Heat shock 70 kDa protein

Overview
NameHeat shock 70 kDa protein
Smed IDSMED30033164
Length (bp)676
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock 70 kDa protein (SMED30033164) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock 70 kDa protein (SMED30033164) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock 70 kDa protein (SMED30033164) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock 70 kDa protein (SMED30033164) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033164

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30033164SMESG000041117.1 dd_Smed_v6_1378_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30033164SMESG000041117.1 dd_Smed_v6_1378_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033164SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 65.4698 bits (158), Expect = 4.432e-13
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 65.4698 bits (158), Expect = 4.957e-13
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 65.855 bits (159), Expect = 7.400e-13
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 65.855 bits (159), Expect = 7.844e-13
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 65.855 bits (159), Expect = 7.909e-13
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 65.855 bits (159), Expect = 2.087e-12
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 65.855 bits (159), Expect = 2.087e-12
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 63.1586 bits (152), Expect = 2.054e-11
Identity = 31/70 (44.29%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  197 KMSGIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            K  GI+  T YSCVG++++       N +G+ TTP+Y AFTDT R +  A KD   RN  N +F+ KRL+
Sbjct:    5 KAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 63.1586 bits (152), Expect = 2.054e-11
Identity = 31/70 (44.29%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  197 KMSGIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            K  GI+  T YSCVG++++       N +G+ TTP+Y AFTDT R +  A KD   RN  N +F+ KRL+
Sbjct:    5 KAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 63.1586 bits (152), Expect = 2.054e-11
Identity = 31/70 (44.29%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  197 KMSGIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            K  GI+  T YSCVG++++       N +G+ TTP+Y AFTDT R +  A KD   RN  N +F+ KRL+
Sbjct:    5 KAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-1 (gene:FBgn0001216 transcript:FBtr0075762)

HSP 1 Score: 65.855 bits (159), Expect = 3.022e-12
Identity = 34/67 (50.75%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFT++ R I  A K+    N NN IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 64.6994 bits (156), Expect = 6.754e-12
Identity = 34/67 (50.75%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N    IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 64.6994 bits (156), Expect = 6.754e-12
Identity = 34/67 (50.75%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N    IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 64.6994 bits (156), Expect = 6.754e-12
Identity = 34/67 (50.75%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N    IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 64.6994 bits (156), Expect = 6.754e-12
Identity = 34/67 (50.75%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N    IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 69.3218 bits (168), Expect = 1.466e-13
Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+     + +  +++  + FK
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFK 95          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.2 (heat shock cognate 70-kd protein, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110405-1])

HSP 1 Score: 69.3218 bits (168), Expect = 1.466e-13
Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+     + +  +++  + FK
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFK 95          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 69.707 bits (169), Expect = 1.963e-13
Identity = 38/86 (44.19%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN IF+ KRL+     + +  +++  + FK
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFDDQVVQSDMKLWPFK 93          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 69.707 bits (169), Expect = 2.203e-13
Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+     + +  +++  + FK
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFK 95          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.3 (heat shock cognate 70-kd protein, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-110713-1])

HSP 1 Score: 69.707 bits (169), Expect = 2.245e-13
Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+     + +  +++  + FK
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFK 95          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: ENSXETT00000025573.1 (heat shock protein family A (Hsp70) member 1B [Source:NCBI gene;Acc:100485441])

HSP 1 Score: 67.3958 bits (163), Expect = 1.760e-12
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+       +  +++  + FK
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPHNTVFDAKRLIGRKYDEPVVQSDMKHWPFK 94          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: tmed10 (transmembrane emp24-like trafficking protein 10 (yeast) [Source:Xenbase;Acc:XB-GENE-968508])

HSP 1 Score: 67.3958 bits (163), Expect = 1.792e-12
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+       +  +++  + FK
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPHNTVFDAKRLIGRKYDEPVVQSDMKHWPFK 94          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 66.6254 bits (161), Expect = 2.782e-12
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:   13 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 79          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 66.6254 bits (161), Expect = 2.886e-12
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:   11 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 66.6254 bits (161), Expect = 2.897e-12
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 64.6994 bits (156), Expect = 3.416e-13
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 67.3958 bits (163), Expect = 1.407e-12
Identity = 35/67 (52.24%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N IF+ KRL+
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLI 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 67.3958 bits (163), Expect = 1.407e-12
Identity = 35/67 (52.24%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N IF+ KRL+
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLI 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa1a (heat shock protein 1A [Source:MGI Symbol;Acc:MGI:96244])

HSP 1 Score: 67.0106 bits (162), Expect = 1.873e-12
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa1b (heat shock protein 1B [Source:MGI Symbol;Acc:MGI:99517])

