SMED30033165

Overview
NameSMED30033165
Smed IDSMED30033165
Length (bp)400
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033165

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033165SMESG000069527.1 SmedASXL_001004SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033165SMESG000069526.1 SmedASXL_038544SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033165 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006139:27898..30189 +1870
Homology
BLAST of SMED30033165 vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 67.0106 bits (162), Expect = 2.426e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 66.6254 bits (161), Expect = 2.800e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 66.6254 bits (161), Expect = 2.827e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 66.6254 bits (161), Expect = 2.828e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  543 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 619          
BLAST of SMED30033165 vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 66.6254 bits (161), Expect = 2.981e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  543 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 619          
BLAST of SMED30033165 vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 68.5514 bits (166), Expect = 2.504e-14
Identity = 31/89 (34.83%), Postives = 55/89 (61.80%), Query Frame = -3
Query:    3 FSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 269
            F+V +E  +   +W  + AF+ QG D  P A+S R   + WW FT++I S+Y+A+L ++LT++     I+S ++L+N+ +I   + EG 
Sbjct:  588 FTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGG 676          
BLAST of SMED30033165 vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 68.5514 bits (166), Expect = 2.594e-14
Identity = 31/89 (34.83%), Postives = 55/89 (61.80%), Query Frame = -3
Query:    3 FSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 269
            F+V +E  +   +W  + AF+ QG D  P A+S R   + WW FT++I S+Y+A+L ++LT++     I+S ++L+N+ +I   + EG 
Sbjct:  657 FTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGG 745          
BLAST of SMED30033165 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 67.3958 bits (163), Expect = 6.750e-14
Identity = 35/95 (36.84%), Postives = 58/95 (61.05%), Query Frame = -3
Query:    3 NLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKI-VLAEGA 284
            N K  F+V++        W  +G+ + QG D  P A ++R +  VWWMFT +I S+Y+A L ++LTV+     I+S Q+L+N+++I+  VL  G+
Sbjct:  576 NQKNQFTVLNSF------WFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGS 664          
BLAST of SMED30033165 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 67.3958 bits (163), Expect = 7.384e-14
Identity = 35/95 (36.84%), Postives = 58/95 (61.05%), Query Frame = -3
Query:    3 NLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKI-VLAEGA 284
            N K  F+V++        W  +G+ + QG D  P A ++R +  VWWMFT +I S+Y+A L ++LTV+     I+S Q+L+N+++I+  VL  G+
Sbjct:  576 NQKNQFTVLNSF------WFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGS 664          
BLAST of SMED30033165 vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 64.3142 bits (155), Expect = 8.371e-13
Identity = 32/110 (29.09%), Postives = 63/110 (57.27%), Query Frame = -3
Query:    3 YLLSLLSPLSAWNL----KLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 320
            +L+S  SP   W +    +  F++ ++  +   +W  + AF+ QG D  P ++S R   + WW FT++I S+Y+A+L ++LT++     I+S ++L+ + +IK  +  G 
Sbjct:  610 FLVSRFSPYE-WRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGG 718          
BLAST of SMED30033165 vs. Ensembl Fly
Match: GluRIID (gene:FBgn0028422 transcript:FBtr0083938)

HSP 1 Score: 71.2478 bits (173), Expect = 3.809e-15
Identity = 32/102 (31.37%), Postives = 64/102 (62.75%), Query Frame = -3
Query:   30 YLLSLLSPLSAWN-----LKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKE 320
            +++  LSP+  W+     ++ P  + ++  I   +W   GA L QG +  P A+S+RT+ A+WW FT+++ S+Y+A+L ++LT+++    I S ++L++ K+
Sbjct:  566 FIIGRLSPIE-WDNPYPCIEEPEELENQFTINNSLWFTTGALLQQGSEIAPKALSTRTISAIWWFFTLIMVSSYTANLAAFLTIENPTSPINSVKDLADNKD 666          
BLAST of SMED30033165 vs. Ensembl Fly
Match: GluRIIE (gene:FBgn0051201 transcript:FBtr0110837)

HSP 1 Score: 68.9366 bits (167), Expect = 2.516e-14
Identity = 33/102 (32.35%), Postives = 61/102 (59.80%), Query Frame = -3
Query:   30 YLLSLLSPLSAWN-----LKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKE 320
            ++L  LSP S W+     ++ P  + ++  +   +W   GA L QG +  P A+S+RTV + WW FT+++ S+Y+A+L ++LT++     I S  +L++ K+
Sbjct:  568 FILGRLSP-SEWDNPYPCIEEPEELENQFTLGNSIWFTTGALLQQGSEIGPKALSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSLINSVDDLADNKD 668          
BLAST of SMED30033165 vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 67.3958 bits (163), Expect = 8.005e-14
Identity = 28/77 (36.36%), Postives = 50/77 (64.94%), Query Frame = -3
Query:    3 VWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 233
            +W  +G+ + QG DF P A+S+R V  +WW FT+++ S+Y+A+L ++LTV+     I+S ++L+ +  IK    +G 
Sbjct:  595 MWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGG 671          
BLAST of SMED30033165 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089194)

