EH domain-containing protein 1

Overview
NameEH domain-containing protein 1
Smed IDSMED30033179
Length (bp)2059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EH domain-containing protein 1 (SMED30033179) t-SNE clustered cells

Violin plots show distribution of expression levels for EH domain-containing protein 1 (SMED30033179) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EH domain-containing protein 1 (SMED30033179) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EH domain-containing protein 1 (SMED30033179) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033179

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033179h1SMcG0019059 Contig4857GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033179h1SMcG0019059 dd_Smed_v4_3148_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033179h1SMcG0019059 dd_Smed_v4_3148_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033179h1SMcG0019059 dd_Smed_v4_3148_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033179h1SMcG0019059 SMED30033179smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30033179h1SMcG0019059 SMED30033179smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD1 (EH domain containing 1 [Source:HGNC Symbol;Acc:HGNC:3242])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 410/525 (78.10%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H ISPGDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR
Sbjct:   23 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 545          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD1 (EH domain containing 1 [Source:HGNC Symbol;Acc:HGNC:3242])

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 410/525 (78.10%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H ISPGDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD1 (EH domain containing 1 [Source:HGNC Symbol;Acc:HGNC:3242])

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 410/525 (78.10%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H ISPGDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD3 (EH domain containing 3 [Source:HGNC Symbol;Acc:HGNC:3244])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 340/524 (64.89%), Postives = 411/524 (78.44%), Query Frame = 3
Query:  123 KHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 1694
            K  E+F  V + L KLY  KL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVLESI++IDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+K+R+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP++ GKDNKKKEL+ NL  IY RI R+H ISPGDFP ++RMQ+ L   DF  F  LK KL+E VDDMLA+DIA+LM ++ +E++ +      VKGGAFE     PFG G  EG   G  D EW VA+ K  YDE F +L PV+GKI G  AK  +V++KLP ++LGKIWKL+DID DG LD DEFALA +L+++KL+  E+P  LP HL+PP+KR++ 
Sbjct:   13 KDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRP--IQMVKGGAFEGTLHGPFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVA 534          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD4 (EH domain containing 4 [Source:HGNC Symbol;Acc:HGNC:3245])

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 319/515 (61.94%), Postives = 401/515 (77.86%), Query Frame = 3
Query:  144 NVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
             V   L  LY +K+ PLE+ Y+FHEFHS +LE  DF+ KPM+LL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M+ E EG+ PGNALVVDPK+PFR LS+FGN FL RF CS + N VL+SI++ID+PGILSGEKQR+ RGY F +V++WFAERVDRIILLFDAHKLDISDEF   I+  +G ++KIR+VLNK D VD+QQLMRVYGALMWSLGKV+ TPEV RVYIGSFW QPL    NR+LFE E +DLF D++SLP+ + VRKLND I+RARLAKVHAYIIS L+ EMP++ GK+NKK+ELI  L  IY ++ R++ IS GDFP+++ MQ  L ++DF  F +LK KLIE VD+ML+N I+ LM +I +E+T+    T  V+GGAF+   + PF  G  EG   G  + EW VAK K  YDE F +L P+NGKI+G  AK  +V +KLP ++LGKIWKL+D D DG LD++EFALA +L+++KLD  E+P +LP HL+PP+ R+
Sbjct:   23 TVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTP--TQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRK 535          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 343/532 (64.47%), Postives = 421/532 (79.14%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTN-----PVKGGAFE--VQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            S+K K++E+   V + L K+Y QKL PLE+ +KFH+FHS +L+  DFDAKPM+LL+GQYSTGKTTFIRYLLE DFPGIRIGPEPTTD+FIA+M  ++EG+IPGNALVVD K+ FR LS FGN FL RFQCS + N VLES+ I+DTPGILSGEKQR+DRGY F+ V+EWFAERVDRIILLFDAHKLDISDEF+R IE L G E+KIRIVLNK DMVD QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLH+D NR+LF+ E+ DLF+DL++LPRN+ +RKLND I+RARLAKVHAYII+ LR +MP++IGKD KKK+LIQNL  IY+++ R+H+ISPGDFP + +M+  L   DF  F  LK KL+E VD MLA DIA+LM  IPKE+ A    +N      V+GGAF    + + PFG G  EG ++G  + EW V++ +   D TF SL PVNG ++G  AK+++VK+KLP ++LGK+WKL+DID DG LD DEFALA YL+ LKL+  EIP  LP HLIPP+KR
Sbjct:  240 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKR 771          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 343/532 (64.47%), Postives = 421/532 (79.14%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTN-----PVKGGAFE--VQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            S+K K++E+   V + L K+Y QKL PLE+ +KFH+FHS +L+  DFDAKPM+LL+GQYSTGKTTFIRYLLE DFPGIRIGPEPTTD+FIA+M  ++EG+IPGNALVVD K+ FR LS FGN FL RFQCS + N VLES+ I+DTPGILSGEKQR+DRGY F+ V+EWFAERVDRIILLFDAHKLDISDEF+R IE L G E+KIRIVLNK DMVD QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLH+D NR+LF+ E+ DLF+DL++LPRN+ +RKLND I+RARLAKVHAYII+ LR +MP++IGKD KKK+LIQNL  IY+++ R+H+ISPGDFP + +M+  L   DF  F  LK KL+E VD MLA DIA+LM  IPKE+ A    +N      V+GGAF    + + PFG G  EG ++G  + EW V++ +   D TF SL PVNG ++G  AK+++VK+KLP ++LGK+WKL+DID DG LD DEFALA YL+ LKL+  EIP  LP HLIPP+KR
Sbjct:  240 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKR 771          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 351/562 (62.46%), Postives = 433/562 (77.05%), Query Frame = 3
Query:   33 YFSCNHFSCKIIEGRN*K----IFKMNLFKSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTN-----PVKGGAFE--VQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + S N F  +I EG+  K    +F      S+K K++E+   V + L K+Y QKL PLE+ +KFH+FHS +L+  DFDAKPM+LL+GQYSTGKTTFIRYLLE DFPGIRIGPEPTTD+FIA+M  ++EG+IPGNALVVD K+ FR LS FGN FL RFQCS + N VLES+ I+DTPGILSGEKQR+DRGY F+ V+EWFAERVDRIILLFDAHKLDISDEF+R IE L G E+KIRIVLNK DMVD QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLH+D NR+LF+ E+ DLF+DL++LPRN+ +RKLND I+RARLAKVHAYII+ LR +MP++IGKD KKK+LIQNL  IY+++ R+H+ISPGDFP + +M+  L   DF  F  LK KL+E VD MLA DIA+LM  IPKE+ A    +N      V+GGAF    + + PFG G  EG ++G  + EW V++ +   D TF SL PVNG ++G  AK+++VK+KLP ++LGK+WKL+DID DG LD DEFALA YL+ LKL+  EIP  LP HLIPP+KR
Sbjct:   37 FSSTNPFGGEIEEGQKKKKTRSMFSWLGGDSSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKR 598          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 343/532 (64.47%), Postives = 421/532 (79.14%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTN-----PVKGGAFE--VQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            S+K K++E+   V + L K+Y QKL PLE+ +KFH+FHS +L+  DFDAKPM+LL+GQYSTGKTTFIRYLLE DFPGIRIGPEPTTD+FIA+M  ++EG+IPGNALVVD K+ FR LS FGN FL RFQCS + N VLES+ I+DTPGILSGEKQR+DRGY F+ V+EWFAERVDRIILLFDAHKLDISDEF+R IE L G E+KIRIVLNK DMVD QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLH+D NR+LF+ E+ DLF+DL++LPRN+ +RKLND I+RARLAKVHAYII+ LR +MP++IGKD KKK+LIQNL  IY+++ R+H+ISPGDFP + +M+  L   DF  F  LK KL+E VD MLA DIA+LM  IPKE+ A    +N      V+GGAF    + + PFG G  EG ++G  + EW V++ +   D TF SL PVNG ++G  AK+++VK+KLP ++LGK+WKL+DID DG LD DEFALA YL+ LKL+  EIP  LP HLIPP+KR
Sbjct:   62 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKR 593          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 343/532 (64.47%), Postives = 421/532 (79.14%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTN-----PVKGGAFE--VQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            S+K K++E+   V + L K+Y QKL PLE+ +KFH+FHS +L+  DFDAKPM+LL+GQYSTGKTTFIRYLLE DFPGIRIGPEPTTD+FIA+M  ++EG+IPGNALVVD K+ FR LS FGN FL RFQCS + N VLES+ I+DTPGILSGEKQR+DRGY F+ V+EWFAERVDRIILLFDAHKLDISDEF+R IE L G E+KIRIVLNK DMVD QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLH+D NR+LF+ E+ DLF+DL++LPRN+ +RKLND I+RARLAKVHAYII+ LR +MP++IGKD KKK+LIQNL  IY+++ R+H+ISPGDFP + +M+  L   DF  F  LK KL+E VD MLA DIA+LM  IPKE+ A    +N      V+GGAF    + + PFG G  EG ++G  + EW V++ +   D TF SL PVNG ++G  AK+++VK+KLP ++LGK+WKL+DID DG LD DEFALA YL+ LKL+  EIP  LP HLIPP+KR
Sbjct:    9 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKR 540          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: Past1 (gene:FBgn0016693 transcript:FBtr0082654)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 350/523 (66.92%), Postives = 425/523 (81.26%), Query Frame = 3
Query:  129 EEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNP-VKGGAFEV---QHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            +E+  NVI  L K+Y  KL PLE+ Y+FH+FHS  LE  DFDAKPM+LL+GQYSTGKTTFIRYLLE+DFPGIRIGPEPTTD+FIA+M+D+KEG IPGNALVVDPK+ FRPLSK+GN FL RFQCS + +PVL +I+I+DTPGILSGEKQR+DRGY F+ V+EWFAERVDRIILLFDAHKLDISDEFRR IE LKG+++KIRI+LNK DM+D QQLMRVYGALMWSLGKVL TPEVARVYIGSFWDQPL FD NR+LFE EE+DLF DL+SLPRN+ +RKLND I+RARLAKVHA+II+ LR +MP++ GKD+KKK+LI+NL  +YDRI R+HSISPGDFP I++MQ +L   DF  F +LK  L++ VD+MLA DIA+LM+MIP+E+       +P VKGGAFE     H +PFG    EGI+ G  + EW   K K   D  F  L PV+GKI+G TAK  L+K+KLP ++L KIWKLSD+D DG LD DEFALA++L+ +KL+  E+P  LP+HL+PP+KR
Sbjct:   18 QEVVENVIGELKKIYRSKLLPLEEHYQFHDFHSPKLEDPDFDAKPMILLVGQYSTGKTTFIRYLLERDFPGIRIGPEPTTDRFIAVMYDDKEGVIPGNALVVDPKKQFRPLSKYGNAFLNRFQCSSVASPVLNAISIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFRRSIEALKGHDDKIRIILNKADMIDHQQLMRVYGALMWSLGKVLQTPEVARVYIGSFWDQPLRFDANRRLFEDEEQDLFRDLQSLPRNAALRKLNDLIKRARLAKVHAFIIAELRKDMPSVFGKDSKKKDLIKNLGQVYDRIQREHSISPGDFPDIKKMQEVLQHQDFTKFHSLKPHLLDIVDNMLAKDIARLMEMIPQEEMTM--VADPIVKGGAFEGVIDDHVSPFGYMKGEGIDAGYGEHEWICNKDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKR 538          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: Past1 (gene:FBgn0016693 transcript:FBtr0082655)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 350/523 (66.92%), Postives = 425/523 (81.26%), Query Frame = 3
Query:  129 EEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNP-VKGGAFEV---QHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            +E+  NVI  L K+Y  KL PLE+ Y+FH+FHS  LE  DFDAKPM+LL+GQYSTGKTTFIRYLLE+DFPGIRIGPEPTTD+FIA+M+D+KEG IPGNALVVDPK+ FRPLSK+GN FL RFQCS + +PVL +I+I+DTPGILSGEKQR+DRGY F+ V+EWFAERVDRIILLFDAHKLDISDEFRR IE LKG+++KIRI+LNK DM+D QQLMRVYGALMWSLGKVL TPEVARVYIGSFWDQPL FD NR+LFE EE+DLF DL+SLPRN+ +RKLND I+RARLAKVHA+II+ LR +MP++ GKD+KKK+LI+NL  +YDRI R+HSISPGDFP I++MQ +L   DF  F +LK  L++ VD+MLA DIA+LM+MIP+E+       +P VKGGAFE     H +PFG    EGI+ G  + EW   K K   D  F  L PV+GKI+G TAK  L+K+KLP ++L KIWKLSD+D DG LD DEFALA++L+ +KL+  E+P  LP+HL+PP+KR
Sbjct:   12 QEVVENVIGELKKIYRSKLLPLEEHYQFHDFHSPKLEDPDFDAKPMILLVGQYSTGKTTFIRYLLERDFPGIRIGPEPTTDRFIAVMYDDKEGVIPGNALVVDPKKQFRPLSKYGNAFLNRFQCSSVASPVLNAISIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFRRSIEALKGHDDKIRIILNKADMIDHQQLMRVYGALMWSLGKVLQTPEVARVYIGSFWDQPLRFDANRRLFEDEEQDLFRDLQSLPRNAALRKLNDLIKRARLAKVHAFIIAELRKDMPSVFGKDSKKKDLIKNLGQVYDRIQREHSISPGDFPDIKKMQEVLQHQDFTKFHSLKPHLLDIVDNMLAKDIARLMEMIPQEEMTM--VADPIVKGGAFEGVIDDHVSPFGYMKGEGIDAGYGEHEWICNKDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKR 532          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: CG9297 (gene:FBgn0038181 transcript:FBtr0082827)

HSP 1 Score: 153.68 bits (387), Expect = 2.132e-38
Identity = 76/243 (31.28%), Postives = 136/243 (55.97%), Query Frame = 3
Query:  147 VIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFP--GIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQP 869
            +++ + ++Y   + PLE  YK+ +  +      +  +KP++L +G +S GK++ + YL + ++    +R G EP+   F  +M+  +   + G  L  D    F  L KFG     R +   +K+ +LE +NI++ PGIL   KQ + R + F++  +WF +R D I L++D  KLD+  E   +++ LKG E + RI+LNK D V  ++L+RV GAL+W++  ++ + +   +Y  S W  P
Sbjct:  513 ILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGPWSGGKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLAAD--YTFAGLQKFGQGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDVGPETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWTHP 752          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: CG9297 (gene:FBgn0038181 transcript:FBtr0333192)

HSP 1 Score: 153.68 bits (387), Expect = 2.228e-38
Identity = 76/243 (31.28%), Postives = 136/243 (55.97%), Query Frame = 3
Query:  147 VIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFP--GIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQP 869
            +++ + ++Y   + PLE  YK+ +  +      +  +KP++L +G +S GK++ + YL + ++    +R G EP+   F  +M+  +   + G  L  D    F  L KFG     R +   +K+ +LE +NI++ PGIL   KQ + R + F++  +WF +R D I L++D  KLD+  E   +++ LKG E + RI+LNK D V  ++L+RV GAL+W++  ++ + +   +Y  S W  P
Sbjct:  535 ILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGPWSGGKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLAAD--YTFAGLQKFGQGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDVGPETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWTHP 774          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: CG9297 (gene:FBgn0038181 transcript:FBtr0082828)

HSP 1 Score: 153.68 bits (387), Expect = 2.228e-38
Identity = 76/243 (31.28%), Postives = 136/243 (55.97%), Query Frame = 3
Query:  147 VIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFP--GIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQP 869
            +++ + ++Y   + PLE  YK+ +  +      +  +KP++L +G +S GK++ + YL + ++    +R G EP+   F  +M+  +   + G  L  D    F  L KFG     R +   +K+ +LE +NI++ PGIL   KQ + R + F++  +WF +R D I L++D  KLD+  E   +++ LKG E + RI+LNK D V  ++L+RV GAL+W++  ++ + +   +Y  S W  P
Sbjct:  535 ILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGPWSGGKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLAAD--YTFAGLQKFGQGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDVGPETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWTHP 774          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1a (EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2518])

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 337/522 (64.56%), Postives = 413/522 (79.12%), Query Frame = 3
Query:  123 KHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K  E+F NV   L +LY  KLFPLE  Y FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M  E+EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVLESI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIISAL+ EMP++ GKD+KKKELI NL  IY++I ++H+ISPGDFP +++MQ LL   DF  FP +K KL+E+V+DML NDIAKLM ++ KE+      +  VKGGAFE   + PFG G  EG   G  + EW V + K  YDE F +L P+NGKI+G TAK  + K+KLP  +LGKIW L+D+D DG LD +EFALA +L+++KL+  E+P  LP+HL+PP+KR+
Sbjct:   11 KDPELFQNVSDGLKRLYRTKLFPLEDTYHFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQLNNPVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLIAENRKLFEAEEQDLFQDIQSLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPSVFGKDSKKKELINNLGAIYEKIQKEHNISPGDFPNLKKMQELLSVQDFTKFPAMKPKLLESVEDMLGNDIAKLMALVRKEEATMP--SQSVKGGAFEGISNGPFGHGYGEGAGEGIDELEWIVGRDKPSYDEIFYTLSPINGKISGATAKKEMTKSKLPNTVLGKIWTLADVDKDGYLDDEEFALANHLIKVKLEGFELPAKLPNHLVPPSKRQ 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1b (EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2069])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 339/527 (64.33%), Postives = 412/527 (78.18%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K  K K  E+F  V   L +LY  KLFPLE  Y+FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M  E+EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +E+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D++ LPRN+ +RKLND I+RARLAKV AYIIS+L+ EMP + GK+NKKKELI NL  IY +I ++H ISPGDFPK+ +MQ +L   DF  F  LK KL+E+V+DMLANDIAKLM ++ +E+ +    +  V+GGAFE   + PFG G  EG   G  + EW VAK K  YDE F +L PVNGK++G  AK  +VK+KLP N+LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LPDHL+PP+KRE
Sbjct:    7 KDGKKKDPELFQTVSDGLKRLYRTKLFPLEDAYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQGLPRNAALRKLNDLIKRARLAKVQAYIISSLKKEMPNVFGKENKKKELIANLGEIYAKIEKEHQISPGDFPKLSKMQEVLAGQDFTKFQGLKPKLLESVEDMLANDIAKLMTLVRQEEASMP--SQAVQGGAFEGTMNGPFGHGYGEGAGEGIDELEWVVAKDKPTYDEIFYTLSPVNGKVSGAMAKKEMVKSKLPNNVLGKIWKLADVDKDGYLDDEEFALANHLIKVKLEGHELPADLPDHLVPPSKRE 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1b (EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2069])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 339/527 (64.33%), Postives = 412/527 (78.18%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K  K K  E+F  V   L +LY  KLFPLE  Y+FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M  E+EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +E+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D++ LPRN+ +RKLND I+RARLAKV AYIIS+L+ EMP + GK+NKKKELI NL  IY +I ++H ISPGDFPK+ +MQ +L   DF  F  LK KL+E+V+DMLANDIAKLM ++ +E+ +    +  V+GGAFE   + PFG G  EG   G  + EW VAK K  YDE F +L PVNGK++G  AK  +VK+KLP N+LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LPDHL+PP+KRE
Sbjct:    7 KDGKKKDPELFQTVSDGLKRLYRTKLFPLEDAYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQGLPRNAALRKLNDLIKRARLAKVQAYIISSLKKEMPNVFGKENKKKELIANLGEIYAKIEKEHQISPGDFPKLSKMQEVLAGQDFTKFQGLKPKLLESVEDMLANDIAKLMTLVRQEEASMP--SQAVQGGAFEGTMNGPFGHGYGEGAGEGIDELEWVVAKDKPTYDEIFYTLSPVNGKVSGAMAKKEMVKSKLPNNVLGKIWKLADVDKDGYLDDEEFALANHLIKVKLEGHELPADLPDHLVPPSKRE 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1b (EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2069])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 339/527 (64.33%), Postives = 412/527 (78.18%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K  K K  E+F  V   L +LY  KLFPLE  Y+FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M  E+EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +E+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D++ LPRN+ +RKLND I+RARLAKV AYIIS+L+ EMP + GK+NKKKELI NL  IY +I ++H ISPGDFPK+ +MQ +L   DF  F  LK KL+E+V+DMLANDIAKLM ++ +E+ +    +  V+GGAFE   + PFG G  EG   G  + EW VAK K  YDE F +L PVNGK++G  AK  +VK+KLP N+LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LPDHL+PP+KRE
Sbjct:    7 KDGKKKDPELFQTVSDGLKRLYRTKLFPLEDAYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQGLPRNAALRKLNDLIKRARLAKVQAYIISSLKKEMPNVFGKENKKKELIANLGEIYAKIEKEHQISPGDFPKLSKMQEVLAGQDFTKFQGLKPKLLESVEDMLANDIAKLMTLVRQEEASMP--SQAVQGGAFEGTMNGPFGHGYGEGAGEGIDELEWVVAKDKPTYDEIFYTLSPVNGKVSGAMAKKEMVKSKLPNNVLGKIWKLADVDKDGYLDDEEFALANHLIKVKLEGHELPADLPDHLVPPSKRE 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd3 (EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-041014-352])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 340/525 (64.76%), Postives = 412/525 (78.48%), Query Frame = 3
Query:  117 KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREI 1691
            + K  E+F  V + L KLY  KL PLE+ YKFHEFHS +LE  DFD KPMVLL+GQYSTGKT+FIRYLLEQDFPG+RIGPEPTTD FIA+M    EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVLESI++IDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP++ GKDNKKKELI +L  IY RI R+H ISPGDFP +++MQ  L  HD   F  LK KL++TVDDMLA+DIA+LM ++ +E+T +      VKGGAFE   + PFG G  EG   G  + EW VA+ K  YDE F +L PVNGK+ G  AK  +VK+KLP  +LGKIWKL+DID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR++
Sbjct:   11 RKKDPEVFQTVSEGLKKLYKTKLLPLEEHYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGTMEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELINSLGEIYSRIEREHQISPGDFPNLKKMQEQLQAHDLNKFQPLKMKLLDTVDDMLAHDIAQLMVLVRQEETQRP--NQVVKGGAFEGTMNGPFGHGYGEGAGEGIDEVEWVVARDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSDLPGHLVPPSKRKV 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:Xenbase;Acc:XB-GENE-854514])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 339/525 (64.57%), Postives = 411/525 (78.29%), Query Frame = 3
Query:  117 KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREI 1691
            + K  E+F  V   L KLY  KL PLE+ YKFHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + +PVLESI++IDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+K+R+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMPA+ GKDNKKKEL+  L  IY RI R+H ISPGDFP +++MQ+LL   DF  F  LK KL+ETVD+MLA+DIA LM ++ +E+T +      VKGGAFE   + PFG G  EG   G  D +W V++ K  YDE F +L PVNGK+ G  AK  +VK+KLP  +LGKIWKL+DID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR++
Sbjct:   11 RKKDPEVFQTVSDGLRKLYKTKLLPLEEYYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDVEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPSPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPAVFGKDNKKKELVAGLGEIYARIEREHQISPGDFPNLKKMQDLLLAQDFNKFQPLKNKLLETVDEMLAHDIAHLMVLVRQEETQKP--VQVVKGGAFEGTQNGPFGHGYGEGAGEGIDDADWVVSRDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNDLPCHLLPPSKRKV 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: nfe2l2 (nuclear factor, erythroid 2 like 2 [Source:Xenbase;Acc:XB-GENE-943926])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 340/526 (64.64%), Postives = 411/526 (78.14%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNP-VKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L KLYT KL PLE+ Y+FH+FHS +LE  DF   PMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDPK+PFR LS FGN FL RF C+ + NPVLESI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYII AL+ EMP + GK+NKKKELI NL  IY +I ++H ISPGDFP I++MQ +L   DF  F  +K KL++TVDDMLA+DIAKLM M+ +E++   + TN  VKGGAFE   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G +AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HLIPP+KR
Sbjct:    9 TRRKKEPELFQTVSEGLRKLYTHKLLPLEETYRFHDFHSPALEDADFHNNPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPVEGVMPGNALVVDPKKPFRKLSAFGNAFLNRFMCAQLPNPVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIIGALKKEMPNVFGKENKKKELINNLHEIYMKIEKEHQISPGDFPNIKKMQEILMTQDFAKFQAVKPKLLDTVDDMLASDIAKLMVMVRQEES---QMTNQVVKGGAFEGTMNGPFGHGYGEGAGEGIDDFEWVVGKDKPTYDEIFFTLSPVNGKITGASAKKEMVKSKLPNTVLGKIWKLADVDRDGLLDDEEFALANHLIKIKLEGHELPADLPSHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:Xenbase;Acc:XB-GENE-854514])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 339/524 (64.69%), Postives = 410/524 (78.24%), Query Frame = 3
Query:  117 KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            + K  E+F  V   L KLY  KL PLE+ YKFHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + +PVLESI++IDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+K+R+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMPA+ GKDNKKKEL+  L  IY RI R+H ISPGDFP +++MQ+LL   DF  F  LK KL+ETVD+MLA+DIA LM ++ +E+T +      VKGGAFE   + PFG G  EG   G  D +W V++ K  YDE F +L PVNGK+ G  AK  +VK+KLP  +LGKIWKL+DID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR+
Sbjct:   11 RKKDPEVFQTVSDGLRKLYKTKLLPLEEYYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDVEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPSPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPAVFGKDNKKKELVAGLGEIYARIEREHQISPGDFPNLKKMQDLLLAQDFNKFQPLKNKLLETVDEMLAHDIAHLMVLVRQEETQKP--VQVVKGGAFEGTQNGPFGHGYGEGAGEGIDDADWVVSRDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNDLPCHLLPPSKRK 532          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:Xenbase;Acc:XB-GENE-854514])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 339/541 (62.66%), Postives = 411/541 (75.97%), Query Frame = 3
Query:  117 KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDR----------------GYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREI 1691
            + K  E+F  V   L KLY  KL PLE+ YKFHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + +PVLESI++IDTPGILSGEKQR+ R                GY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+K+R+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMPA+ GKDNKKKEL+  L  IY RI R+H ISPGDFP +++MQ+LL   DF  F  LK KL+ETVD+MLA+DIA LM ++ +E+T +      VKGGAFE   + PFG G  EG   G  D +W V++ K  YDE F +L PVNGK+ G  AK  +VK+KLP  +LGKIWKL+DID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR++
Sbjct:   11 RKKDPEVFQTVSDGLRKLYKTKLLPLEEYYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDVEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPSPVLESISVIDTPGILSGEKQRISREREESGYSGLRRCTYGGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPAVFGKDNKKKELVAGLGEIYARIEREHQISPGDFPNLKKMQDLLLAQDFNKFQPLKNKLLETVDEMLAHDIAHLMVLVRQEETQKP--VQVVKGGAFEGTQNGPFGHGYGEGAGEGIDDADWVVSRDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNDLPCHLLPPSKRKV 549          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: ehd4 (EH domain containing 4 [Source:NCBI gene;Acc:100125054])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 335/527 (63.57%), Postives = 404/527 (76.66%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K N    +++   V   L  LYT KL PLE+ Y+FHEFHS +LE  DF   PMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M+ EKEG+IPGNALVVDPK+PFR L+ FGN FL RF CS + N VL SI+IID+PGILSGEKQR+ RGY F +V++WFAERVDRIILLFDAHKLDISDEF   I   +G ++KIR+VLNK D VD+QQLMRVYGALMWSLGKV+ TPEV RVYIGSFW +PL    NRKLFE+E +DLF D++SLPRN+ +RKLND I+RARLAKVHAYIIS L+ EMPA+ GKD KKKELI  L  IY ++ R+H ISPGDFP +++MQ  L  +DF  F T+K KLIE+VD+MLAN IA LM MI +E+   N  T  V GGAFE   + PFG G  EG   G  D EW VAK K  YDE F +L P+NGKI+G +AK  +V +KLP ++LGKIWKL+D D DG LD +EFALA +L+++KL+  E+P  LP HL+PP++R+
Sbjct:    7 KENAKGQQDVLQTVTGGLQALYTGKLLPLEEHYRFHEFHSPALEEADFKNLPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGEKEGSIPGNALVVDPKKPFRKLNSFGNAFLNRFMCSQLPNEVLRSISIIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIRAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVVRVYIGSFWSKPLQNTENRKLFEMEAQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISHLKKEMPAVFGKDTKKKELISRLPEIYIQLQREHQISPGDFPDVKKMQQQLEMYDFSKFHTMKPKLIESVDNMLANKIAPLMSMIREEEC--NMPTQMVHGGAFEGTMEGPFGQGYGEGAGEGAEDEEWVVAKDKPVYDELFYTLSPINGKISGVSAKKEMVNSKLPNSVLGKIWKLADNDKDGMLDDEEFALAKHLIKIKLEGYELPNDLPSHLVPPSQRK 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd1 (EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:1341878])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 409/525 (77.90%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H IS GDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HLIPP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQAVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd1 (EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:1341878])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 409/525 (77.90%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H IS GDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HLIPP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQAVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd3 (EH-domain containing 3 [Source:MGI Symbol;Acc:MGI:1928900])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 338/525 (64.38%), Postives = 409/525 (77.90%), Query Frame = 3
Query:  117 KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREI 1691
            + K  E+F  V   L KLY  KL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + N VLESI++IDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+K+R+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP++ GKD KKKEL+ NL  IY RI R+H ISPGDFP ++RMQ+ L   DF  F  LK KL+E VDDMLA+DIA+LM ++ +E+T +      VKGGAFE     PFG G  EG   G  D EW VA+ K  YDE F +L PV+GKI G  AK  +V++KLP ++LGKIWKL+DID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR++
Sbjct:   11 RKKDPEVFQTVSDGLKKLYKTKLLPLEEYYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDVEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNAVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDTKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEETQRP--VQMVKGGAFEGTLQGPFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLLPPSKRKV 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd4 (EH-domain containing 4 [Source:MGI Symbol;Acc:MGI:1919619])

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 320/515 (62.14%), Postives = 398/515 (77.28%), Query Frame = 3
Query:  144 NVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
             V   L  LY +K+ PLE+ Y+FHEFHS +LE  DF+ KPM+LL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M+ E EG+ PGNALVVDPK+PFR LS+FGN FL RF CS + N VL+SI+IID+PGILSGEKQR+ RGY F +V++WFAERVDRIILLFDAHKLDISDEF   I+  +G ++KIR+VLNK D VD+QQLMRVYGALMWSLGKV+ TPEV RVYIGSFW QPL    NR+LFE E +DLF D++SLP+ + VRKLND I+RARLAKVHAYIIS L+ EMP + GK+NKK+ELI  L  IY ++ R++ IS GDFP+++ MQ  L ++DF  F +LK KLIE VD+ML N I+ LM +I +E+   N  T  V+GGAF+   + PF  G  EG   G  + EW VAK K  YDE F +L P+NGKI+G  AK  +V +KLP ++LGKIWKL+D D DG LD++EFALA +L+++KLD  E+P +LP HL+PP+ R+
Sbjct:   23 TVTGGLRSLYQRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPNMFGKENKKRELIYRLPEIYVQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLTNKISSLMGLISQEEM--NMPTQMVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPNSLPPHLVPPSHRK 535          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd2 (EH-domain containing 2 [Source:MGI Symbol;Acc:MGI:2154274])

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 313/523 (59.85%), Postives = 390/523 (74.57%), Query Frame = 3
Query:  132 EIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPF-GIGASEGINRGKF----DTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            E    V  SL +LY  KL PLE+ Y+F  FHS +LE  DFD KPMVL+ GQYSTGKT+FI+YLLEQ+ PG R+GPEPTTD F+A+M  E EGT+PGNALVVDP++PFR L+ FGN FL RF C+ + N VLESI+IIDTPGILSG KQR+ RGY F  V+ WFAERVD IILLFDAHKL+ISDEF   I  L+G+E+KIR+VLNK DMV++QQLMRVYGALMW+LGKV+ TPEV RVYIGSFW QPL    NR+LFELEE+DLF D++ LPR++ +RKLND ++RARL +VHAYIIS L+ EMP + GK+NKKK+LI  L  I+ +I  +H ISPGDFP  ++MQ LL  HDF  F +LK KL+E +DDMLA DIAKLM ++ +E+    E    V+GGAFE     PF   G  E I  G+     D EW V K K++YDE F +L P +GK++G+ AK ++V TKLP ++LG+IWKLSD+D DG LD +EFALA +L+  KL+   +P  LP  L+PP+KR
Sbjct:   16 EAIRTVTSSLKELYRTKLLPLEEHYRFGSFHSPALEDADFDGKPMVLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGETEGTVPGNALVVDPEKPFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPTVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDDMLAQDIAKLMPLLRQEELESVEAG--VQGGAFEGTRMGPFVERGPDEAIEDGEEGSEDDAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPTNLPRRLVPPSKR 536          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5RBP4|EHD1_PONAB (EH domain-containing protein 1 OS=Pongo abelii OX=9601 GN=EHD1 PE=2 SV=1)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 410/525 (78.10%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H ISPGDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9H4M9|EHD1_HUMAN (EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 410/525 (78.10%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H ISPGDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q641Z6|EHD1_RAT (EH domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ehd1 PE=1 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 409/525 (77.90%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H IS GDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HLIPP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQAVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9WVK4|EHD1_MOUSE (EH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ehd1 PE=1 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 409/525 (77.90%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H IS GDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++     +  VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HLIPP+KR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--SQAVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5E9R3|EHD1_BOVIN (EH domain-containing protein 1 OS=Bos taurus OX=9913 GN=EHD1 PE=1 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 336/525 (64.00%), Postives = 409/525 (77.90%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            + + K  E+F  V + L +LY QKL PLE+ Y+FHEFHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M    EG +PGNALVVDP+RPFR L+ FGN FL RF C+ + NPVL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIIS+L+ EMP + GK++KKKEL+ NL  IY +I R+H ISPGDFP + +MQ LL   DF  F  LK KL++TVDDMLANDIA+LM M+ +E++        VKGGAF+   + PFG G  EG   G  D EW V K K  YDE F +L PVNGKI G  AK  +VK+KLP  +LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR
Sbjct:    9 ARRKKEPELFQTVSEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPNLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMP--AQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDRDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A1S8X9A1 (Dynamin family protein OS=Opisthorchis viverrini OX=6198 GN=X801_00770 PE=3 SV=1)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 363/530 (68.49%), Postives = 439/530 (82.83%), Query Frame = 3
Query:  102 LFKSN-KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            +FK N KPK +E + +VI  L++LYTQKL PLE  YKFHEFHS +LE GDF++KPMVLL+GQYSTGKTTFIRYLL QDFPGIRIGPEPTTD FIA+M++E+EG IPGNALV D K+ FRPL +FGNNFL RFQC+ + N VLESI  IDTPGILSGEKQRLDRGY FS VIEWFAERVDRIILLFDAHKLDISDEF+RVIE+LKG E+KIRIVLNK DMVD+QQLMRVYGALMWSLGK+LYTPEVARVYIGSFWD+ L FDTNRKLFELE++DLF DL +LP ++ +RKLND IRRARLAKVHAYII  L++EMPA++GKD KKKELI NL  +Y+ +SR H IS GDFP ++RMQ  L  HDF+ FP+L+ KL++ VDDML+ND+AKLMQMIP+EQ A      PV+GGAF+  +D PF   ASEGIN+G +D+EW V++ + E D  F +L PVNGKI+G +A+ +++K++LP + L KIW L D+D DG LD+DEFAL  +L++L+L  +E+P TLP HLIPP+KR+
Sbjct:   45 VFKKNTKPKDQEAYASVIDGLSRLYTQKLLPLETTYKFHEFHSPALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMYNEREGVIPGNALVADHKKQFRPLDRFGNNFLNRFQCAHLPNEVLESITFIDTPGILSGEKQRLDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEDKIRIVLNKADMVDAQQLMRVYGALMWSLGKILYTPEVARVYIGSFWDRRLLFDTNRKLFELEQRDLFRDLSTLPGDAALRKLNDIIRRARLAKVHAYIIGHLKNEMPAIMGKDAKKKELINNLGKVYETLSRLHHISLGDFPNVQRMQECLALHDFRTFPSLQPKLVKAVDDMLSNDMAKLMQMIPQEQKANAPVHEPVRGGAFD-SNDTPFSYQASEGINQGMYDSEWIVSRERAEADSIFLTLDPVNGKISGASARSHMIKSQLPNSTLRKIWILGDVDRDGYLDEDEFALVCHLIKLQLQGDELPTTLPKHLIPPSKRQ 573          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A4S2M9B9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001698 PE=3 SV=1)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 363/527 (68.88%), Postives = 438/527 (83.11%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K+ KPK +E + +VI+ L++LYTQKL PLE  YKFHEFHS +LE GDF++KPMVLL+GQYSTGKTTFIRYLL QDFPGIRIGPEPTTD FIA+M++E+EG IPGNALV D K+ FRPL +FGNNFL RFQC+ + N VLESI  IDTPGILSGEKQRLDRGY FS VIEWFAERVDRIILLFDAHKLDISDEF+RVIE+LKG E+KIRIVLNK DMVD+QQLMRVYGALMWSLGK+L+TPEVARVYIGSFWD+ L FDTNRKLFELE++DLF DL +LP ++ +RKLND IRRARLAKVHAYIIS L++EMPAL+GKD KKKELI NL  +Y+ +SR H IS GDFP I+RMQ  L  HDF+ FP+ + KLI+ VDDML+ND+AKLMQMIP+EQ A      PV+GGAF+  +D PF   ASEGIN+G +D+EW V++ + E D  F +L PVNGKI+G +A+ +++K++LP + L KIW L D+D DG LD+DEFAL  +L++L+L  +E+P TLP HLIPP+KR+
Sbjct:   37 KNTKPKDQEAYASVIEGLSRLYTQKLLPLETTYKFHEFHSPALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMYNEREGVIPGNALVADHKKQFRPLDRFGNNFLNRFQCAHLPNEVLESITFIDTPGILSGEKQRLDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEDKIRIVLNKADMVDAQQLMRVYGALMWSLGKILFTPEVARVYIGSFWDRRLLFDTNRKLFELEQRDLFRDLSTLPGDAALRKLNDIIRRARLAKVHAYIISHLKNEMPALMGKDAKKKELINNLGKVYETLSRLHHISLGDFPNIQRMQECLALHDFRTFPSFQPKLIKAVDDMLSNDMAKLMQMIPQEQKANAPVHEPVRGGAFD-SNDTPFSYQASEGINQGMYDSEWIVSRERAEADSIFLTLDPVNGKISGASARSHMIKSQLPNSTLRKIWILGDVDRDGYLDEDEFALVCHLIKLQLQGDELPTTLPKHLIPPSKRQ 562          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: G7YAU0 (EH domain-containing protein 3 OS=Clonorchis sinensis OX=79923 GN=CLF_104044 PE=3 SV=1)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 366/537 (68.16%), Postives = 441/537 (82.12%), Query Frame = 3
Query:   99 NLFKSN-KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNE------FTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
             +FK N KPK +E + +VI+ L++LYTQKL PLE  YKFHEFHS +LE GDF++KPMVLL+GQYSTGKTTFIRYLL QDFPGIRIGPEPTTD FIA+M++E+EG IPGNALV D K+ FRPL +FGNNFL RFQC+ + N VLESI  IDTPGILSGEKQRLDRGY FS VIEWFAERVDRIILLFDAHKLDISDEF+RVIE+LKG E+KIRIVLNK DMVD+QQLMRVYGALMWSLGK+LYTPEVARVYIGSFWD+ L FDTNRKLFELE++DLF DL +LP ++ +RKLND IRRARLAKVHAYIIS L+ EMPAL+GKD KKKELI NL  +Y+ +SR H IS GDFP ++RMQ  L  HDF+ FP+L+ KLI+ VDDML+ND+AKLMQMIP+E+ A  E         PV+GGAF+  +D PF   ASEGIN+G +D+EW V++ + E D  F +L PVNGKI+G +A+ +++K++LP + L KIW L D+D DG LD+DEFAL  +L++L+L  +E+P TLP HLIPP+KR+
Sbjct:  229 GVFKKNTKPKDQEAYASVIEGLSRLYTQKLLPLETTYKFHEFHSPALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMYNEREGVIPGNALVADHKKQFRPLDRFGNNFLNRFQCAHLPNEVLESITFIDTPGILSGEKQRLDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEDKIRIVLNKADMVDAQQLMRVYGALMWSLGKILYTPEVARVYIGSFWDRRLLFDTNRKLFELEQRDLFRDLSTLPGDAALRKLNDIIRRARLAKVHAYIISHLKSEMPALMGKDAKKKELINNLGKVYETLSRLHHISLGDFPNVQRMQECLALHDFRTFPSLQPKLIKAVDDMLSNDMAKLMQMIPQEKAAAQEQKANAPVHEPVRGGAFD-SNDTPFSYQASEGINQGMYDSEWIVSRERAEADSIFLTLDPVNGKISGASARSHMIKSQLPNSTLRKIWILGDVDRDGYLDEDEFALVCHLIKLQLQGDELPTTLPKHLIPPSKRQ 764          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A075A282 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_15072 PE=3 SV=1)

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 363/530 (68.49%), Postives = 439/530 (82.83%), Query Frame = 3
Query:  102 LFKSN-KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            +FK N KPK +E + +VI  L++LYTQKL PLE  YKFHEFHS +LE GDF++KPMVLL+GQYSTGKTTFIRYLL QDFPGIRIGPEPTTD FIA+M++E+EG IPGNALV D K+ FRPL +FGNNFL RFQC+ + N VLESI  IDTPGILSGEKQRLDRGY FS VIEWFAERVDRIILLFDAHKLDISDEF+RVIE+LKG E+KIRIVLNK DMVD+QQLMRVYGALMWSLGK+LYTPEVARVYIGSFWD+ L FDTNRKLFELE++DLF DL +LP ++ +RKLND IRRARLAKVHAYII  L++EMPA++GKD KKKELI NL  +Y+ +SR H IS GDFP ++RMQ  L  HDF+ FP+L+ KL++ VDDML+ND+AKLMQMIP+EQ A      PV+GGAF+  +D PF   ASEGIN+G +D+EW V++ + E D  F +L PVNGKI+G +A+ +++K++LP + L KIW L D+D DG LD+DEFAL  +L++L+L  +E+P TLP HLIPP+KR+
Sbjct:    4 VFKKNTKPKDQEAYASVIDGLSRLYTQKLLPLETTYKFHEFHSPALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMYNEREGVIPGNALVADHKKQFRPLDRFGNNFLNRFQCAHLPNEVLESITFIDTPGILSGEKQRLDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEDKIRIVLNKADMVDAQQLMRVYGALMWSLGKILYTPEVARVYIGSFWDRRLLFDTNRKLFELEQRDLFRDLSTLPGDAALRKLNDIIRRARLAKVHAYIIGHLKNEMPAIMGKDAKKKELINNLGKVYETLSRLHHISLGDFPNVQRMQECLALHDFRTFPSLQPKLVKAVDDMLSNDMAKLMQMIPQEQKANAPVHEPVRGGAFD-SNDTPFSYQASEGINQGMYDSEWIVSRERAEADSIFLTLDPVNGKISGASARSHMIKSQLPNSTLRKIWILGDVDRDGYLDEDEFALVCHLIKLQLQGDELPTTLPKHLIPPSKRQ 532          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A4V3SGP0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001698 PE=3 SV=1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 363/533 (68.11%), Postives = 439/533 (82.36%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNE------FTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K+ KPK +E + +VI+ L++LYTQKL PLE  YKFHEFHS +LE GDF++KPMVLL+GQYSTGKTTFIRYLL QDFPGIRIGPEPTTD FIA+M++E+EG IPGNALV D K+ FRPL +FGNNFL RFQC+ + N VLESI  IDTPGILSGEKQRLDRGY FS VIEWFAERVDRIILLFDAHKLDISDEF+RVIE+LKG E+KIRIVLNK DMVD+QQLMRVYGALMWSLGK+L+TPEVARVYIGSFWD+ L FDTNRKLFELE++DLF DL +LP ++ +RKLND IRRARLAKVHAYIIS L++EMPAL+GKD KKKELI NL  +Y+ +SR H IS GDFP I+RMQ  L  HDF+ FP+ + KLI+ VDDML+ND+AKLMQMIP+E+ A  E         PV+GGAF+  +D PF   ASEGIN+G +D+EW V++ + E D  F +L PVNGKI+G +A+ +++K++LP + L KIW L D+D DG LD+DEFAL  +L++L+L  +E+P TLP HLIPP+KR+
Sbjct:    7 KNTKPKDQEAYASVIEGLSRLYTQKLLPLETTYKFHEFHSPALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMYNEREGVIPGNALVADHKKQFRPLDRFGNNFLNRFQCAHLPNEVLESITFIDTPGILSGEKQRLDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEDKIRIVLNKADMVDAQQLMRVYGALMWSLGKILFTPEVARVYIGSFWDRRLLFDTNRKLFELEQRDLFRDLSTLPGDAALRKLNDIIRRARLAKVHAYIISHLKNEMPALMGKDAKKKELINNLGKVYETLSRLHHISLGDFPNIQRMQECLALHDFRTFPSFQPKLIKAVDDMLSNDMAKLMQMIPQEKAAAQEQKANAPVHEPVRGGAFD-SNDTPFSYQASEGINQGMYDSEWIVSRERAEADSIFLTLDPVNGKISGASARSHMIKSQLPNSTLRKIWILGDVDRDGYLDEDEFALVCHLIKLQLQGDELPTTLPKHLIPPSKRQ 538          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd1a (EH domain-containing protein 1-like [Source:NCBI gene;Acc:103036046])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 336/527 (63.76%), Postives = 418/527 (79.32%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQ-NEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            K+N  K  E+F NV + L +LY  KLFPLE  Y+FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M+ E+EG IPGNALVVDPK+PFR L+ FGN FL RF C+ +KN VL+SI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYII++L+ EMP++ GKD+KKKELI NL  IY++I ++H+ISPGDFP +++MQ LL   DF  FP LK KL+E V+DMLANDIAKLM ++ +E+ +  N+    VKGGAF+   + PFG G  EG   G  + EW V + K  YDE F +L PVNGK++G  AK  ++K+KLP  +LGKIW L+D+D DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR
Sbjct:    6 KNNAKKDPELFQNVSEGLKRLYRNKLFPLEDTYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMYGEQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQLKNAVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLIADNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIITSLKKEMPSVFGKDSKKKELISNLGAIYEKIEKEHNISPGDFPNLKKMQELLNGQDFNKFPALKPKLLENVEDMLANDIAKLMTLVRQEEASMPNQI---VKGGAFDGAMNGPFGHGYGEGAGEGIDELEWVVGRDKPSYDEIFYTLSPVNGKVSGAAAKKEMLKSKLPNTVLGKIWTLADVDKDGYLDDEEFALANHLIKVKLEGYELPSKLPSHLVPPSKR 529          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd3 (EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-041014-352])

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 335/538 (62.27%), Postives = 407/538 (75.65%), Query Frame = 3
Query:  132 EIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDR------------------GYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREI 1691
            E+F  V   L  LY  KL PLE+ YKFHEFHS +LE  DFD KPM+LL+GQYSTGKT+FIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVLESI++IDTPGILSGEKQR+ R                  GY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHA+IIS+L+ EMP + GK+NKKKELI +L  IY RI R+H ISPGDFP +++MQ  L  HDF  F  +K KL++  DDML NDIA+LM ++ +E+T +      VKGGAFE   + PFG G  EG   G  + EW VA+ K  YDE F +L PVNGK+NG  AK  ++K+KLP  +LGKIWKLSDID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR+I
Sbjct:   16 EVFQTVTDGLKTLYKAKLLPLEEHYKFHEFHSPALEDADFDNKPMILLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDLEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRETAEDVCGYSCLHKCPYGGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLISDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAHIISSLKKEMPTVFGKENKKKELINSLGEIYSRIEREHQISPGDFPNLKKMQEQLQAHDFMKFQPMKMKLMDNADDMLTNDIAQLMVLVRQEETQRP--NQVVKGGAFEGTMNGPFGHGYGEGAGEGIDEVEWVVARDKPMYDEIFYTLSPVNGKVNGANAKKEMLKSKLPNTVLGKIWKLSDIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLVPPSKRKI 551          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd1b (EH domain-containing protein 1-like [Source:NCBI gene;Acc:103046645])