HSP 1 Score: 67.0106 bits (162), Expect = 1.928e-12
Identity = 34/67 (50.75%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q91233|HSP70_ONCTS (Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha OX=74940 GN=hsp70 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.107e-12
Identity = 37/86 (43.02%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+     + +   ++  + FK
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFNDQVVQADMKHWPFK 95          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q9U639|HSP7D_MANSE (Heat shock 70 kDa protein cognate 4 OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.368e-12
Identity = 36/67 (53.73%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTDRLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q05746|HSP70_PLACB (Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) OX=5828 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.110e-12
Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGV+R+E      NDQG+ TTP+Y AFTDT R I  A K+   RN  N +F+ KRL+
Sbjct:   19 GIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLI 85          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|P11144|HSP70_PLAFA (Heat shock 70 kDa protein OS=Plasmodium falciparum OX=5833 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 7.363e-12
Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGV+R+E      NDQG+ TTP+Y AFTDT R I  A K+   RN  N +F+ KRL+
Sbjct:   19 GIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLI 85          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|P47773|HSP7C_ICTPU (Heat shock cognate 71 kDa protein OS=Ictalurus punctatus OX=7998 GN=hsc70 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.057e-12
Identity = 36/86 (41.86%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTD+ R I  A K+    N  N IF+ KRL+    ++++   ++  + FK
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDSVVQADMKHWPFK 93          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: K9ZRK9 (Heat shock 70kDa protein 1A (Fragment) OS=Bos indicus OX=9915 GN=HSPA1A PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.883e-12
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FKQL 469
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I YA K+    N  N +F+ KRL+     + +  +++  + F+ +
Sbjct:    5 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGYAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI 92          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: K9ZU00 (Heat shock 70kDa protein 1A (Fragment) OS=Bos indicus x Bos taurus OX=30522 GN=HSPA1A PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.883e-12
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FKQL 469
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I YA K+    N  N +F+ KRL+     + +  +++  + F+ +
Sbjct:    5 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGYAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI 92          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A0A2A4AYR6 (Molecular chaperone DnaK (Fragment) OS=Pseudomonas pelagia OX=553151 GN=CO192_00790 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.038e-11
Identity = 36/67 (53.73%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A3E3T5 (Heat shock protein 70 (Fragment) OS=Pfiesteria piscicida OX=71001 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.942e-11
Identity = 37/86 (43.02%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGV++++      NDQG+ TTP+Y AFTDT R I  A K    RN  N +F+ KRL+     + I   +I  + FK
Sbjct:    8 GIDLGTTYSCVGVWKNDGVEIIANDQGNRTTPSYVAFTDTERLIGDAAKSQVARNPENTVFDAKRLIGRKFADPIVQADIKLWPFK 93          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A0A5C6MF07 (Heat shock 70 kDa protein 1 (Fragment) OS=Takifugu flavidus OX=433684 GN=D4764_0023340 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.055e-11
Identity = 37/86 (43.02%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+    ++     +I  + FK
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKLEDPTVQADIKHWPFK 95          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000032722.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:155723:156505:1 gene:ENSAMXG00000042801.1 transcript:ENSAMXT00000032722.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.899e-14
Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+    ++ +  +++  + F+
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFEDPVVQSDMKHWPFQ 95          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.507e-13
Identity = 37/86 (43.02%), Postives = 52/86 (60.47%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVG+F+H       NDQG+ TTP+Y AFTDT R I  A K+    N  N IF+ KRL+    ++T+  +++  + FK
Sbjct:    8 GIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDTVVQSDMKHWPFK 93          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 69.707 bits (169), Expect = 1.602e-13
Identity = 38/86 (44.19%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN IF+ KRL+     + +  +++  + FK
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDAVVQSDMKLWPFK 93          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 69.3218 bits (168), Expect = 2.349e-13
Identity = 36/86 (41.86%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVG+F+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+     + +  +++  + FK
Sbjct:    8 GIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDAVVQSDMKHWPFK 93          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 68.9366 bits (167), Expect = 2.882e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of Heat shock 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 55.0694 bits (131), Expect = 2.810e-9
Identity = 31/68 (45.59%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTG-RWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF++       NDQG+  TP+Y AFT  G R I  A K+    N  N +F+ KRL+
