATATACT
ACAACATGGCATCTAAACTAAGAACAGAATCCGTTCCGGTTTTTGAGAGA
TATGAGAGACAATATGATGAAATCGGTTTTGATAAAGAAACTGGTTTATT
TGCCAATAAATCTATTTATGATTTGGTGATAAATTCTACTTTTGAAGATG
CCCATATTTATCAGTTGGAAAAAGAACTCAATAAAGTGCCACAACCTTCA
TTTGGAAAACTATTGATTGAAACCCATAACCAGATTTATCCTCCGCGATC
TCTAGAATCCTATTCATCTAGTCAAGATGAGTCCTACTCAATGAAGACAG
GTAAAGAATCCAACAGTTCAAATGTCTTATCAGAACAACAATCTAAAACC
GAAGAACATTTGGAATCGATTGAAGAAATGGCTGATTCACAACAAAATTA
TAGCTTACGAAAAATGCCCGCTACCAGTTCAACAACAATAAACTCCATTA
GCAGTAGCTTAAGAAGGAGAAATAATAAAACAGATAATAACGAAGAATCA
TCAAATAACTATTTTCGAGTCAGTAGTACCCATACCGATCCCGATTCCAC
TTTCGACGCATACAAGAGTGAAGAAACTAAACTAAATTCATCAATCTCGT
TTAATGACTATACGAAGAATCCGGAAATAGCACATGAATCTCAAGATGTC
GACGATGAGGACTCAACTCAGGACAATTCTAATAATATATTCGATTCTTT
CGATGCATCAGAAGAAGATGAAACCGAAGGAATTAAATCCCAGTCTAATA
TCAGATTAGAGCCTTTGGATTTAGTTTGGGCTAAATGTCGAGGCTATCCT
TGGTTTCCTGGACTGATAGTCGATCCGTTTATGAGTTCCAATGGAATTTG
TGACAACAAAGTTCCTATTCCGGATCCTCCGGAAAATGTCCGTGAGTTAG
GTAGACTACACAGCAATCAGCATAAATTCCTGGTTTTGTTTTTCGATAAG
AAACGCACATGGCAATGGCTGGAGAGAGAGAAATTGGAGCCATTTGCGGT
GAAAGAGGATATTGACAGAAATATGTTGCAATTGATCAATAAATCGCGAA
AAAGTAAATCGGTACACCAAGCGTACAAGGATGCCATCAGACATTTGTGT
ATTGTCAACTGTGAACCATATCCATACGATCAATTCCATTTTGATGAGGA
GATTTCGTCTCCATTTTTGCCGAGAGCGGCGGCTTCGGCACAATTTAGAT
CATGATTATTTGTGTACATAAATGTATAATCAATAATTCGTAGAATTGTT
GAGATCAATACTGGAATCTGCATTTAATGATGATGTTTGCATATTTAATT
CTTTGTCAAATATTATTCTACTCAATATCTAATTCTATGGAAATAAAATA
AGATTTCTCTCTTTATTG
back to top

protein sequence of SMED30033182-orf-1

>SMED30033182-orf-1 ID=SMED30033182-orf-1|Name=SMED30033182-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1157bp
MDDIDIDVDEFLARIRGNKPPFTCPFDGCSKLFRSFSAISKHLITIHKKS
KEIEICEIDVINDENKDIDCNNVQSNKDNESAYLKIPNMKHTSKFVIDTI
QLSYADSKKFVILQNDKRSFRCNVNVPIYISIDEDLNNTAITELNTNTVH
DENSNDTSQSELSSNFKRIGIKRKRSFSLKNYKKIRKLNEESKEILSNPE
DKTKEMKNKEQEKVLQTPIPIFIEDINLEYFEKETPHDVEGYVKYVEKTA
EELDEIVEYDLDEEDLIWLPKCNEYLTTLEPPKPEKKKNRRASSKTCPSI
VDQATMEYVIDRFEKECHFESITGSNLHNDIDEDAVCDVCLDGTCDNSNV
ILFCDVCNLAVHQECYGVPYVPEGQWLCRKCLHSPSHPVDCCLCPNKGGA
FKQTNDNRWAHVVCGLWIPEIMFANLIFLEPIENVEKIEAARWRLACYLC
KQKNVGACIQCHKSNCYTAFHVTCAQQAGLYMKIEQSEKISGPAGIRKSA
FCDVHSPSGYKAGVSRGMYANSDEELTSEKPGKRQKKLKDVRKLLNKRRN
YTAPISFPVIPPEKLKEITDNIDVRNKEEFMNRIHAYWKMKREYRSGVPL
LRRLVASSSKSNLALLSIDEGSSEMISNLKFWQQIRQDLEKARLLSELSR
KREKIKRELFRNFISINDTLLYPTMNLMKDLIDELQTLDTGKIFAEPVTD
AMAPNYSKIIQCPMDFTLIRKKHKSNEYINIERLRVDFDLMMSNCQRYNA
RNTIYYNMASKLRTESVPVFERYERQYDEIGFDKETGLFANKSIYDLVIN
STFEDAHIYQLEKELNKVPQPSFGKLLIETHNQIYPPRSLESYSSSQDES
YSMKTGKESNSSNVLSEQQSKTEEHLESIEEMADSQQNYSLRKMPATSST
TINSISSSLRRRNNKTDNNEESSNNYFRVSSTHTDPDSTFDAYKSEETKL
NSSISFNDYTKNPEIAHESQDVDDEDSTQDNSNNIFDSFDASEEDETEGI
KSQSNIRLEPLDLVWAKCRGYPWFPGLIVDPFMSSNGICDNKVPIPDPPE
NVRELGRLHSNQHKFLVLFFDKKRTWQWLEREKLEPFAVKEDIDRNMLQL
INKSRKSKSVHQAYKDAIRHLCIVNCEPYPYDQFHFDEEISSPFLPRAAA
SAQFRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036427Bromodomain-like_sf
IPR034732EPHD
IPR001487Bromodomain
IPR001965Znf_PHD
IPR015880Znf_C2H2-like
IPR000313PWWP_dom
IPR019542Enhancer_polycomb-like_N
IPR013083Znf_RING/FYVE/PHD