HSP 1 Score: 63.5438 bits (153), Expect = 1.579e-12
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = -3
Query:    3 SVIDEIRIREHV------WNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 266
            + +D +RI+ +       W  +GA + QG D YP A S+R V   W+ F ++I S+Y+A+L ++LTV+     I+S  +L+ + EI     EG 
Sbjct:  751 NTVDLVRIQNNFTLKNSFWFAIGALMQQGSDLYPRATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGG 844          
BLAST of SMED30033165 vs. Ensembl Fly
Match: Grik (gene:FBgn0038840 transcript:FBtr0083978)

HSP 1 Score: 62.3882 bits (150), Expect = 4.220e-12
Identity = 34/101 (33.66%), Postives = 57/101 (56.44%), Query Frame = -3
Query:   33 YLLSLLSPLSAWN-----LKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRK 320
            ++L  LSP + W+     ++ P  + ++      +W  +GA L QG +  P A S+R V A WW FT+++ S+Y+A+L ++LTV+S    I    +LS  K
Sbjct:  560 FVLGRLSP-AEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANLAAFLTVESLVTPINDADDLSKNK 659          
BLAST of SMED30033165 vs. Ensembl Zebrafish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 69.3218 bits (168), Expect = 2.335e-14
Identity = 39/107 (36.45%), Postives = 61/107 (57.01%), Query Frame = -3
Query:   27 YLLSLLSPLSAWNLKLPFSVID---------EIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 320
            +L+S  SP   W+ + P    D         E  I   +W  +GAF+ QG DF P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  557 FLVSRFSPYE-WHTEEPEEGSDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 662          
BLAST of SMED30033165 vs. Ensembl Zebrafish
Match: si:ch211-264f5.8 (si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-209])

HSP 1 Score: 68.5514 bits (166), Expect = 3.240e-14
Identity = 38/114 (33.33%), Postives = 63/114 (55.26%), Query Frame = -3
Query:    3 YLLSLLSPLSAWNLKLPFSVIDEIR--------IREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 320
            +L + LSP   +N   PF    E R        +   +W  +G F+ QG +  P A+S+R V  VWW FT++I S+Y+A+L ++LTVQ     I+S ++L+++  I+    +G 
Sbjct:   13 FLAARLSPYEWYN---PFPCWRERRDLLENQYTLGNSLWFPIGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESAEDLADQTNIQYGTIQGG 123          
BLAST of SMED30033165 vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 67.3958 bits (163), Expect = 1.086e-13
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = -3
Query:   27 PFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 272
            P    +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  577 PSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 658          
BLAST of SMED30033165 vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 67.3958 bits (163), Expect = 1.100e-13
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = -3
Query:   27 PFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 272
            P    +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  581 PSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 662          
BLAST of SMED30033165 vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 67.3958 bits (163), Expect = 1.100e-13
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = -3
Query:   27 PFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 272
            P    +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  581 PSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 662          
BLAST of SMED30033165 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:Xenbase;Acc:XB-GENE-976035])

HSP 1 Score: 67.0106 bits (162), Expect = 2.091e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  572 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 648          
BLAST of SMED30033165 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:Xenbase;Acc:XB-GENE-976035])

HSP 1 Score: 67.0106 bits (162), Expect = 2.199e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  607 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 683          
BLAST of SMED30033165 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:Xenbase;Acc:XB-GENE-976035])

HSP 1 Score: 67.0106 bits (162), Expect = 2.293e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  547 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 623          
BLAST of SMED30033165 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:Xenbase;Acc:XB-GENE-976035])

HSP 1 Score: 67.0106 bits (162), Expect = 2.296e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  558 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 634          
BLAST of SMED30033165 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:Xenbase;Acc:XB-GENE-976035])

HSP 1 Score: 67.0106 bits (162), Expect = 2.371e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  585 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 661          
BLAST of SMED30033165 vs. Ensembl Mouse
Match: Gria2 (glutamate receptor, ionotropic, AMPA2 (alpha 2) [Source:MGI Symbol;Acc:MGI:95809])

HSP 1 Score: 67.0106 bits (162), Expect = 1.707e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. Ensembl Mouse
Match: Gria2 (glutamate receptor, ionotropic, AMPA2 (alpha 2) [Source:MGI Symbol;Acc:MGI:95809])