Sbjct:   37 GIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLI 104          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 60.8474 bits (146), Expect = 2.473e-11
Identity = 32/70 (45.71%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  197 KMSGIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            K  GI+  T YSCV  F ++      NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+
Sbjct:    3 KAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLI 72          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 60.077 bits (144), Expect = 3.665e-11
Identity = 31/70 (44.29%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  197 KMSGIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            K  GI+  T YSCV  F ++      NDQG+ TTP++ AFTDT R I  A K+    N +N +F+ KRL+
Sbjct:    3 KAVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLI 72          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 59.3066 bits (142), Expect = 7.769e-11
Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCV  F ++      NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+
Sbjct:    6 GIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLI 72          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 56.9954 bits (136), Expect = 3.820e-10
Identity = 30/70 (42.86%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  197 KMSGIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            K  GI+  T YSCV  F ++      NDQG+ TTP++  FTDT R I  A K+    N  N +F+ KRL+
Sbjct:    3 KAVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLI 72          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 55.8398 bits (133), Expect = 9.867e-10
Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 2
Query:  191 Y*KMSGIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            Y  + GI+  T YSCV V ++  +    N+QG+  TP+Y AFTD  R I  A K+    N  N IF++KRL+
Sbjct:   49 YGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLI 120          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 65.4698 bits (158), Expect = 1.787e-12
Identity = 33/67 (49.25%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AF+DT R I  A K+    N  N +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 63.929 bits (154), Expect = 5.620e-12
Identity = 33/67 (49.25%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTD  R +  A K+    N  N IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 61.2326 bits (147), Expect = 4.241e-11
Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF++       NDQG+ TTP+Y  FTDT R +  A K+    N  N IF+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 54.6842 bits (130), Expect = 6.764e-9
Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTG-RWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF++       NDQG+  TP+Y AFT+ G R I    K+    N  N +F+ KRL+
Sbjct:   37 GIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLI 104          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 68.9366 bits (167), Expect = 3.553e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 68.5514 bits (166), Expect = 3.667e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLI 74          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 68.1662 bits (165), Expect = 5.236e-13
Identity = 37/92 (40.22%), Postives = 51/92 (55.43%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FKQLYNIT 481
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+       +   ++  + FK +  I 
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVMKEIA 98          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: ENSORLT00000043909.1 (pep primary_assembly:ASM223467v1:8:793349:795333:-1 gene:ENSORLG00000028255.1 transcript:ENSORLT00000043909.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 5.594e-13
Identity = 37/92 (40.22%), Postives = 51/92 (55.43%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FKQLYNIT 481
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+       +   ++  + FK +  I 
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVMKEIA 98          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: ENSORLT00000042552.1 (pep primary_assembly:ASM223467v1:8:710990:713238:-1 gene:ENSORLG00000027683.1 transcript:ENSORLT00000042552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 8.413e-13
Identity = 36/86 (41.86%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLVEMSNKNTINMTEITQY*FK 463
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N +N +F+ KRL+       +   ++  + FK
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFK 95          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.557e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.846e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.846e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.846e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051540.1 (SMESG000051540.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.846e-13
Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  206 GIEYSTNYSCVGVFRHE*S*N*GNDQGDHTTPNYGAFTDTGRWIEYATKDPDMRNTNNMIFEVKRLV 406
            GI+  T YSCVGVF+H       NDQG+ TTP+Y AFTDT R I  A K+    N NN +F+ KRL+
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
The following BLAST results are available for this feature:
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA84.432e-1350.75heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA84.957e-1350.75heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA87.400e-1350.75heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA87.844e-1350.75heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA87.909e-1350.75heat shock protein family A (Hsp70) member 8 [Sour... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-12.087e-1250.75Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-12.087e-1250.75Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.52.054e-1144.29pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.52.054e-1144.29pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.42.054e-1144.29pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-13.022e-1250.75gene:FBgn0001216 transcript:FBtr0075762[more]