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
IPR019786Zinc_finger_PHD-type_CS
IPR019787Znf_PHD-finger
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 703..719
score: 43.09
coord: 719..737
score: 25.17
coord: 737..756
score: 35.54
IPR001487BromodomainSMARTSM00297bromo_6coord: 667..775
e-value: 2.6E-18
score: 76.8
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 678..760
e-value: 2.7E-18
score: 65.8
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 686..756
score: 15.866
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 446..506
e-value: 1.1E-4
score: 31.5
coord: 336..382
e-value: 2.9E-9
score: 46.8
IPR000313PWWP domainSMARTSM00293PWWP_4coord: 1008..1088
e-value: 1.7E-21
score: 87.4
IPR000313PWWP domainPFAMPF00855PWWPcoord: 1009..1121
e-value: 1.6E-16
score: 60.5
IPR000313PWWP domainPROSITEPS50812PWWPcoord: 1010..1090
score: 12.057
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 431..511
e-value: 3.0E-30
score: 106.2
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 322..389
e-value: 4.2E-25
score: 89.0
IPR019542Enhancer of polycomb-like, N-terminalPFAMPF10513EPL1coord: 141..316
e-value: 2.8E-12
score: 47.3
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 669..794
e-value: 3.8E-29
score: 102.8
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 667..783
NoneNo IPR availablePFAMPF13831PHD_2coord: 349..381
e-value: 2.4E-13
score: 49.4
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 999..1126
e-value: 8.6E-39
score: 134.6
NoneNo IPR availablePFAMPF13832zf-HC5HC2H_2coord: 390..505
e-value: 1.2E-34
score: 118.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 919..934
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 838..869
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 838..934
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 882..912
NoneNo IPR availablePANTHERPTHR13793PHD FINGER PROTEINScoord: 532..791
NoneNo IPR availablePANTHERPTHR13793:SF19BROMODOMAIN AND PHD FINGER-CONTAINING PROTEIN 3coord: 869..1125
NoneNo IPR availablePANTHERPTHR13793PHD FINGER PROTEINScoord: 101..528
NoneNo IPR availablePANTHERPTHR13793:SF19BROMODOMAIN AND PHD FINGER-CONTAINING PROTEIN 3coord: 532..791
NoneNo IPR availablePANTHERPTHR13793:SF19BROMODOMAIN AND PHD FINGER-CONTAINING PROTEIN 3coord: 101..528
NoneNo IPR availablePANTHERPTHR13793PHD FINGER PROTEINScoord: 869..1125
NoneNo IPR availableCDDcd15572PHD_BRPFcoord: 334..386
e-value: 2.91895E-32
score: 117.332
NoneNo IPR availableCDDcd15670ePHD_BRPFcoord: 391..505
e-value: 1.28704E-72
score: 234.537
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 1004..1126
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 24..47
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 22..52
score: 10.512
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 337..381
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 334..384
score: 9.899
IPR034732Extended PHD (ePHD) domainPROSITEPS51805EPHDcoord: 388..506
score: 34.453
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 326..399