HSP 1 Score: 67.0106 bits (162), Expect = 1.832e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. Ensembl Mouse
Match: Gria2 (glutamate receptor, ionotropic, AMPA2 (alpha 2) [Source:MGI Symbol;Acc:MGI:95809])

HSP 1 Score: 67.0106 bits (162), Expect = 1.849e-13
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 66.2402 bits (160), Expect = 3.065e-13
Identity = 31/77 (40.26%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  591 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 667          
BLAST of SMED30033165 vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 66.2402 bits (160), Expect = 3.065e-13
Identity = 31/77 (40.26%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  591 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 667          
BLAST of SMED30033165 vs. UniProt/SwissProt
Match: sp|P26591|GLRK_LYMST (Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.199e-13
Identity = 37/101 (36.63%), Postives = 62/101 (61.39%), Query Frame = -3
Query:   24 YLLSLLSPLSAWNLKLPFS--VIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIK 320
            +L+S  SP + W+L       + ++  I   +W  +GAF+ QG D  P +MS R V +VWW FT++I S+Y+A+L ++LTV+     I S ++L+ + EI+
Sbjct:  575 FLVSRFSP-NEWHLSEAHHSYIANDFSISNSLWFSLGAFMQQGCDISPRSMSGRIVGSVWWFFTLIIISSYTANLAAFLTVERMLTPIDSAEDLARQTEIQ 674          
BLAST of SMED30033165 vs. UniProt/SwissProt
Match: sp|Q10914|GLR2_CAEEL (Glutamate receptor 2 OS=Caenorhabditis elegans OX=6239 GN=glr-2 PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 3.300e-13
Identity = 31/89 (34.83%), Postives = 55/89 (61.80%), Query Frame = -3
Query:    3 FSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 269
            F+V +E  +   +W  + AF+ QG D  P A+S R   + WW FT++I S+Y+A+L ++LT++     I+S ++L+N+ +I   + EG 
Sbjct:  657 FTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGG 745          
BLAST of SMED30033165 vs. UniProt/SwissProt
Match: sp|P19491|GRIA2_RAT (Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 1.281e-12
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. UniProt/SwissProt
Match: sp|P23819|GRIA2_MOUSE (Glutamate receptor 2 OS=Mus musculus OX=10090 GN=Gria2 PE=1 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 1.294e-12
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. UniProt/SwissProt
Match: sp|P42262|GRIA2_HUMAN (Glutamate receptor 2 OS=Homo sapiens OX=9606 GN=GRIA2 PE=1 SV=3)

HSP 1 Score: 66.6254 bits (161), Expect = 1.345e-12
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++LS + EI
Sbjct:  590 NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEI 666          
BLAST of SMED30033165 vs. TrEMBL
Match: A0A1I8I790 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.427e-30
Identity = 49/105 (46.67%), Postives = 74/105 (70.48%), Query Frame = -3
Query:    6 YLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEG 320
            + L+  SP SAWNL+L F++ DE+ ++E++W+ +G+FL QGQDFYPYAMS R V+  WW+FTV+I+ AY+ DLTS LTV      I+SF+++     +  ++  G
Sbjct:   18 FALAYFSPFSAWNLQLEFAIADEVWLQEYIWSCIGSFLQQGQDFYPYAMSPRAVMVFWWLFTVIIYGAYTGDLTSALTVSVTSLPIQSFEDMLADGSLTPIMPRG 122          
BLAST of SMED30033165 vs. TrEMBL
Match: A0A1I8HZU0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.446e-30
Identity = 51/90 (56.67%), Postives = 77/90 (85.56%), Query Frame = -3
Query:   45 LSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQEL 314
            LS  SP SA+NL L +S+ DE+R++E++W++VG+FL QGQDF+P+AMS+RTV+A WWMFTV+++SAY+A+LT++LTV +E   I+S ++L
Sbjct:  329 LSYFSPFSAYNLGLQYSIADEVRVQEYLWSIVGSFLQQGQDFFPFAMSARTVMAFWWMFTVIVYSAYTANLTAFLTVHTENLPIRSLEDL 418          

HSP 2 Score: 115.161 bits (287), Expect = 5.411e-27
Identity = 48/93 (51.61%), Postives = 74/93 (79.57%), Query Frame = -3
Query:   24 SPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIK 302
            SP SA+NL L FS+ DE+ ++E++W+ +G+F+ QGQDFYP+A+S+RT +A WWMFTV+I+ A++ADLTS+LTV +  ++I++  EL  +  IK
Sbjct: 1276 SPFSAYNLGLEFSIADEVWLQEYLWSAIGSFMQQGQDFYPFAVSARTAMAFWWMFTVIIYCAFTADLTSHLTVNTVAKSIETLDELVAQSAIK 1368          
BLAST of SMED30033165 vs. TrEMBL
Match: A0A1I8I240 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.792e-29
Identity = 49/105 (46.67%), Postives = 74/105 (70.48%), Query Frame = -3
Query:    6 YLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEG 320
            + L+  SP SAWNL+L F++ DE+ ++E++W+ +G+FL QGQDFYPYAMS R V+  WW+FTV+I+ AY+ DLTS LTV      I+SF+++     +  ++  G
Sbjct:   17 FALAYFSPFSAWNLQLEFAIADEVWLQEYIWSCIGSFLQQGQDFYPYAMSPRAVMVFWWLFTVIIYGAYTGDLTSALTVSVTSLPIQSFEDMLADGSLTPIMPRG 121          
BLAST of SMED30033165 vs. TrEMBL
Match: A0A1I8J047 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.715e-28
Identity = 52/105 (49.52%), Postives = 76/105 (72.38%), Query Frame = -3
Query:    3 LLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 317
            +L+  SP +A+NLK  +++ DE+  +E+VW+VVG+FL QGQDFYP+AMS RT+LA WWMFTV+I+ AY+ DLT++LTV      IK+  +L ++  IK  +  G 
Sbjct:  152 ILAYFSPFTAYNLKEEYAIADEVWFQEYVWSVVGSFLQQGQDFYPFAMSPRTILAFWWMFTVIIYGAYTGDLTAHLTVTITDYPIKTLSDLVSQTAIKPYVPAGT 256          
BLAST of SMED30033165 vs. TrEMBL
Match: A0A1I8FU98 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.686e-28
Identity = 56/131 (42.75%), Postives = 89/131 (67.94%), Query Frame = -3
Query:    6 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEG 398
            W V  PL W +WLL++  ++   I  ++L+  +P S WNL++ ++  DE+ ++E++W+V+G+FL QGQDFYP+AMS RTVLA WWM TV+++ AY+ DLT+ L V      I+S ++L +    K ++A G
Sbjct:  165 WNVFTPLAWDSWLLILGMLVFVPIIVFVLASCNPFSGWNLRISYAFADEVWLKEYIWSVIGSFLQQGQDFYPFAMSPRTVLAFWWMLTVILYGAYTGDLTAKLAVTVAEYPIQSLEDLVSMPHYKAMVARG 295          
BLAST of SMED30033165 vs. Ensembl Cavefish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 68.1662 bits (165), Expect = 5.248e-14
Identity = 32/77 (41.56%), Postives = 51/77 (66.23%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG DF P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  585 NEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 661          
BLAST of SMED30033165 vs. Ensembl Cavefish
Match: si:ch211-251b21.1 (probable glutamate receptor [Source:NCBI gene;Acc:103035003])

HSP 1 Score: 67.781 bits (164), Expect = 6.554e-14
Identity = 36/109 (33.03%), Postives = 66/109 (60.55%), Query Frame = -3
Query:    3 FC-YLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 326
            FC YL + +SP S W  + P +  ++  +    W  VGA  +QG   +P A+S R + A+WW+F++++ + Y A+L+++L   S   +IKSF++L+N+  I+    +G+
Sbjct:  168 FCIYLAARISP-SEW--EKPQADENQFTLSHSFWYTVGAITLQGAGPHPKALSGRLITAIWWLFSLMVLACYFANLSAWLHSDSNQLSIKSFEDLANQNIIQYGTIKGS 273          
BLAST of SMED30033165 vs. Ensembl Cavefish
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:103024859])

HSP 1 Score: 67.781 bits (164), Expect = 7.448e-14
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = -3
Query:    3 YLLSLLSPLSAWNLKLPFSVIDEIR--------IREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 320
            +L + LSP   +N   P   + E R        +   +W  VG F+ QG +  P A+S+R V  VWW FT++I S+Y+A+L ++LTVQ     I+S  +L+++  I+     G 
Sbjct:  576 FLAARLSPYEWYN---PHPCLRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPKALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIQYGTIHGG 686          
BLAST of SMED30033165 vs. Ensembl Cavefish
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:103024859])

HSP 1 Score: 67.781 bits (164), Expect = 7.774e-14
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = -3
Query:    3 YLLSLLSPLSAWNLKLPFSVIDEIR--------IREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 320
            +L + LSP   +N   P   + E R        +   +W  VG F+ QG +  P A+S+R V  VWW FT++I S+Y+A+L ++LTVQ     I+S  +L+++  I+     G 
Sbjct:  576 FLAARLSPYEWYN---PHPCLRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPKALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIQYGTIHGG 686          
BLAST of SMED30033165 vs. Ensembl Cavefish
Match: si:ch211-264f5.8 (si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-209])

HSP 1 Score: 67.3958 bits (163), Expect = 1.016e-13
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = -3
Query:    3 YLLSLLSPLSAWNLKLPFSVIDEIR--------IREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 320
            +L + LSP   +N   P   + E R        +   +W  VG F+ QG +  P A+S+R V  VWW FT++I S+Y+A+L ++LTVQ     I+S  +L+++  I+     G 
Sbjct:  526 FLAARLSPYEWYN---PHPCLRERRDLLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIQYGTIHGG 636          
BLAST of SMED30033165 vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 63.5438 bits (153), Expect = 4.335e-13
Identity = 30/77 (38.96%), Postives = 49/77 (63.64%), Query Frame = -3
Query:   27 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 257
            +E  I   +W  +GAF+ QG +  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S  +L+ + EI
Sbjct:  230 NEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEI 306          
BLAST of SMED30033165 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.379e-12
Identity = 26/70 (37.14%), Postives = 46/70 (65.71%), Query Frame = -3
Query:   24 VWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIK 233
            +W  VGA + QG +  P A+S+R V  +WW FT+++ S+Y+A+L ++LTV+     I S  +L+ + +I+
Sbjct:   29 LWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIE 98          
BLAST of SMED30033165 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.218e-12
Identity = 27/69 (39.13%), Postives = 44/69 (63.77%), Query Frame = -3
Query:   24 WNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIK 230
            W  VGA + QG +  P A+S+R V  +WW FT++I S+Y+A+L ++LTV+     I S  +L+ +  I+
Sbjct:  113 WFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIE 181          
BLAST of SMED30033165 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.172e-9
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = -3
Query:   24 WNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQT-IKSFQELSNRKEIK 230
            W V  A + QG D  P +M+ + ++  WW F +V+ S Y+A+L ++LT  +EGQT I+S ++L+ + + +
Sbjct:   90 WFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLT--AEGQTSIRSLKDLTRQMDAR 157          
BLAST of SMED30033165 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 1.035e-7
Identity = 21/58 (36.21%), Postives = 37/58 (63.79%), Query Frame = -3
Query:   60 VWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIK 233
            +W V G+F+ QG +    ++S+R V+ VWW+F  ++ S+Y+A LT+ LT+      I+
Sbjct:  159 LWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTINRMDPPIR 216          
BLAST of SMED30033165 vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 60.4622 bits (145), Expect = 6.989e-12
Identity = 27/85 (31.76%), Postives = 47/85 (55.29%), Query Frame = -3
Query:    3 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 257
            DE  +   +W   G+ L QG D  P + S R + A +W+FT+++ S Y+A+L ++ T Q+   TI S ++L  +   K  + +G 
Sbjct:   51 DEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGG 135          
BLAST of SMED30033165 vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 55.8398 bits (133), Expect = 3.311e-10
Identity = 27/86 (31.40%), Postives = 49/86 (56.98%), Query Frame = -3
Query:    3 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQT-IKSFQELSNRKEIKIVLAEGA 257
            DE  +   +W  V + L QG D  P + S R + A +W+FT+++ S Y+A+L +Y T +   ++ I S ++L ++  +K  + EG 
Sbjct:  168 DEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGG 253          
BLAST of SMED30033165 vs. Ensembl Nematostella
Match: EDO41290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J4])

HSP 1 Score: 52.373 bits (124), Expect = 2.496e-9
Identity = 23/85 (27.06%), Postives = 45/85 (52.94%), Query Frame = -3
Query:    3 DEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 257
            DE  +   +W    + L QG D  P + S R + + +W F ++I S Y+A+L ++ T ++    I++  +L+ +K+I     +G 
Sbjct:   94 DEFNLFNSLWFATASMLQQGPDNTPKSPSGRILASAFWFFILIIISTYTANLAAFFTKKTSKNFIETLDDLTKQKKISYGCLKGG 178          
BLAST of SMED30033165 vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 47.3654 bits (111), Expect = 3.009e-7
Identity = 22/78 (28.21%), Postives = 42/78 (53.85%), Query Frame = -3
Query:    3 VWNVVGAFLMQGQDF-YPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 233
            +W+    +L QG D  +P + S R  +AVWW    ++ + Y+A++ ++LT       I+  ++LS++ EI     E +
Sbjct:  564 IWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENS 641          
BLAST of SMED30033165 vs. Ensembl Nematostella
Match: EDO32621 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUK3])

HSP 1 Score: 45.4394 bits (106), Expect = 1.103e-6
Identity = 18/63 (28.57%), Postives = 38/63 (60.32%), Query Frame = -3
Query:   45 VWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQEL 233
            +W  + + L QG D  P ++S R +   +W   ++  S Y+A+L ++ TV+S G+T+ + +++
Sbjct:   97 LWFCLASMLQQGADSTPRSLSGRVLAGCFWFCILIWISTYTANLAAFFTVRSAGKTVSTLEDV 159          
BLAST of SMED30033165 vs. Ensembl Medaka
Match: ENSORLT00000026787.1 (glutamate receptor ionotropic, kainate 5 [Source:NCBI gene;Acc:101155942])

HSP 1 Score: 68.1662 bits (165), Expect = 4.465e-14
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = -3
Query:    3 YLLSLLSPLSAWNLKLPFSVIDEIR--------IREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 320
            +L + LSP   +N   P+    E R        +   +W  VG F+ QG +  P A+S+R V  VWW FT++I S+Y+A+L ++LTVQ     I+S  +L+++  I+     G 
Sbjct:  572 FLAARLSPYEWYN---PYPCFRERRDILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESADDLADQTNIQYGTIHGG 682          
BLAST of SMED30033165 vs. Ensembl Medaka
Match: gria3b (glutamate receptor 3 [Source:NCBI gene;Acc:101171999])

HSP 1 Score: 68.1662 bits (165), Expect = 4.612e-14
Identity = 38/107 (35.51%), Postives = 61/107 (57.01%), Query Frame = -3
Query:   27 YLLSLLSPLSAWNL---------KLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 320
            +L+S  SP   WNL         + P    ++  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  560 FLVSRFSPYE-WNLEEQDEIKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 665          
BLAST of SMED30033165 vs. Ensembl Medaka
Match: ENSORLT00000001416.2 (glutamate receptor ionotropic, kainate 5 [Source:NCBI gene;Acc:101155942])

HSP 1 Score: 68.1662 bits (165), Expect = 4.902e-14
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = -3
Query:    3 YLLSLLSPLSAWNLKLPFSVIDEIR--------IREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 320
            +L + LSP   +N   P+    E R        +   +W  VG F+ QG +  P A+S+R V  VWW FT++I S+Y+A+L ++LTVQ     I+S  +L+++  I+     G 
Sbjct:  541 FLAARLSPYEWYN---PYPCFRERRDILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESADDLADQTNIQYGTIHGG 651          
BLAST of SMED30033165 vs. Ensembl Medaka
Match: gria3b (glutamate receptor 3 [Source:NCBI gene;Acc:101171999])

HSP 1 Score: 68.1662 bits (165), Expect = 4.927e-14
Identity = 38/107 (35.51%), Postives = 61/107 (57.01%), Query Frame = -3
Query:   27 YLLSLLSPLSAWNL---------KLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 320
            +L+S  SP   WNL         + P    ++  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  560 FLVSRFSPYE-WNLEEQDEIKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 665          
BLAST of SMED30033165 vs. Ensembl Medaka
Match: gria3b (glutamate receptor 3 [Source:NCBI gene;Acc:101171999])

HSP 1 Score: 68.1662 bits (165), Expect = 5.122e-14
Identity = 38/107 (35.51%), Postives = 61/107 (57.01%), Query Frame = -3
Query:   27 YLLSLLSPLSAWNL---------KLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEI 320
            +L+S  SP   WNL         + P    ++  I   +W  +GAF+ QG D  P ++S R V  VWW FT++I S+Y+A+L ++LTV+     I+S ++L+ + EI
Sbjct:  560 FLVSRFSPYE-WNLEEQDEIKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 665          
BLAST of SMED30033165 vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 169.474 bits (428), Expect = 9.673e-51
Identity = 84/132 (63.64%), Postives = 112/132 (84.85%), Query Frame = -3
Query:    3 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 398
            W V RPL W+TWL++++S I  S   Y+LS  SPLSAWNLKL F+V+DEIR+REH+WN+VG+FLMQGQDFYPY+MSSRTVLA+WW+FTVVIFS Y+ADLTS+LTV+++   I S +EL++RK++KI++ +G 
Sbjct:  352 WNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGT 483          
BLAST of SMED30033165 vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 169.474 bits (428), Expect = 9.742e-51
Identity = 84/132 (63.64%), Postives = 112/132 (84.85%), Query Frame = -3
Query:    3 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 398
            W V RPL W+TWL++++S I  S   Y+LS  SPLSAWNLKL F+V+DEIR+REH+WN+VG+FLMQGQDFYPY+MSSRTVLA+WW+FTVVIFS Y+ADLTS+LTV+++   I S +EL++RK++KI++ +G 
Sbjct:  354 WNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGT 485          
BLAST of SMED30033165 vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 152.14 bits (383), Expect = 1.531e-43
Identity = 70/131 (53.44%), Postives = 102/131 (77.86%), Query Frame = -3
Query:    6 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEG 398
            W V+RPLQ++ W+L+++SV   S+ C+  S  SPLSAWNL L F++IDE++++E+ WNV+G+  MQGQDFYP+ +SSR VLA+WW+  ++IFSAYSADLTS+LTVQ +   I    EL+NRK++ I++ +G
Sbjct:  100 WHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKG 230          

HSP 2 Score: 145.591 bits (366), Expect = 3.487e-41
Identity = 67/131 (51.15%), Postives = 97/131 (74.05%), Query Frame = -3
Query:    6 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEG 398
            W + RP  W+ WLL I ++ + S FCY+ S  +PLSA+NL L F+++DEI I+EH+WN +G F++QGQDFYPY +S+R VLA+WW+F ++IFSAY+ADLTS+LTV      + S   L+ R ++KIV+ +G
Sbjct:  659 WHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKG 789          
BLAST of SMED30033165 vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 147.132 bits (370), Expect = 1.688e-43
Identity = 70/132 (53.03%), Postives = 102/132 (77.27%), Query Frame = -3
Query:    3 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA 398
            W V+RPLQ++ W+L+++SV   S+ C+  S  SPLSAWNL L F++IDE++++E+ WNV+G+  MQGQDFYP+ +SSR VLA+WW+  ++IFSAYSADLTS+LTVQ +   I    EL+NRK++ I++ +G 
Sbjct:  100 WHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGT 231          
BLAST of SMED30033165 vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 152.14 bits (383), Expect = 1.756e-43
Identity = 70/131 (53.44%), Postives = 102/131 (77.86%), Query Frame = -3
Query:    6 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEG 398
            W V+RPLQ++ W+L+++SV   S+ C+  S  SPLSAWNL L F++IDE++++E+ WNV+G+  MQGQDFYP+ +SSR VLA+WW+  ++IFSAYSADLTS+LTVQ +   I    EL+NRK++ I++ +G
Sbjct:  100 WHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKG 230          

HSP 2 Score: 145.206 bits (365), Expect = 3.848e-41
Identity = 67/131 (51.15%), Postives = 97/131 (74.05%), Query Frame = -3
Query:    6 WIVIRPLQXXXXXXXXXXXXXXXIFCYLLSLLSPLSAWNLKLPFSVIDEIRIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEG 398
            W + RP  W+ WLL I ++ + S FCY+ S  +PLSA+NL L F+++DEI I+EH+WN +G F++QGQDFYPY +S+R VLA+WW+F ++IFSAY+ADLTS+LTV      + S   L+ R ++KIV+ +G
Sbjct:  659 WHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKG 789          
The following BLAST results are available for this feature:
BLAST of SMED30033165 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA22.426e-1341.56glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIA22.800e-1341.56glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIA22.827e-1341.56glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIA22.828e-1341.56glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIA22.981e-1341.56glutamate ionotropic receptor AMPA type subunit 2 ... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-22.504e-1434.83Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-22.594e-1434.83Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-46.750e-1436.84GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-47.384e-1436.84GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-18.371e-1329.09Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluRIID3.809e-1531.37gene:FBgn0028422 transcript:FBtr0083938[more]
GluRIIE2.516e-1432.35gene:FBgn0051201 transcript:FBtr0110837[more]
KaiR1D8.005e-1436.36gene:FBgn0038837 transcript:FBtr0083987[more]
CG111551.579e-1234.04gene:FBgn0039927 transcript:FBtr0089194[more]
Grik4.220e-1233.66gene:FBgn0038840 transcript:FBtr0083978[more]
back to top
BLAST of SMED30033165 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a2.335e-1436.45glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
si:ch211-264f5.83.240e-1433.33si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
gria2a1.086e-1339.02glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
gria2a1.100e-1339.02glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
gria2a1.100e-1339.02glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgcr82.091e-1341.56DGCR8 microprocessor complex subunit [Source:Xenba... [more]
dgcr82.199e-1341.56DGCR8 microprocessor complex subunit [Source:Xenba... [more]
dgcr82.293e-1341.56DGCR8 microprocessor complex subunit [Source:Xenba... [more]
dgcr82.296e-1341.56DGCR8 microprocessor complex subunit [Source:Xenba... [more]
dgcr82.371e-1341.56DGCR8 microprocessor complex subunit [Source:Xenba... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gria21.707e-1341.56glutamate receptor, ionotropic, AMPA2 (alpha 2) [S... [more]
Gria21.832e-1341.56glutamate receptor, ionotropic, AMPA2 (alpha 2) [S... [more]
Gria21.849e-1341.56glutamate receptor, ionotropic, AMPA2 (alpha 2) [S... [more]
Gria43.065e-1340.26glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria43.065e-1340.26glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
back to top
BLAST of SMED30033165 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26591|GLRK_LYMST1.199e-1336.63Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE... [more]
sp|Q10914|GLR2_CAEEL3.300e-1334.83Glutamate receptor 2 OS=Caenorhabditis elegans OX=... [more]
sp|P19491|GRIA2_RAT1.281e-1241.56Glutamate receptor 2 OS=Rattus norvegicus OX=10116... [more]
sp|P23819|GRIA2_MOUSE1.294e-1241.56Glutamate receptor 2 OS=Mus musculus OX=10090 GN=G... [more]
sp|P42262|GRIA2_HUMAN1.345e-1241.56Glutamate receptor 2 OS=Homo sapiens OX=9606 GN=GR... [more]
back to top
BLAST of SMED30033165 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I7901.427e-3046.67PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8HZU03.446e-3056.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I2406.792e-2946.67PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8J0472.715e-2849.52PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8FU983.686e-2842.75Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a5.248e-1441.56glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
si:ch211-251b21.16.554e-1433.03probable glutamate receptor [Source:NCBI gene;Acc:... [more]
grik57.448e-1433.33glutamate ionotropic receptor kainate type subunit... [more]
grik57.774e-1433.33glutamate ionotropic receptor kainate type subunit... [more]
si:ch211-264f5.81.016e-1333.33si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria1b4.335e-1338.96glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000002503.11.379e-1237.14pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
ENSPMAT00000005084.12.218e-1239.13pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000007790.12.172e-935.71pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000000621.11.035e-736.21pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033165 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412936.989e-1231.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412913.311e-1031.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412902.496e-927.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466333.009e-728.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326211.103e-628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30033165 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000026787.14.465e-1433.33glutamate receptor ionotropic, kainate 5 [Source:N... [more]
gria3b4.612e-1435.51glutamate receptor 3 [Source:NCBI gene;Acc:1011719... [more]
ENSORLT00000001416.24.902e-1433.33glutamate receptor ionotropic, kainate 5 [Source:N... [more]
gria3b4.927e-1435.51glutamate receptor 3 [Source:NCBI gene;Acc:1011719... [more]
gria3b5.122e-1435.51glutamate receptor 3 [Source:NCBI gene;Acc:1011719... [more]
back to top
BLAST of SMED30033165 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069533.19.673e-5163.64SMESG000069533.1[more]
SMESG000069533.19.742e-5163.64SMESG000069533.1[more]
SMESG000018611.11.531e-4353.44SMESG000018611.1[more]
SMESG000018611.11.688e-4353.03SMESG000018611.1[more]
SMESG000018611.11.756e-4353.44SMESG000018611.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033165 ID=SMED30033165|Name=SMED30033165|organism=Schmidtea mediterranea sexual|type=transcript|length=400bp
GCTGCTCCTTCAGCTAGTACAATTTTAATTTCTTTTCTGTTGGATAGTTC
CTGAAAAGATTTTATCGTTTGTCCTTCACTTTGAACTGTTAAATAGGATG
TGAGATCAGCAGAGTAAGCACTGAAGATAACTACTGTAAACATCCACCAA
ACAGCCAAAACAGTTCTTGAAGACATTGCATAAGGATAAAAGTCCTGTCC
TTGCATTAGAAAAGCACCGACGACATTCCATACGTGCTCTCGAATTCTAA
TTTCATCAATGACACTAAATGGAAGCTTCAAATTCCATGCAGATAGGGGG
CTCAGTAATGATAATAAATAACAGAAAATAGATGTTATGATGACTGATAT
AATTAACAGTAGCCAAGTTGTCCATTGAAGAGGCCTTATTACAATCCAAA
back to top

protein sequence of SMED30033165-orf-1

>SMED30033165-orf-1 ID=SMED30033165-orf-1|Name=SMED30033165-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
WIVIRPLQWTTWLLLIISVIITSIFCYLLSLLSPLSAWNLKLPFSVIDEI
RIREHVWNVVGAFLMQGQDFYPYAMSSRTVLAVWWMFTVVIFSAYSADLT
SYLTVQSEGQTIKSFQELSNRKEIKIVLAEGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: molecular function
TermDefinition
GO:0038023signaling receptor activity
GO:0015276ligand-gated ion channel activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 79..106
score: 28.57
coord: 11..36
score: 38.08
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 1..109
e-value: 9.6E-27
score: 95.6
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 110..129
e-value: 9.6E-27
score: 95.6
NoneNo IPR availablePANTHERPTHR42643:SF13IONOTROPIC RECEPTOR 40A-RELATEDcoord: 2..128
NoneNo IPR availablePANTHERPTHR42643FAMILY NOT NAMEDcoord: 2..128
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 9..121
e-value: 8.2E-24
score: 84.1