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 327/526 (62.17%), Postives = 407/526 (77.38%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            +  + K  E+F  V   + +LY  KL PLE  ++FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M  E+EG +PGNALVVDPK+PFR L+ FGN FL RF C+ + N VLESI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK YE+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D+++LPRN+ +RKLND I+RARLAKVHAYIISAL+ EMP + GK++KKKELI NL  IY  + +++ ISPGDFPK+ +MQ +L   DF  F T+K KL+E V+DML NDIA+LM ++ +E+ A    T  V+GGAFE   + PFG G  EG   G  + EW VA+ K  YDE F  L P+NGK++G  AK  ++K+KLP  ILGKIWKL+D+D DG LD +EFALA +L+++KL+  ++P  LP HL+PP+KR
Sbjct:    7 RDGRRKEPELFSTVSDGMRRLYHAKLLPLEDAHRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHAEQEGLVPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNYEDKMRVVLNKSDQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQNLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPNMFGKESKKKELIANLGEIYAMVEKEYQISPGDFPKLSKMQEILAIQDFSKFQTIKPKLMEAVEDMLTNDIARLMVLVRQEEAATPSQT--VQGGAFEGTKNGPFGHGYGEGAGAGIDELEWIVARDKPSYDEIFFMLSPINGKVSGAMAKKEMIKSKLPNTILGKIWKLADVDGDGYLDIEEFALANHLIKVKLEGHDLPADLPHHLVPPSKR 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd1b (EH domain-containing protein 1-like [Source:NCBI gene;Acc:103046645])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 326/525 (62.10%), Postives = 406/525 (77.33%), Query Frame = 3
Query:  108 KSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTK 1682
            +  + K  E+F  V   + +LY  KL PLE  ++FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M  E+EG +PGNALVVDPK+PFR L+ FGN FL RF C+ + N VLESI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK YE+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D+++LPRN+ +RKLND I+RARLAKVHAYIISAL+ EMP + GK++KKKELI NL  IY  + +++ ISPGDFPK+ +MQ +L   DF  F T+K KL+E V+DML NDIA+LM ++ +E+ A    T  V+GGAFE   + PFG G  EG   G  + EW VA+ K  YDE F  L P+NGK++G  AK  ++K+KLP  ILGKIWKL+D+D DG LD +EFALA +L+++KL+  ++P  LP HL+PP+K
Sbjct:    7 RDGRRKEPELFSTVSDGMRRLYHAKLLPLEDAHRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHAEQEGLVPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNYEDKMRVVLNKSDQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQNLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPNMFGKESKKKELIANLGEIYAMVEKEYQISPGDFPKLSKMQEILAIQDFSKFQTIKPKLMEAVEDMLTNDIARLMVLVRQEEAATPSQT--VQGGAFEGTKNGPFGHGYGEGAGAGIDELEWIVARDKPSYDEIFFMLSPINGKVSGAMAKKEMIKSKLPNTILGKIWKLADVDGDGYLDIEEFALANHLIKVKLEGHDLPADLPHHLVPPSK 529          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd4 (EH domain-containing protein 4 [Source:NCBI gene;Acc:103028495])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 323/531 (60.83%), Postives = 401/531 (75.52%), Query Frame = 3
Query:   96 MNLFKSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            +N  +  + K  ++F  V + L  LY +KL PLE+ Y FH+FHS +LE  DF +KPMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M+ E EG +PGNALVVDPK+PFR L+ FGN FL RF CS + N VL+SI+IIDTPGILSGEKQR+ RGY FSEV+ WF ERVDRIILLFDAHKLDISDEF   I+  +G ++KIR+VLNK D VD+QQLMRVYGALMWSLGKV+ TPEVARVY+GSFW +PL    +R+LFE E +DLF D+++LPRN+ +RKLND I+RARLAKVHAYIIS L+ EMP+L GK+ KK+ELI  L  IY  + R++ ISPGDFP + +MQ  L  +DF  FP+LK KLIE VD ML+N I+ LM MI +E+  Q   T  V GGAFE   D PFG G  EGI+ G    +W V++ K  YDE F +L P+NGK+ G  AK  ++ ++LP  +LGKIWKL+D D DG LD +EFALA +L+++KL+  E+P  LP HL+PP  R+
Sbjct:    5 VNKEQGGRNKEGDMFQTVTEGLQSLYAKKLLPLEEAYLFHDFHSPALEEADFQSKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDGFIAVMYGENEGVVPGNALVVDPKKPFRKLNAFGNAFLNRFICSQMPNQVLQSISIIDTPGILSGEKQRISRGYDFSEVLRWFGERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVARVYLGSFWAKPLQNTDSRRLFEAEAQDLFRDIQALPRNAALRKLNDLIKRARLAKVHAYIISFLKKEMPSLFGKEKKKEELIARLPEIYQMLQREYHISPGDFPNVTKMQEQLMHYDFSKFPSLKIKLIEAVDKMLSNKISGLMTMIREEEGKQP--TQVVTGGAFEGSEDGPFGHGYGEGISAGADTEDWIVSRDKPRYDEIFYTLMPINGKVTGVNAKKEMMNSRLPNTVLGKIWKLADCDKDGMLDDEEFALAQHLIKVKLEGFELPSELPAHLVPPAHRK 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ehd1a (EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2518])

HSP 1 Score: 474.552 bits (1220), Expect = 1.878e-163
Identity = 246/404 (60.89%), Postives = 312/404 (77.23%), Query Frame = 3
Query:  489 RFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIVFS 1700
            RF C+ + NPVLESI+IIDTPGILSGEKQR+ RGY F+ V+ WFAERVDRIILLFDAHKLDISDEF  VI  LKG+++KIR+VLNK D V++QQLMRVYGALMWSLGKV+ TPEV RVY+GSFW  PL    NR+LFE+EE+DLF+D+++LPRN+ +RKLND I+R RLAKVHAYIIS LR EMPA+ GKD KKKELI NL  I+ RI R+H IS GDFP +++MQ  L D DF  F TLK KL E VD+ML++DIA+LM ++ +E+      +  V+GGAFE   + PFG G  EG   G  + +W V+K K  YDE F +L P++GKI+G +AK  +VK+KLP  +LG+IWKL+D+D DG LD DEFALA +L+++KL+  E+P  LP HL+PP+KR++  +
Sbjct:    1 RFMCAQLPNPVLESISIIDTPGILSGEKQRISRGYDFTAVLTWFAERVDRIILLFDAHKLDISDEFSEVIRALKGHDDKIRVVLNKADQVETQQLMRVYGALMWSLGKVINTPEVVRVYMGSFWSNPLLIPDNRRLFEMEEQDLFKDIQTLPRNAALRKLNDLIKRTRLAKVHAYIISHLRKEMPAVFGKDAKKKELIANLGEIFTRIEREHQISAGDFPNLKKMQEQLQDQDFTKFHTLKPKLFEKVDEMLSHDIARLMGLVRQEEARVP--SQAVRGGAFEGTENGPFGRGYGEGAGEGADEADWVVSKDKPAYDEIFYTLSPIDGKISGASAKREMVKSKLPNTVLGRIWKLADVDKDGMLDDDEFALANHLIKVKLEGHELPEELPMHLLPPSKRKLAVA 402          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007308.1 (pep scaffold:Pmarinus_7.0:GL476503:58924:70125:-1 gene:ENSPMAG00000006577.1 transcript:ENSPMAT00000007308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.707 bits (696), Expect = 3.107e-83
Identity = 185/560 (33.04%), Postives = 295/560 (52.68%), Query Frame = 3
Query:  108 KSNKPKHEEIF--VNVIQSLNKLYTQKLFPLEKQYKFH-EFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLL----------EQDFPGIRIGPEPTTDKFIAIMFDEKEGTI-PGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKG----YEEKIRIVLNKCD-MVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQ--NLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQ-----------MIPKEQTAQNEFTNPVKGGAFEVQHDNP-FGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            +  +P+ E+    +   ++L +LY Q + P+E++Y FH  + ++ L   +FD+ P VLLLG  + GKT+ +RYLL           Q      + P   T     +   E  G++ PG+ALV++    F  L+ FG+  ++R     +  P+LES+  +DTPGI + E      G  +  ++ W  ER DR+ L+ DA +  +S+       L       +  K+R++L + D + +   L+R +GAL WSLG++L      RVY  +F D PL +D NR L E+ E+D   DLRSLPR + +R+LND I RARLA+ HA I+SAL  ++P L G+     EL+    L  + +   ++  +  GD P++E MQ  L   D      ++++L+  VD +L  D   L+            ++P  Q        P       V   +P  G    +G +       WA+++ K  Y+E FRSL PV G+++G +A+  L++++LP   L ++W+LSD+D DG LD DEF +A +LV   L   E+P  LP HL+PP+KR+
Sbjct:    6 RETQPQQEDEAERLPAARALARLYRQHVLPIERRYGFHVAYRAAELRDAEFDSPPTVLLLGAPAAGKTSLLRYLLGGPSSQQQQFLQQLQQGVLQPGSATTSVTIVQHGEAPGSVTPGHALVLEANSAFAGLAAFGSAAMSRVVRVQLPCPILESVTFVDTPGIPNDEIATGQHGTYYGGLLAWLCERADRVALVCDAPRPSVSERGALATALRSLRRHLHPHKLRVLLLRADELGEPGSLLRAHGALCWSLGRLLGRVSPPRVYAAAFRDGPLRWDWNRDLLEVNERDFMNDLRSLPRLAPLRRLNDVIARARLARAHACIVSALHSQLP-LFGRRAALTELVAQGGLAPVLEVAQQRWGLPVGDRPEMEPMQEWLMHCDMSFIRPMERRLLAAVDTLLQRDAPALLSRFRRRPRPSLLLLPGGQALPASSLGPFAEDLGFVSATSPTCGDDDGDGDDDASSPAPWALSEEKALYEELFRSLSPVRGRVSGASARLVLLRSRLPACALRRVWRLSDVDADGMLDSDEFTVANHLVAAALRGHELPRELPPHLVPPSKRD 564          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: srl (sarcalumenin [Source:ZFIN;Acc:ZDB-GENE-061110-91])

HSP 1 Score: 196.823 bits (499), Expect = 2.504e-56
Identity = 123/308 (39.94%), Postives = 169/308 (54.87%), Query Frame = 3
Query:  138 FVNVIQSLNKLYTQKLFPLEKQYKF-----HEF---HSSSLETGD---FDAKPMVLLLGQYSTGKTTFIRYLLEQD---FPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYII 1019
            F  ++  L K+Y   + PLE+ YK+     H+    H  S+ T D     AKP+VL LG +S GK++ I YLL  D   F     G EPTT +F  I    K   + G  +  D  R F  L KFG +FL +F    + + +LE +  +DTPGI+   KQ+  RGY F++V +WF +R D I ++FD  KLD+  E   +   LKG E +IRI+LNK D V +QQLMRVYGAL WSL  ++   E  RVY+ SFW      DTNR LF  EE  L +DLR +  N    K+    + A   ++HA ++
Sbjct:    1 FAGLLDRLKKIYHTSIKPLERIYKYDSIRQHDMTASHGRSISTFDESEIIAKPLVLFLGPWSVGKSSMINYLLGLDDKAFSLYTGGAEPTTSEFTVIRHGTKVKHLEGIVMATDGSRTFASLEKFGQSFLEKFSGVEMPHRLLERVTFVDTPGIIENRKQQ-QRGYPFNDVCQWFIDRGDLIFVVFDPTKLDVGLELETLFRQLKGRESQIRIILNKADSVSTQQLMRVYGALFWSLAPLINVTEPPRVYVSSFWPYAFRVDTNRGLFLAEETSLLDDLRQIIANRMENKIALIRQHAIRVRIHALVV 307          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004856.1 (pep scaffold:Pmarinus_7.0:GL476392:158221:184050:-1 gene:ENSPMAG00000004375.1 transcript:ENSPMAT00000004856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.878e-22
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 3
Query: 1314 PVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAV-AKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            PV    FE+  D+P  I   +G      D  WAV  + K ++D  + SL P NG ++G   K  L+ +KLP   LG++W LSDID DG LD+DEF++AMYLV   L+ E +P  LP  LIPP KR+
Sbjct:   97 PVPVPKFEL--DSPAMIAPPQGP-----DIPWAVKPEEKAKFDSIYDSLKPQNGLLSGEKVKPVLLNSKLPVETLGRVWDLSDIDRDGFLDRDEFSVAMYLVYRALEKEPVPLALPIKLIPPAKRK 215          

HSP 2 Score: 50.0618 bits (118), Expect = 9.786e-7
Identity = 26/67 (38.81%), Postives = 40/67 (59.70%), Query Frame = 3
Query: 1431 EYDETFRSLHP-VNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKL 1628
            +YDE F  L    +G++ G   K+  +KT L   +L +IW LSD    G L +D+F +AM+LV+ K+
Sbjct:  272 KYDEMFTKLDKDGDGQVTGLEVKEVFMKTGLSPAVLAQIWALSDTRQCGKLTRDQFGMAMHLVQEKI 338          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: EPS15L1 (epidermal growth factor receptor pathway substrate 15 like 1 [Source:HGNC Symbol;Acc:HGNC:24634])

HSP 1 Score: 97.4413 bits (241), Expect = 3.677e-21
Identity = 44/87 (50.57%), Postives = 58/87 (66.67%), Query Frame = 3
Query: 1425 KNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            K ++D  F SL P NG ++G   K  L+ + LP  +LGK+W LSDID DG LD+DEFA+AM+LV   LD E +P  +P  L+PP KR
Sbjct:  129 KTKFDGIFDSLGPANGLLSGEKVKPVLINSNLPMEVLGKVWDLSDIDKDGHLDRDEFAVAMHLVYRALDKEPVPSVIPPKLVPPAKR 215          

HSP 2 Score: 59.3066 bits (142), Expect = 2.369e-9
Identity = 38/109 (34.86%), Postives = 61/109 (55.96%), Query Frame = 3
Query: 1401 TEWAVAKF-KNEYDETF-RSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNE-EIPGTLPDHLIPPTKREIVFSRVAGDV 1718
            T W V    K +YDE F ++   ++G ++G   KD  +++ LP  +L +IW L+D    G L QD+FAL MYL+  K+    + P TL   ++PP++R +  +  A  V
Sbjct:  282 TTWVVTPADKIKYDEIFLKTDLDMDGLVSGLEVKDIFMQSGLPQAVLAQIWALADTRQQGKLTQDQFAL-MYLITQKVSKGVDPPVTLNADMMPPSERGVSTTDGASGV 389          

HSP 3 Score: 53.9138 bits (128), Expect = 1.076e-7
Identity = 30/82 (36.59%), Postives = 46/82 (56.10%), Query Frame = 3
Query: 1434 YDETFRSLHPVN-GKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPP 1676
            Y++ +R + P N G++  + A  +L K+ L    LGKIW L+D D  G LD+  F +A+ LV    +  EI  +   H+IPP
Sbjct:   19 YEKYYRLVDPGNNGRVGASEAALFLKKSGLSDLTLGKIWDLADADRKGWLDKQGFYVALRLVACAQNGHEIALSALSHVIPP 100          
BLAST of EH domain-containing protein 1 vs. Ensembl Yeast
Match: EDE1 (Scaffold protein involved in the formation of early endocytic sites; putative regulator of cytokinesis; homo-oligomerization is required for localization to and organization of endocytic sites; has a network of interactions with other endocytic proteins; binds membranes in a ubiquitin-dependent manner; may also bind ubiquitinated membrane-associated proteins; interacts with Cmk2 and functions upstream of CMK2 in regulating non-apoptotic cell death; homolog of mammalian Eps15 [Source:SGD;Acc:S000000143])

HSP 1 Score: 67.3958 bits (163), Expect = 6.194e-12
Identity = 48/156 (30.77%), Postives = 74/156 (47.44%), Query Frame = 3
Query: 1248 NDIAKLMQMIPKEQTAQNE-------FTNPVKGGAFEV-QHDNPFGIGASEGINRGKFD----TEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEI----PGTLPDHL 1667
            N+ +  ++MI + Q A N+        + P +  +F + Q+  P   G++ G N    D    +   +AKF   +D T +    V G      AKD  +K +LP   LG+IW L D D  G LD+ EF +AMYL++L + +       P  LP  L
Sbjct:   70 NEFSAALRMIAQLQNAPNQPISAALYESTPTQLASFSINQNPAPMQSGSATG-NTNNTDIPALSSNDIAKFSQLFDRTAKGAQTVAGD----KAKDIFLKARLPNQTLGEIWALCDRDASGVLDKSEFIMAMYLIQLCMSHHPSMNTPPAVLPTQL 220          
BLAST of EH domain-containing protein 1 vs. Ensembl Yeast
Match: PAN1 (Part of actin cytoskeleton-regulatory complex Pan1p-Sla1p-End3p; associates with actin patches on cell cortex; promotes protein-protein interactions essential for endocytosis; binds to and activates Arp2/3 complex in vitro; phosphorylation of Thr-1225 is regulated by MAPK Hog1p in response to osmotic stress; previously thought to be a subunit of poly(A) ribonuclease [Source:SGD;Acc:S000001445])

HSP 1 Score: 55.4546 bits (132), Expect = 2.791e-8
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 3
Query: 1440 ETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            ETF + +   G ++  TA +   K+ L    L +IW L DI+  G L++ EFAL M+LV  KL+ + IP  LP  LIP + +
Sbjct:  609 ETFDTQN--KGLLDSPTAVEIFRKSGLNRADLEQIWNLCDINNTGQLNKQEFALGMHLVYGKLNGKPIPNVLPSSLIPSSTK 688          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO49577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP8])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 329/530 (62.08%), Postives = 413/530 (77.92%), Query Frame = 3
Query:  111 SNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNP-VKGGAFEVQH--DNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREI 1691
            SNK +H ++F +V+  L K+Y + L P+E+ Y F++FHS S+   DF AKPMVLL+GQYSTGKTTFI+YLLEQDFPGIRIGPEPTTD FIA+M  + +  IPGNAL+VDP + FR LS FGN FL RF CS + N VL SI I+DTPGILSGEKQ + RGY F+ +++WFAER DRIILLFDAHKLDISDEF+R IE+L+ Y++KIRIVLNK DM+++QQLMRVYGALMWSLGKV+ TPEVARVYIGSFW+QPL  D NR+LFE+E  DLF D++ LPRN+ +RKLNDFI+RARLAKVHAYIIS L+ +MP++ GKD KK ELI+ L  +Y +I R+H+ISPGDFP + + +  L  HDF  F TL+ K IET+D MLA+DI +LM MIP E T  ++ + P V GGAF V H  +NPF  GA EG+  G     W V  FK +YDE F++L PV+GK++G  AK  +VK+KLP   LG+IWKLSDID DG LD+DEFALAMYL+++KL++ +IP  LP HL+PP+KR++
Sbjct:   10 SNK-RHPQVFASVVDGLKKMYMKNLKPMEEYYLFNDFHSPSMSEPDFHAKPMVLLVGQYSTGKTTFIKYLLEQDFPGIRIGPEPTTDSFIAVMHGDSQQVIPGNALIVDPNKQFRSLSSFGNAFLNRFCCSELPNDVLNSITIVDTPGILSGEKQSVARGYDFTGILKWFAERCDRIILLFDAHKLDISDEFQRGIEVLRDYDDKIRIVLNKADMINTQQLMRVYGALMWSLGKVINTPEVARVYIGSFWNQPLQMDDNRRLFEMEATDLFRDIQELPRNAALRKLNDFIKRARLAKVHAYIISELKSQMPSMFGKDKKKDELIKKLTDVYQKIQREHNISPGDFPPVSKFKEQLKQHDFTKFHTLRAKHIETLDHMLAHDIPRLMAMIPHETT--DDASKPSVSGGAFAVHHATNNPFASGACEGVALGAGTDTWVVEDFKPKYDELFKTLGPVDGKLSGAKAKKEMVKSKLPNTQLGRIWKLSDIDHDGCLDEDEFALAMYLIKVKLEDNDIPEELPVHLVPPSKRQL 536          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO43900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX50])

HSP 1 Score: 73.9442 bits (180), Expect = 1.572e-13
Identity = 36/94 (38.30%), Postives = 56/94 (59.57%), Query Frame = 3
Query: 1395 FDTEWAV-AKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIP 1673
             D +W +  + +  +D  F S +P NG ++G  A+   ++++LP   L KIWKL+D+  D  LD  EFA AM+L++L+L   +IP  LP  L P
Sbjct:    3 VDLKWIINEEERTRHDALFYSQNPENGFLSGEQARSLFIRSRLPLAELSKIWKLADVTRDNFLDVSEFATAMHLIQLRLKGFDIPEKLPSTLAP 96          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO47146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMS3])

HSP 1 Score: 68.5514 bits (166), Expect = 5.599e-12
Identity = 31/66 (46.97%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 1470 GKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHL 1667
            G   G  AK + +K+ LP  +LGKIW LSDID DG +   EF +AM+L++ KL   E P  LP+ L
Sbjct:    5 GSPQGEQAKQFFLKSNLPAMVLGKIWSLSDIDRDGKMTMQEFTIAMHLIQNKLKGTEPPSVLPNTL 70          

HSP 2 Score: 60.8474 bits (146), Expect = 1.297e-9
Identity = 33/90 (36.67%), Postives = 51/90 (56.67%), Query Frame = 3
Query: 1410 AVAKFKNEYDETFRSLH-PVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPP 1676
            +VA+ K  Y + F++      G ++G   +  L+++ LP   L  IWKLSD+D DG L+QDEF LAM+ V +      +P  +P  L+ P
Sbjct:  253 SVARLK--YTQMFKAQDFKQTGFLSGEQVRSMLIQSGLPQPSLALIWKLSDVDKDGQLNQDEFILAMHFVDMAKLGHTLPLVVPPELLTP 340          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO36122 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH7])

HSP 1 Score: 53.9138 bits (128), Expect = 1.324e-7
Identity = 55/211 (26.07%), Postives = 93/211 (44.08%), Query Frame = 3
Query:  267 VLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGN--NFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSF--SEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELL-KGYEEKIRIVLNKCDMV----DSQQ-LMRVYGALMWSLGKVLYTPEVARVYIGSFWDQP 869
            +L++G +S GK++FI + +E+     R G    T  F  +   +K  ++ GNA  +     F+PL +      +LT  + S  K      +  IDTPG++ G     D  Y F   E I W     D I + FD     +      ++E L +   E++R  L+K D      D Q+ LM++   L    G      ++  +Y+ +  D+P
Sbjct:   59 LLMIGNHSAGKSSFINWYIEEHIQ--RTGVAIETQGFTFVTSGKKRESLTGNA-TLHLYSHFKPLQEIEGVVEYLTT-EISTSKQKKFPLVTFIDTPGLVDG-----DMKYPFDVDEAIIWLGGLADLIFVFFDPIGQALCKRTLNLVEHLNEDQSERLRFYLSKADTAGHESDRQKVLMQITQELCKRPGLNKAGFDMPTIYVPTMLDKP 260          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd1a (EH domain-containing protein 1 [Source:NCBI gene;Acc:101158863])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 340/531 (64.03%), Postives = 418/531 (78.72%), Query Frame = 3
Query:  102 LFKSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 1694
            +F+    K  E+F NV + L +LY  KLFPLE  Y+FH+FHS +LE  DFD KPMVLL+GQYSTGKTTFIR+L+EQDFPG+RIGPEPTTD FIA+M  ++EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + N VLESI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +E+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYII+AL+ EMPA+ GK++KKKELI NL  IY R+ ++H+ISPGDFPK+E+MQ LL  HDF  F  LK KL+E V+DMLANDIA+LM ++ +E+   N  +  VKGGAFE     PFG G  EG + G  + EW V + K  YDE F +L P+NGK+ G  AK  +VK+KLP ++LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P +LPDHL+PP+KR  V
Sbjct:    1 MFRKTLKKDPELFQNVSEGLRRLYRTKLFPLEDTYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGDQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLVPDNRKLFEAEEQDLFVDIQSLPRNAALRKLNDLIKRARLAKVHAYIITALKKEMPAVFGKESKKKELITNLGEIYHRVEKEHNISPGDFPKLEKMQELLNGHDFTKFANLKPKLLEAVEDMLANDIARLMALVRQEEA--NMPSQSVKGGAFEGTMSGPFGHGYGEGASEGIDELEWVVGRDKPTYDEIFYTLSPINGKVTGAAAKKEMVKSKLPNSVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPASLPDHLVPPSKRGTV 529          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd3 (EH domain-containing protein 3 [Source:NCBI gene;Acc:101160952])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 340/526 (64.64%), Postives = 414/526 (78.71%), Query Frame = 3
Query:  117 KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 1694
            + K  E+F  V + L KLY  KL PLE+ YKFHEFHS +LE  DFD KPMVLL+GQYSTGKT+FIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVLESI++IDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIISAL+ EMP++ GK+NKKKELI +L  IY RI R+H ISPGDFP +++MQ+LL D D   F  LK KL+E VDDMLA+DIA LM ++ +E++ +    + VKGGAF+   + PFG G  EG   G  + EW VA+ K  YDE F +L PVNGK+ G  AK  +VK+KLP  +LGKIWKL+DID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR+I 
Sbjct:   11 RKKDPEVFQTVSEGLKKLYKTKLLPLEESYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDTEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPSVFGKENKKKELIASLGDIYKRIEREHQISPGDFPNLKKMQDLLQDQDLTRFQALKPKLLEAVDDMLASDIASLMVLVRQEESQRP--NSAVKGGAFDGTLNGPFGHGYGEGAGEGIDEAEWVVARDKPAYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLVPPSKRKIA 534          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd4 (EH domain-containing protein 4 [Source:NCBI gene;Acc:101167502])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 327/523 (62.52%), Postives = 400/523 (76.48%), Query Frame = 3
Query:  123 KHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNP-VKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKRE 1688
            K  E++  V + L  LY++KL PLE+ Y FH+FHS +LE  DF +KPMVLL+GQYSTGKTTFIRYLLEQDFPG+RIGPEPTTD FIA+M+ E EG +PGNALVVD K+PFR L+ FGN FL RF CS + N VL+SI+IIDTPGILSGEKQR+ RGY F+EV+ WF ERVDRIILLFDAHKLDISDEF   I  LKG ++KIR+VLNK D VD+QQLMRVYGALMWSLGKV+ TPEV RVY+GSFW +PL    NR+LFE E +DLF D++SLPRN+ +RKLND I+RARLAKVHAYIIS L+ EMP L G++ KK+ELI  L  IY  + R+H IS GDFP + +MQ++L  +DF  FP+LK KLIE+VD MLA  IA LM MI +E++ Q     P V GGAFE   D PFG G  EGI+ G    +W V++ K+ YDE F +L PVNGKI G  AK  ++ ++LP  +LGKIWKL+D D DG LD DEFALA +L+++KL+  E+P  LPDHL+PP+ R+
Sbjct:   14 KEGEMYQTVTEGLQTLYSKKLLPLEETYLFHDFHSPALEPADFQSKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDGFIAVMYGENEGVVPGNALVVDSKKPFRKLNAFGNAFLNRFICSQMPNQVLQSISIIDTPGILSGEKQRISRGYDFAEVLRWFGERVDRIILLFDAHKLDISDEFSEAIRALKGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVVRVYLGSFWAKPLQNTENRRLFEAESQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISYLKKEMPTLFGREKKKEELIMRLPEIYTILQREHHISAGDFPNVNKMQDMLQHYDFHKFPSLKMKLIESVDKMLATKIAVLMAMIREEESKQ---PAPFVSGGAFEGSQDGPFGQGYGEGISAGADAEDWIVSRDKHRYDEIFYTLMPVNGKITGVNAKKEMMNSRLPNTVLGKIWKLADCDQDGMLDDDEFALAQHLIKIKLEGYELPSELPDHLVPPSHRK 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd3 (EH domain-containing protein 3 [Source:NCBI gene;Acc:101160952])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 340/542 (62.73%), Postives = 414/542 (76.38%), Query Frame = 3
Query:  117 KPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDR----------------GYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 1694
            + K  E+F  V + L KLY  KL PLE+ YKFHEFHS +LE  DFD KPMVLL+GQYSTGKT+FIRYLLEQDFPG+RIGPEPTTD FIA+M  + EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + NPVLESI++IDTPGILSGEKQR+ R                GY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +E+KIR+VLNK D +++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE+DLF+D++SLPRN+ +RKLND I+RARLAKVHAYIISAL+ EMP++ GK+NKKKELI +L  IY RI R+H ISPGDFP +++MQ+LL D D   F  LK KL+E VDDMLA+DIA LM ++ +E++ +    + VKGGAF+   + PFG G  EG   G  + EW VA+ K  YDE F +L PVNGK+ G  AK  +VK+KLP  +LGKIWKL+DID DG LD +EFALA +L+++KL+  E+P  LP HL+PP+KR+I 
Sbjct:   11 RKKDPEVFQTVSEGLKKLYKTKLLPLEESYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDTEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRDKEMSGYSCLHRCPYGGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPSVFGKENKKKELIASLGDIYKRIEREHQISPGDFPNLKKMQDLLQDQDLTRFQALKPKLLEAVDDMLASDIASLMVLVRQEESQRP--NSAVKGGAFDGTLNGPFGHGYGEGAGEGIDEAEWVVARDKPAYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLVPPSKRKIA 550          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd1a (EH domain-containing protein 1 [Source:NCBI gene;Acc:101158863])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 322/531 (60.64%), Postives = 397/531 (74.76%), Query Frame = 3
Query:  102 LFKSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 1694
            +F+    K  E+F NV + L +LY  KLFPLE  Y+FH+FHS +LE  DFD KPM                     DFPG+RIGPEPTTD FIA+M  ++EG IPGNALVVDPK+PFR L+ FGN FL RF C+ + N VLESI+IIDTPGILSGEKQR+ RGY F+ V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +E+K+R+VLNK D + +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE+DLF D++SLPRN+ +RKLND I+RARLAKVHAYII+AL+ EMPA+ GK++KKKELI NL  IY R+ ++H+ISPGDFPK+E+MQ LL  HDF  F  LK KL+E V+DMLANDIA+LM ++ +E+   N  +  VKGGAFE     PFG G  EG + G  + EW V + K  YDE F +L P+NGK+ G  AK  +VK+KLP ++LGKIWKL+D+D DG LD +EFALA +L+++KL+  E+P +LPDHL+PP+KR  V
Sbjct:    1 MFRKTLKKDPELFQNVSEGLRRLYRTKLFPLEDTYRFHDFHSPALEDADFDNKPM---------------------DFPGMRIGPEPTTDSFIAVMHGDQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLVPDNRKLFEAEEQDLFVDIQSLPRNAALRKLNDLIKRARLAKVHAYIITALKKEMPAVFGKESKKKELITNLGEIYHRVEKEHNISPGDFPKLEKMQELLNGHDFTKFANLKPKLLEAVEDMLANDIARLMALVRQEEA--NMPSQSVKGGAFEGTMSGPFGHGYGEGASEGIDELEWVVGRDKPTYDEIFYTLSPINGKVTGAAAKKEMVKSKLPNSVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPASLPDHLVPPSKRGTV 508          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000026849.1 (SMESG000026849.1)

HSP 1 Score: 1079.7 bits (2791), Expect = 0.000e+0
Identity = 542/543 (99.82%), Postives = 542/543 (99.82%), Query Frame = 3
Query:   96 MNLFKSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIVFSRVAGDVDK 1724
            MNLFKSNKPKHEEIFVNVIQSLNKLYTQKL PLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRKLFELEEKDLFEDLRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIVFSRVAGDVDK
Sbjct:    1 MNLFKSNKPKHEEIFVNVIQSLNKLYTQKLLPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRKLFELEEKDLFEDLRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIVFSRVAGDVDK 543          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000001303.1 (SMESG000001303.1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 399/534 (74.72%), Postives = 463/534 (86.70%), Query Frame = 3
Query:   96 MNLFKSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQT-AQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 1694
            M++FKSNK K E+ + NVI+ L  LY  KL PLEK Y+FH+FHS  LE GDFDAKPMV+LLGQYSTGKTTFIRY+LE+DFPG+RIGPEPTTD F+++M  +K G IPGNALVVD KR FRPLSKFGNNFL RFQC  + NPVL++I  IDTPGILSGEKQRLDRGY+F +VIEWFAERVDRIILLFDAHKLDISDEF+RVIELLKGYE+KIRIVLNK D +DSQQLMRVYGALMWSLGKVLYTPEV RVYIGSFWDQPLH+DTNRKLFELEE DL  DL+SLP N+ +RKLND I+RARLAKVHAYIIS+L+++MP+L+GK++KKKELI NLQ  YD+IS+++SIS GDFPKI+RMQ +L D DFK F  LK KLIE VD+MLAND+AKLMQMIPKEQ+ +  +F + VKGGAF+VQ DN FGIGAS+GIN+GKFD +W V + + EYDE F+SL+P NGKINGT AK+Y++KTKLPYNILGKIWKLSD+DLDG LD DEFALA YL+ LKL+ EEIP TLPDHL+PP+KR IV
Sbjct:    1 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPSLLGKESKKKELISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIV 534          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000006379.1 (SMESG000006379.1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 320/520 (61.54%), Postives = 405/520 (77.88%), Query Frame = 3
Query:  147 VIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGT--IPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRXXXXXXXXXXXXXXRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTAQNEF-TNPVKGGAFE-VQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 1694
            V+  L KLYT+KL PLEK YKF  FHSS ++  DF AKP+VLL+GQYSTGKTTFIRYLLE+DFPGIRIGPEPTTD+F+ IM  ++  +  IPG A V D K PF+ L+KFGN+FL RFQCSM+ N VL+SI +IDTPGILSGEKQR+DRGY +++VI+WFA+RVDRIILLFDAHKLDISDEF+R I++LK Y+ KIRI+LNK DM++SQQLM+VYGAL+WSLGKVL TPEV RV++GS+WDQPL FD +RKLF+LEE++L  DL++LP N+ +RK+ND IRRARLAKVHA+IIS L+  MP LI K+ KK+ELI +L  ++ R++  H +S GDFPK++ MQ  L D DF    +LKQKLI+ VD+MLA DI  L+Q IP + T +N+F    VKGGAF  +  +NPF       IN+GKF+T W V +F++ Y+E F SL P NG + G   +D+L+KTKLP  +L ++WKLSD+D DG LD DEFALA YLV+LKL  +E+P  LP HLIPP+K  I+
Sbjct:   14 VLADLYKLYTRKLLPLEKTYKFDYFHSSIMDEADFSAKPLVLLIGQYSTGKTTFIRYLLEEDFPGIRIGPEPTTDRFVVIMHSDQGSSTVIPGQAAVTDAKLPFKGLNKFGNSFLNRFQCSMLPNDVLKSITLIDTPGILSGEKQRVDRGYDYTQVIDWFAQRVDRIILLFDAHKLDISDEFKRTIDVLKSYDNKIRIILNKADMINSQQLMKVYGALLWSLGKVLSTPEVPRVFMGSYWDQPLQFDDSRKLFQLEEEELMNDLKNLPLNAAIRKINDLIRRARLAKVHAFIISHLKQNMPYLIRKEKKKQELISSLDEVFHRLATVHQVSEGDFPKVKSMQEQLIDTDFSQLSSLKQKLIDQVDNMLAVDIPILLQKIP-QITEENDFGKKTVKGGAFNAINEENPFQ-RVEIAINKGKFETNWVVEEFQSNYNEIFNSLEPRNGLLTGQQVRDHLLKTKLPVPVLSRVWKLSDLDGDGFLDCDEFALASYLVKLKLSGDELPNELPKHLIPPSKVNIL 531          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000037239.1 (SMESG000037239.1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.423e-18
Identity = 43/94 (45.74%), Postives = 61/94 (64.89%), Query Frame = 3
Query: 1407 WAVAKFKN-EYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKR 1685
            WA++  +   Y + F SL+PVN K++G   K   + +KL    LG+IW L+DID DG LD++EF LAM+ +   L NEE+P TLP + IP +KR
Sbjct:  122 WAISNDEQARYSKVFESLNPVNNKLSGDAVKPVFLNSKLSVPTLGQIWTLADIDADGYLDREEFCLAMHFIYKCLANEELPKTLPINFIPLSKR 215          

HSP 2 Score: 66.2402 bits (160), Expect = 6.041e-11
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 3
Query: 1389 GKFDTEWAVAKFKNE-YDETFRSLHP-VNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLD---NEEIPGTLPDHLIPPTKR 1685
            G   ++W + K + E YD  F +     +G ++G   KD  V++ LP   L KIW L DI+  G L+ ++FALAMYL+  ++    ++ IP +L   +IPP+ R
Sbjct:  247 GSSSSDWVIGKLEKERYDNLFFAADKDKDGFVSGLEIKDTFVQSGLPQTELAKIWDLCDINKTGLLNSEQFALAMYLINQQISSAGSKPIPSSLALDMIPPSLR 350          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000066021.1 (SMESG000066021.1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.617e-16
Identity = 38/83 (45.78%), Postives = 56/83 (67.47%), Query Frame = 3
Query: 1425 KNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIP 1673
            K ++D  F+ L+PVNG I G  AK    K+ LP ++LG+IW L+D D DG ++ +EFA+AM+L++ KL+  E+P  LP  L P
Sbjct:   15 KVKFDVQFQCLNPVNGFITGNQAKSLFTKSNLPTDVLGRIWFLADYDKDGCMNSNEFAIAMHLIKRKLEGYELPDVLPLSLNP 97          

HSP 2 Score: 67.0106 bits (162), Expect = 4.607e-11
Identity = 32/86 (37.21%), Postives = 50/86 (58.14%), Query Frame = 3
Query: 1470 GKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPT--KREIVFSRVAGDVD 1721
            G + G  AK  LV++ LP   L  IW L+DID DG L  +EF +AM+LV       ++P  LP  L+PP+  K+ I+ + ++  ++
Sbjct:  227 GFLTGVEAKAILVQSGLPNTSLASIWSLADIDQDGNLTCEEFCIAMHLVEQARSGRQLPNQLPQSLLPPSLQKKNILGTSMSASMN 312          
The following BLAST results are available for this feature:
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EHD10.000e+064.00EH domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
EHD10.000e+064.00EH domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
EHD10.000e+064.00EH domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
EHD30.000e+064.89EH domain containing 3 [Source:HGNC Symbol;Acc:HGN... [more]
EHD40.000e+061.94EH domain containing 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rme-10.000e+064.47Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+064.47Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+062.46Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+064.47Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+064.47Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Past10.000e+066.92gene:FBgn0016693 transcript:FBtr0082654[more]
Past10.000e+066.92gene:FBgn0016693 transcript:FBtr0082655[more]
CG92972.132e-3831.28gene:FBgn0038181 transcript:FBtr0082827[more]
CG92972.228e-3831.28gene:FBgn0038181 transcript:FBtr0333192[more]
CG92972.228e-3831.28gene:FBgn0038181 transcript:FBtr0082828[more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1a0.000e+064.56EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd1b0.000e+064.33EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd1b0.000e+064.33EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd1b0.000e+064.33EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd30.000e+064.76EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+064.57dual specificity tyrosine phosphorylation regulate... [more]
nfe2l20.000e+064.64nuclear factor, erythroid 2 like 2 [Source:Xenbase... [more]
dyrk20.000e+064.69dual specificity tyrosine phosphorylation regulate... [more]
dyrk20.000e+062.66dual specificity tyrosine phosphorylation regulate... [more]
ehd40.000e+063.57EH domain containing 4 [Source:NCBI gene;Acc:10012... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ehd10.000e+064.00EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd10.000e+064.00EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd30.000e+064.38EH-domain containing 3 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd40.000e+062.14EH-domain containing 4 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd20.000e+059.85EH-domain containing 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBP4|EHD1_PONAB0.000e+064.00EH domain-containing protein 1 OS=Pongo abelii OX=... [more]
sp|Q9H4M9|EHD1_HUMAN0.000e+064.00EH domain-containing protein 1 OS=Homo sapiens OX=... [more]
sp|Q641Z6|EHD1_RAT0.000e+064.00EH domain-containing protein 1 OS=Rattus norvegicu... [more]
sp|Q9WVK4|EHD1_MOUSE0.000e+064.00EH domain-containing protein 1 OS=Mus musculus OX=... [more]
sp|Q5E9R3|EHD1_BOVIN0.000e+064.00EH domain-containing protein 1 OS=Bos taurus OX=99... [more]
back to top
BLAST of EH domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8X9A10.000e+068.49Dynamin family protein OS=Opisthorchis viverrini O... [more]
A0A4S2M9B90.000e+068.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YAU00.000e+068.16EH domain-containing protein 3 OS=Clonorchis sinen... [more]
A0A075A2820.000e+068.49Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4V3SGP00.000e+068.11Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1a0.000e+063.76EH domain-containing protein 1-like [Source:NCBI g... [more]
ehd30.000e+062.27EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ehd1b0.000e+062.17EH domain-containing protein 1-like [Source:NCBI g... [more]
ehd1b0.000e+062.10EH domain-containing protein 1-like [Source:NCBI g... [more]
ehd40.000e+060.83EH domain-containing protein 4 [Source:NCBI gene;A... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1a1.878e-16360.89EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000007308.13.107e-8333.04pep scaffold:Pmarinus_7.0:GL476503:58924:70125:-1 ... [more]
srl2.504e-5639.94sarcalumenin [Source:ZFIN;Acc:ZDB-GENE-061110-91][more]
ENSPMAT00000004856.12.878e-2244.44pep scaffold:Pmarinus_7.0:GL476392:158221:184050:-... [more]
EPS15L13.677e-2150.57epidermal growth factor receptor pathway substrate... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
EDE16.194e-1230.77Scaffold protein involved in the formation of earl... [more]
PAN12.791e-839.02Part of actin cytoskeleton-regulatory complex Pan1... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO495770.000e+062.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439001.572e-1338.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471465.599e-1246.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361221.324e-726.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1a0.000e+064.03EH domain-containing protein 1 [Source:NCBI gene;A... [more]
ehd30.000e+064.64EH domain-containing protein 3 [Source:NCBI gene;A... [more]
ehd40.000e+062.52EH domain-containing protein 4 [Source:NCBI gene;A... [more]
ehd30.000e+062.73EH domain-containing protein 3 [Source:NCBI gene;A... [more]
ehd1a0.000e+060.64EH domain-containing protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026849.10.000e+099.82SMESG000026849.1[more]
SMESG000001303.10.000e+074.72SMESG000001303.1[more]
SMESG000006379.10.000e+061.54SMESG000006379.1[more]
SMESG000037239.13.423e-1845.74SMESG000037239.1[more]
SMESG000066021.11.617e-1645.78SMESG000066021.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033179 ID=SMED30033179|Name=EH domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2059bp
TGTGACTGAAAAAATTTTTGAGTCAATTTTAGTATTTCAGTTGCAATCAT
TTTTCTTGTAAAATTATTGAGGGAAGAAATTGAAAAATTTTTAAAATGAA
TTTATTCAAATCTAACAAACCGAAACATGAAGAAATTTTTGTTAATGTCA
TACAAAGTCTGAACAAGTTATACACTCAAAAGCTGTTTCCTTTAGAAAAA
CAATATAAATTTCATGAATTTCATTCTTCATCTTTGGAGACCGGTGATTT
TGATGCAAAACCGATGGTTCTGTTGTTGGGTCAATATTCAACGGGTAAAA
CAACATTTATCCGATATCTGCTAGAACAAGATTTCCCCGGCATTCGTATT
GGTCCAGAGCCAACAACAGACAAGTTTATCGCAATAATGTTTGACGAAAA
AGAGGGCACTATACCTGGTAACGCATTAGTTGTTGACCCGAAGCGGCCAT
TTCGTCCTCTATCGAAATTTGGAAATAATTTTCTCACTCGATTTCAATGT
TCAATGATTAAAAATCCAGTGTTGGAATCGATCAATATTATTGACACGCC
GGGAATTCTCAGTGGTGAAAAACAGCGATTGGATAGAGGCTATAGCTTCT
CTGAGGTAATCGAATGGTTTGCGGAACGAGTGGACAGAATTATTCTTCTT
TTTGATGCTCACAAATTGGATATATCCGATGAATTTCGCCGAGTTATTGA
ACTATTAAAGGGTTATGAAGAAAAAATTCGAATTGTTCTCAACAAATGTG
ACATGGTCGACAGTCAGCAATTGATGCGAGTTTATGGAGCATTAATGTGG
AGCTTGGGGAAAGTCCTTTACACCCCGGAAGTAGCTCGAGTTTATATTGG
ATCTTTTTGGGATCAACCGCTTCATTTCGATACCAATCGGAAATTGTTTG
AATTAGAGGAAAAGGATTTATTTGAGGATTTGCGATCTTTGCCCAGAAAT
TCTACAGTTCGGAAATTAAATGATTTTATTCGTCGGGCCAGATTGGCTAA
GGTACACGCTTACATTATCAGTGCTCTTCGTGATGAAATGCCCGCTCTGA
TAGGAAAAGACAATAAAAAGAAAGAATTAATACAAAACCTTCAAGGAATA
TACGACAGAATATCTCGACAGCATAGTATTTCTCCAGGCGACTTTCCGAA
AATAGAGCGAATGCAGAATCTGTTGCCAGATCACGATTTCAAAGCCTTTC
CTACATTGAAACAGAAATTAATTGAGACTGTAGATGACATGCTAGCCAAC
GATATTGCCAAGCTAATGCAAATGATTCCAAAAGAACAAACCGCCCAAAA
TGAATTTACAAATCCAGTGAAAGGAGGTGCATTCGAGGTACAGCATGACA
ACCCGTTTGGAATCGGTGCAAGTGAAGGTATCAACCGTGGCAAATTTGAC
ACCGAATGGGCCGTTGCCAAGTTTAAAAATGAATACGATGAAACCTTCAG
AAGCTTGCATCCAGTCAATGGGAAAATCAACGGCACTACTGCTAAAGATT
ATCTTGTCAAAACGAAATTACCATACAACATCCTGGGGAAAATATGGAAA
TTATCGGATATCGATTTGGATGGTGCTCTTGATCAGGATGAATTTGCTCT
TGCTATGTATTTGGTACGGTTGAAACTAGACAATGAAGAAATTCCAGGAA
CGCTTCCAGATCATCTTATTCCTCCAACAAAGAGGGAAATCGTGTTTTCT
CGCGTTGCAGGCGATGTCGATAAATAATTTTAAATCAGATGTATTGTCTT
GACCGTGCTGTCATCTGTATTCGATTGGATATAATTATACAGATTACATA
TTTCACATTGATTCATATATCCAATCAAACTTTATTGTGCCTGATTTTTG
ATTATTTTGTCATTATTGATTATCGCGTGGGTGCGGCAGATGTGTTTACG
CTTGGCCCAATGCTGGGCTGCCACAATATTGCTTTATCAGCAAATGCTTT
GATTTTTGTGAGAGAATAAATGTTTATAAACTGGTGGTAATTATATTTGT
GGTTATTCTCGGGAATTGGGGGCCATTTGGGGTTTTAAATTTGTGATTTT
GAAATTTAT
back to top

protein sequence of SMED30033179-orf-1

>SMED30033179-orf-1 ID=SMED30033179-orf-1|Name=SMED30033179-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=544bp
MNLFKSNKPKHEEIFVNVIQSLNKLYTQKLFPLEKQYKFHEFHSSSLETG
DFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFD
EKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIID
TPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRV
IELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVY
IGSFWDQPLHFDTNRKLFELEEKDLFEDLRSLPRNSTVRKLNDFIRRARL
AKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDF
PKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQTA
QNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDET
FRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEF
ALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIVFSRVAGDVDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032456endocytic recycling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040990DUF5600
IPR029952EHD4
IPR000261EH_dom
IPR031692EHD_N
IPR022812Dynamin_SF
IPR011992EF-hand-dom_pair
IPR027417P-loop_NTPase
IPR002048EF_hand_dom
IPR030381G_DYNAMIN_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0005525GTP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000261EH domainSMARTSM00027eh_3coord: 437..530
e-value: 1.1E-32
score: 124.5
IPR000261EH domainPFAMPF12763EF-hand_4coord: 445..534
e-value: 1.4E-17
score: 63.6
IPR000261EH domainPROSITEPS50031EHcoord: 443..531
score: 22.377
IPR000261EH domainCDDcd00052EHcoord: 447..511
e-value: 2.48693E-20
score: 82.6526
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 58..282
e-value: 3.4E-160
score: 534.7
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 431..532
e-value: 1.7E-29
score: 103.5
NoneNo IPR availableGENE3DG3DSA:1.10.268.20coord: 21..383
e-value: 3.4E-160
score: 534.7
NoneNo IPR availablePANTHERPTHR11216EH DOMAINcoord: 6..532
NoneNo IPR availableCDDcd09913EHDcoord: 57..297
e-value: 4.62248E-159
score: 450.957
IPR040990Domain of unknown function DUF5600PFAMPF18150DUF5600coord: 285..391
e-value: 2.0E-41
score: 140.9
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 58..217
e-value: 1.2E-12
score: 48.3
IPR031692EH domain-containing protein, N-terminalPFAMPF16880EHD_Ncoord: 22..53
e-value: 1.6E-13
score: 50.3
IPR029952EH domain-containing protein 4PANTHERPTHR11216:SF57EH DOMAIN-CONTAINING PROTEIN 4coord: 6..532
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 475..510
score: 9.157
IPR030381Dynamin-type guanine nucleotide-binding (G) domainPROSITEPS51718G_DYNAMIN_2coord: 52..283
score: 41.322
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 48..301
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 444..530