Hsc70-46.754e-1250.75gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-46.754e-1250.75gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-46.754e-1250.75gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-46.754e-1250.75gene:FBgn0266599 transcript:FBtr0083060[more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp70.11.466e-1343.02heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.21.466e-1343.02heat shock cognate 70-kd protein, tandem duplicate... [more]
hspa1b1.963e-1344.19heat shock protein family A (Hsp70) member 1B [Sou... [more]
hsp70.12.203e-1343.02heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.32.245e-1343.02heat shock cognate 70-kd protein, tandem duplicate... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000025573.11.760e-1241.86heat shock protein family A (Hsp70) member 1B [Sou... [more]
tmed101.792e-1241.86transmembrane emp24-like trafficking protein 10 (y... [more]
wdr262.782e-1250.75WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr262.886e-1250.75WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr262.897e-1250.75WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa83.416e-1350.75heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa21.407e-1252.24heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa21.407e-1252.24heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa1a1.873e-1250.75heat shock protein 1A [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa1b1.928e-1250.75heat shock protein 1B [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91233|HSP70_ONCTS2.107e-1243.02Heat shock 70 kDa protein OS=Oncorhynchus tshawyts... [more]
sp|Q9U639|HSP7D_MANSE2.368e-1253.73Heat shock 70 kDa protein cognate 4 OS=Manduca sex... [more]
sp|Q05746|HSP70_PLACB6.110e-1252.24Heat shock 70 kDa protein OS=Plasmodium cynomolgi ... [more]
sp|P11144|HSP70_PLAFA7.363e-1252.24Heat shock 70 kDa protein OS=Plasmodium falciparum... [more]
sp|P47773|HSP7C_ICTPU8.057e-1241.86Heat shock cognate 71 kDa protein OS=Ictalurus pun... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K9ZRK94.883e-1240.91Heat shock 70kDa protein 1A (Fragment) OS=Bos indi... [more]
K9ZU004.883e-1240.91Heat shock 70kDa protein 1A (Fragment) OS=Bos indi... [more]
A0A2A4AYR61.038e-1153.73Molecular chaperone DnaK (Fragment) OS=Pseudomonas... [more]
A3E3T51.942e-1143.02Heat shock protein 70 (Fragment) OS=Pfiesteria pis... [more]
A0A5C6MF072.055e-1143.02Heat shock 70 kDa protein 1 (Fragment) OS=Takifugu... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032722.11.899e-1441.86pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000004733.21.507e-1343.02pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
hspa1b1.602e-1344.19heat shock protein family A (Hsp70) member 1B [Sou... [more]
hsc702.349e-1341.86heat shock cognate 71 kDa protein-like [Source:NCB... [more]
ENSAMXT00000037064.12.882e-1352.24heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hspa52.810e-945.59heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA42.473e-1145.71Heat shock protein that is highly induced upon str... [more]
SSA13.665e-1144.29ATPase involved in protein folding and NLS-directe... [more]
SSA37.769e-1146.27ATPase involved in protein folding and the respons... [more]
SSA23.820e-1042.86HSP70 family ATP-binding protein; involved in prot... [more]
KAR29.867e-1041.67ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO372801.787e-1249.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303235.620e-1249.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445304.241e-1147.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332966.764e-944.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b3.553e-1352.24heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hspa8b3.667e-1352.24heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
HSPA25.236e-1340.22heat shock protein family A (Hsp70) member 2 [Sour... [more]
ENSORLT00000043909.15.594e-1340.22pep primary_assembly:ASM223467v1:8:793349:795333:-... [more]
ENSORLT00000042552.18.413e-1341.86pep primary_assembly:ASM223467v1:8:710990:713238:-... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051815.13.557e-1352.24SMESG000051815.1[more]
SMESG000051570.13.846e-1352.24SMESG000051570.1[more]
SMESG000051567.13.846e-1352.24SMESG000051567.1[more]
SMESG000051541.13.846e-1352.24SMESG000051541.1[more]
SMESG000051540.13.846e-1352.24SMESG000051540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033164 ID=SMED30033164|Name=Heat shock 70 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=676bp
AGTGGAGTTATTTCTCTCGTTCAGCAAAATGCCTCCTCTATTGGAATCAT
TGCTTTTATTGCCGGGTGTATTCTTATCGCCATTTCTGTCATTGGAATTG
TCGCGGTTTGCTGTTGTACTTTGAAACTGATATTGATTGTGGTAAGATTT
GGCTTTGTATTGATTTTTTATCCCTATTGAATTTGTTTTATATTGAAAAA
TGTCCGGTATTGAATATAGTACTAACTATTCATGTGTTGGTGTATTTCGA
CATGAATAAAGCTGAAATTAAGGCAATGATCAAGGAGACCACACAACACC
CAATTATGGTGCATTTACAGATACAGGGCGATGGATTGAATATGCTACAA
AAGATCCAGATATGAGAAACACAAACAATATGATTTTCGAAGTCAAGCGG
CTGGTCGAGATGAGCAATAAAAATACAATCAACATGACAGAAATTACCCA
ATATTAATTTAAACAACTTTATAATATAACATTTATTTTAACAATTAAAG
TATAATATTTAAAATTAATTTAAATGATTTCTTTTTTAGAAGGATATTAA
AATTCAAACATTAATAATTTCTTTTAATATATAAATTAAAATCCACATTA
TTTTTGTTGGTTTATTACCTGATGATGATGAAAGTAAATTTATTGAAATA
TCGTAAAACGTGTGCTTGAATGGCGC
back to top

protein sequence of SMED30033164-orf-1

>SMED30033164-orf-1 ID=SMED30033164-orf-1|Name=SMED30033164-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
WSYFSRSAKCLLYWNHCFYCRVYSYRHFCHWNCRGLLLYFETDIDCGKIW
LCIDFLSLLNLFYIEKCPVLNIVLTIHVLVYFDMNKAEIKAMIKETTQHP
IMVHLQIQGDGLNMLQKIQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000419prepharyngeal region
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR013126Hsp_70_fam
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm