slc26a-2

Overview
Nameslc26a-2 (AKN21606.1)
Smed IDSMED30033152
Length (bp)1950
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc26a-2 (SMED30033152) t-SNE clustered cells

Violin plots show distribution of expression levels for slc26a-2 (SMED30033152) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc26a-2 (SMED30033152) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc26a-2 (SMED30033152) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033152SMESG000054903.1 SMESG000054878.1 Contig2366GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033152SMESG000073280.1 Contig2366GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30033152SMESG000073280.1 dd_Smed_v4_7104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc26a-2 vs. Ensembl Human
Match: SLC26A11 (solute carrier family 26 member 11 [Source:HGNC Symbol;Acc:HGNC:14471])

HSP 1 Score: 345.895 bits (886), Expect = 3.504e-110
Identity = 212/577 (36.74%), Postives = 336/577 (58.23%), Query Frame = 1
Query:  133 SACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINER 1851
            SAC  S     + +  PI+ W+  Y   +LK D V+GLSVGLT IPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +G+  LGF+ +++S  V+ GFTS+AA+ IG+GQIK +LGL+ I   FFL +Y    ++ ET + D   G+V +++LL  KL+  +V      +    R+   ++W    + N LVV    ++A+  +        LTG   +GLP   +P F +     T+  T ++ +++G G+ +V L+ L+E++A+ KAFA  N Y+I ++QE +AIG++N++GS   S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II+AV  + D K     W++KR D +    TF+L     V+YG+L G  +S L ++  A+RP+ +V E         S L FP +  L   I    +E      + L+ T V S D  ++  L ++  DF  + + + +     Q+  +   + AD  G Q + ++E+A+    H+ + 
Sbjct:   21 SACCCSP--AALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF-----HEPAYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT-EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFDTKIFRTLWRVKRLDLLPLCVTFLLCF-WEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDF--QKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAE---KHLRQE 583          
BLAST of slc26a-2 vs. Ensembl Human
Match: SLC26A11 (solute carrier family 26 member 11 [Source:HGNC Symbol;Acc:HGNC:14471])

HSP 1 Score: 345.895 bits (886), Expect = 3.504e-110
Identity = 212/577 (36.74%), Postives = 336/577 (58.23%), Query Frame = 1
Query:  133 SACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINER 1851
            SAC  S     + +  PI+ W+  Y   +LK D V+GLSVGLT IPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +G+  LGF+ +++S  V+ GFTS+AA+ IG+GQIK +LGL+ I   FFL +Y    ++ ET + D   G+V +++LL  KL+  +V      +    R+   ++W    + N LVV    ++A+  +        LTG   +GLP   +P F +     T+  T ++ +++G G+ +V L+ L+E++A+ KAFA  N Y+I ++QE +AIG++N++GS   S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II+AV  + D K     W++KR D +    TF+L     V+YG+L G  +S L ++  A+RP+ +V E         S L FP +  L   I    +E      + L+ T V S D  ++  L ++  DF  + + + +     Q+  +   + AD  G Q + ++E+A+    H+ + 
Sbjct:   21 SACCCSP--AALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF-----HEPAYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT-EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFDTKIFRTLWRVKRLDLLPLCVTFLLCF-WEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDF--QKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAE---KHLRQE 583          
BLAST of slc26a-2 vs. Ensembl Human
Match: SLC26A11 (solute carrier family 26 member 11 [Source:HGNC Symbol;Acc:HGNC:14471])

HSP 1 Score: 345.895 bits (886), Expect = 3.504e-110
Identity = 212/577 (36.74%), Postives = 336/577 (58.23%), Query Frame = 1
Query:  133 SACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINER 1851
            SAC  S     + +  PI+ W+  Y   +LK D V+GLSVGLT IPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +G+  LGF+ +++S  V+ GFTS+AA+ IG+GQIK +LGL+ I   FFL +Y    ++ ET + D   G+V +++LL  KL+  +V      +    R+   ++W    + N LVV    ++A+  +        LTG   +GLP   +P F +     T+  T ++ +++G G+ +V L+ L+E++A+ KAFA  N Y+I ++QE +AIG++N++GS   S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II+AV  + D K     W++KR D +    TF+L     V+YG+L G  +S L ++  A+RP+ +V E         S L FP +  L   I    +E      + L+ T V S D  ++  L ++  DF  + + + +     Q+  +   + AD  G Q + ++E+A+    H+ + 
Sbjct:   21 SACCCSP--AALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF-----HEPAYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT-EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFDTKIFRTLWRVKRLDLLPLCVTFLLCF-WEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDF--QKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAE---KHLRQE 583          
BLAST of slc26a-2 vs. Ensembl Human
Match: SLC26A11 (solute carrier family 26 member 11 [Source:HGNC Symbol;Acc:HGNC:14471])

HSP 1 Score: 345.895 bits (886), Expect = 3.504e-110
Identity = 212/577 (36.74%), Postives = 336/577 (58.23%), Query Frame = 1
Query:  133 SACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINER 1851
            SAC  S     + +  PI+ W+  Y   +LK D V+GLSVGLT IPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +G+  LGF+ +++S  V+ GFTS+AA+ IG+GQIK +LGL+ I   FFL +Y    ++ ET + D   G+V +++LL  KL+  +V      +    R+   ++W    + N LVV    ++A+  +        LTG   +GLP   +P F +     T+  T ++ +++G G+ +V L+ L+E++A+ KAFA  N Y+I ++QE +AIG++N++GS   S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II+AV  + D K     W++KR D +    TF+L     V+YG+L G  +S L ++  A+RP+ +V E         S L FP +  L   I    +E      + L+ T V S D  ++  L ++  DF  + + + +     Q+  +   + AD  G Q + ++E+A+    H+ + 
Sbjct:   21 SACCCSP--AALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF-----HEPAYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT-EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFDTKIFRTLWRVKRLDLLPLCVTFLLCF-WEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDF--QKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAE---KHLRQE 583          
BLAST of slc26a-2 vs. Ensembl Human
Match: SLC26A11 (solute carrier family 26 member 11 [Source:HGNC Symbol;Acc:HGNC:14471])

HSP 1 Score: 180.259 bits (456), Expect = 3.455e-52
Identity = 93/197 (47.21%), Postives = 133/197 (67.51%), Query Frame = 1
Query:  133 SACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVV 723
            SAC  S     + +  PI+ W+  Y   +LK D V+GLSVGLT IPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +G+  LGF+ +++S  V+ GFTS+AA+ IG+GQIK +LGL+ I   FFL +Y    ++ ET + D   G+V ++
Sbjct:   21 SACCCSP--AALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF-----HEPAYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCML 210          
BLAST of slc26a-2 vs. Ensembl Celegans
Match: sulp-7 (Anion transporter SULP-7a; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EGG6])

HSP 1 Score: 177.178 bits (448), Expect = 1.234e-47
Identity = 155/579 (26.77%), Postives = 273/579 (47.15%), Query Frame = 1
Query:  172 KYFPIVEWIQYYRFTY-LKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSL---------------ASEIPFDITYSVI--LSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNN----FFLSIYDVCSKL--EETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAV--MFMTDFKFLYRTWKIKRYD----CITWFSTFVLSLGLGVEYGVLIGIGLSFLPI--------------------VFIAS--------RPKFQVYENTSHFQGSFLWFPFISKLT------AMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRN 1716
             Y PI +W+  Y  +  L NDI+ G++VG+  +PQG+AY ++ GL+P YGL+ + +   +Y  FGTS+ + +G  A++SL+    +L               ++E+   I+ +V+  L L  G IQ+I+GLF   ++ +Y+S  ++ GFT+ AA+ +   Q+  ILG+   R++     F    D+ + +  E+ N+      +V++V+L   K +             + R   K L  + I  ++ +++  TI+A + +  E   + + G+I  G P   LPD               +F+ +      +A++++V  +++GK  A+ + Y+I   QEF A+GI     S F   P T + +RT IN    +K+  S + +  V+ L L F+  Y   +P   L+ I+IVA+  MF+    F+   W++ +YD     IT+F+T  L +  G+  G +  + LS L I                    VF AS        R   ++ +  +   G       ISK        AMID+ + +   ++  D+ GV S D +  N L+ I  D I  +
Sbjct:   11 NYIPITKWLPNYSISENLINDIIGGVTVGILNVPQGMAYASLVGLKPVYGLYTSLFPSLIYMFFGTSRHVALGVFAVVSLMSGSCNLRVTQEIISNNGTNMTSTEVE-AISINVVKSLGLAVGLIQIIMGLFKANYLISYLSDQIILGFTTGAAVHVLTAQLNKILGVALPRHSGIGKLFFIYQDLITAIIGEKVNVITFGASVVAIVILYISKYIL------------TPRFCAKTL--VPIPFDLFLIVIGTIIADWFQVEERWGVKVVGDIPTGFPNPALPDLF-------------MFRHVIGDALAIAIVSVVVTVSMGKVIAKKHNYEIDVRQEFFALGIVASTCSMFPCWPATTALARTLINDNAGTKTQISAIFSALVLTLVLFFIGQYLEGLPMCLLSCIVIVALRGMFLHLQNFV-TLWRVSKYDWAIFAITFFATVCLDVVPGLFIGTIFALLLSILRIQRSSPTLLDDDCAESGKTFVVFFASSLFYFNCERFDRKIQKIVAQITGE----KDISKAAVSTEDMAMIDSHKPQK--TVIFDMNGVSSIDLSGANLLVKIQKDLITND 554          
BLAST of slc26a-2 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 169.088 bits (427), Expect = 1.203e-44
Identity = 157/579 (27.12%), Postives = 273/579 (47.15%), Query Frame = 1
Query:  121 DYDLSACKN-SKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLV--AHYSLASEIPF----DITYSV--------------ILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNN---FFLSIY-DVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAV--MFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF-----------QVYENTS--HFQGSFLWFPFISKLTAMIDTM-EAENRM----------SITLDLTGVYSADSAIINTLIDIGHD 1701
            D D+   K  S F + + KY PI+EW+  Y++  +   D+++GL+VG+  +PQG+AY ++AG+ P YG++++F+   +Y  FGT++ ++IG  A+ S++V  A   LA +IP     DI  SV               L+L+ G +Q+I+G+  LGF+  Y+S  +VSGFT+ AA+ +   Q+  + G+K  R+      + +Y D+   L   N   +   I  ++          ++ + R +++    IV K          ILV+    I   +    E    ++   I +G P   LP    +N    +         +   IPI A++  +  M++GK FA+ + YK  ++QE  AIGI++ + SFF   P   S SR+++     + +    + +  ++L  +  L P+   +P   LA I+IV++  +FM   K L R ++I +YD   W    + ++   V  G++I +  S   +V     P F            V EN     F GS  +    + +TA  D M EA  ++          +I LD + V   D   ++ L D+  D
Sbjct:   12 DQDIVEKKECSPFRKKLQKYIPILEWLPNYQWKDHFHGDVIAGLTVGIMHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPISNSSDINPSVYPLGEYVDPLVFTSALTLLVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGIL----------FLDLGRTYINP---IVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVY-EIPRGFP---LPSIPRLNFLPAL---------LSDAIPI-AVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFM-QVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPSFSTVLHDETPRQNVPENVKIVKFAGSLHF----ANVTAFQDDMGEAIGKLPEEDPLIDERTIILDASSVAFIDIMGVDALRDVFKD 558          
BLAST of slc26a-2 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 169.088 bits (427), Expect = 1.203e-44
Identity = 157/579 (27.12%), Postives = 273/579 (47.15%), Query Frame = 1
Query:  121 DYDLSACKN-SKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLV--AHYSLASEIPF----DITYSV--------------ILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNN---FFLSIY-DVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAV--MFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF-----------QVYENTS--HFQGSFLWFPFISKLTAMIDTM-EAENRM----------SITLDLTGVYSADSAIINTLIDIGHD 1701
            D D+   K  S F + + KY PI+EW+  Y++  +   D+++GL+VG+  +PQG+AY ++AG+ P YG++++F+   +Y  FGT++ ++IG  A+ S++V  A   LA +IP     DI  SV               L+L+ G +Q+I+G+  LGF+  Y+S  +VSGFT+ AA+ +   Q+  + G+K  R+      + +Y D+   L   N   +   I  ++          ++ + R +++    IV K          ILV+    I   +    E    ++   I +G P   LP    +N    +         +   IPI A++  +  M++GK FA+ + YK  ++QE  AIGI++ + SFF   P   S SR+++     + +    + +  ++L  +  L P+   +P   LA I+IV++  +FM   K L R ++I +YD   W    + ++   V  G++I +  S   +V     P F            V EN     F GS  +    + +TA  D M EA  ++          +I LD + V   D   ++ L D+  D
Sbjct:   12 DQDIVEKKECSPFRKKLQKYIPILEWLPNYQWKDHFHGDVIAGLTVGIMHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPISNSSDINPSVYPLGEYVDPLVFTSALTLLVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGIL----------FLDLGRTYINP---IVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVY-EIPRGFP---LPSIPRLNFLPAL---------LSDAIPI-AVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFM-QVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPSFSTVLHDETPRQNVPENVKIVKFAGSLHF----ANVTAFQDDMGEAIGKLPEEDPLIDERTIILDASSVAFIDIMGVDALRDVFKD 558          
BLAST of slc26a-2 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 169.088 bits (427), Expect = 1.203e-44
Identity = 157/579 (27.12%), Postives = 273/579 (47.15%), Query Frame = 1
Query:  121 DYDLSACKN-SKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLV--AHYSLASEIPF----DITYSV--------------ILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNN---FFLSIY-DVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAV--MFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF-----------QVYENTS--HFQGSFLWFPFISKLTAMIDTM-EAENRM----------SITLDLTGVYSADSAIINTLIDIGHD 1701
            D D+   K  S F + + KY PI+EW+  Y++  +   D+++GL+VG+  +PQG+AY ++AG+ P YG++++F+   +Y  FGT++ ++IG  A+ S++V  A   LA +IP     DI  SV               L+L+ G +Q+I+G+  LGF+  Y+S  +VSGFT+ AA+ +   Q+  + G+K  R+      + +Y D+   L   N   +   I  ++          ++ + R +++    IV K          ILV+    I   +    E    ++   I +G P   LP    +N    +         +   IPI A++  +  M++GK FA+ + YK  ++QE  AIGI++ + SFF   P   S SR+++     + +    + +  ++L  +  L P+   +P   LA I+IV++  +FM   K L R ++I +YD   W    + ++   V  G++I +  S   +V     P F            V EN     F GS  +    + +TA  D M EA  ++          +I LD + V   D   ++ L D+  D
Sbjct:   12 DQDIVEKKECSPFRKKLQKYIPILEWLPNYQWKDHFHGDVIAGLTVGIMHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPISNSSDINPSVYPLGEYVDPLVFTSALTLLVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGIL----------FLDLGRTYINP---IVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVY-EIPRGFP---LPSIPRLNFLPAL---------LSDAIPI-AVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFM-QVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPSFSTVLHDETPRQNVPENVKIVKFAGSLHF----ANVTAFQDDMGEAIGKLPEEDPLIDERTIILDASSVAFIDIMGVDALRDVFKD 558          
BLAST of slc26a-2 vs. Ensembl Celegans
Match: sulp-2 (Anion transporter SULP-2; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EDS5])

HSP 1 Score: 162.925 bits (411), Expect = 2.114e-42
Identity = 130/472 (27.54%), Postives = 223/472 (47.25%), Query Frame = 1
Query:  160 RLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH-----YSLASEIPFDITY----SVILSL--MAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLK-RIRNNFFLS----IYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            ++I +  P+++WI  Y+     +D ++GL++G+  +PQ ++Y  +AGL P YGL+A+F+ PFLY IFG++K  +IG  +I  L+V           +E P   T      ++ SL  + G IQ ++ +F       ++    +S  T SA       QI  + G     RN  + S    I D+     ++N T   C   S +V L    +F     K     +S     ++         I +VI+T+   F+  +   G  +L   + +G P  ++P   I            IF++  +    +A++A    MA+G+ FA  + Y+I S+QE +A+G  NI  SFF   PT+ SFSRT +N +  +K+  SG+ +   + L +  + PY   +P   L+AI+IV +  M      L   W+  ++D   W  T V++L   +  GV  GI  +   I   + +P  ++
Sbjct:   39 KIILRRVPVIDWIGSYQINNFASDFIAGLTMGVYNVPQAMSYSILAGLPPVYGLYASFFPPFLYSIFGSAKHSSIGVFSITCLMVDKCVKKMLKFRNENPEKFTSVQAIEIVTSLCILTGIIQAVMAIFRCDKPMKFLGAPAISAITFSACFFGVVSQIPKLCGFSVPSRNEHWFSLVHSILDIFENCHKSN-TATLCISASALVFLIGSRIFIEPFFKNHKKLQSIPFPKEL---------ITIVIATSASYFFDFEHRFGVKTL-HTVPRGFPYPDVPRIDIW---------PYIFQDALS----IAVVAYAVTMAMGQEFATKHRYRIDSNQELLALGFINIGSSFFSVFPTSASFSRTLVNERSGAKTQLSGITSACFMALVITTIGPYLASLPSCILSAIVIVVLESMLRKCTVLPGLWRCSKHDFWIWIITAVVTLSSDIAQGVAAGIFTAIFTIAIQSQQPTIKL 486          
BLAST of slc26a-2 vs. Ensembl Fly
Match: Esp (gene:FBgn0013953 transcript:FBtr0304054)

HSP 1 Score: 321.242 bits (822), Expect = 1.707e-100
Identity = 199/553 (35.99%), Postives = 312/553 (56.42%), Query Frame = 1
Query:  130 LSACKNSKFYR-LITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLL------TCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGT-LSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEI----GTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF--QVYENTSHFQGSF------LWFPFISKLTAMIDTMEAENRMSITLDLTGVYSAD---SAIINTLIDIGHDFINRNK 1719
            L  C+   F R  + K  PI+ W+  Y       D+V+G++VGLTVIPQ LAY  +AGL   YGL+A+F G F+Y   G+ KD+ +GP+AI++LL    +  S        SV+L L++G ++L++GLF LGF+ +++S  V SGFTS+ +++I   QI+ +LG+    N F      V   +E T   D   G+  +V+LL      +C++      V     S  +R VNKILW +  + N ++V+   I+ + L   E G    + G I  GLP  +LP    +   ET    ++ F E+    G+G+ ++ LI+L+E +AI KAFA  NG  + +SQE IAIG +NI  SF Q+ P TG+ SR A+N+    ++P S + +G +V++AL FL PYF FIP+ +LAAIII AV+FM + K +   W+ K+ D +    TFV  L L +E+G+LIG+GL+ + I++ A+RPK   ++    S  + S       L FP +  +  +++       + + +D + VY AD   + +I++LI    DF  R +
Sbjct:   68 LQDCQRRTFNRKTLHKRLPILGWLPKYNSQDAVGDLVAGITVGLTVIPQALAYAGIAGLPVAYGLYASFVGCFVYIFLGSCKDVPMGPSAIVALLTYQAAQGS-----WQKSVLLCLLSGIVELLMGLFGLGFLIDFVSGPVSSGFTSAVSLIILTSQIQSVLGITAKGNTFVEIWTQVFHNIEHTRAGDTVLGLTCIVILLLMRSLSSCRI----GPVDEKECSSFQRAVNKILWIVGTARNAILVVVCCIMGYMLHTEEHGAPFRVVGEIPPGLPSIQLPP-TSLTANETSNGVAEGFVEMVHSMGSGLVVIPLISLMENIAICKAFA--NGKPVDASQELIAIGTANIFNSFVQAFPGTGALSRGAVNNASGVRTPLSNIYSGGLVMIALLFLTPYFYFIPRPTLAAIIISAVVFMIEVKVVKPMWRSKKSDLVPGVGTFVACLVLPLEWGILIGVGLNVIFILYHAARPKLSTELLTTQSGVEYSMITPDRCLIFPSVDYVRNLVNKQSIRQNVPVVIDASHVYGADFTTATVIDSLIS---DFNQRGQ 605          
BLAST of slc26a-2 vs. Ensembl Fly
Match: Esp (gene:FBgn0013953 transcript:FBtr0084703)

HSP 1 Score: 321.242 bits (822), Expect = 1.707e-100
Identity = 199/553 (35.99%), Postives = 312/553 (56.42%), Query Frame = 1
Query:  130 LSACKNSKFYR-LITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLL------TCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGT-LSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEI----GTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF--QVYENTSHFQGSF------LWFPFISKLTAMIDTMEAENRMSITLDLTGVYSAD---SAIINTLIDIGHDFINRNK 1719
            L  C+   F R  + K  PI+ W+  Y       D+V+G++VGLTVIPQ LAY  +AGL   YGL+A+F G F+Y   G+ KD+ +GP+AI++LL    +  S        SV+L L++G ++L++GLF LGF+ +++S  V SGFTS+ +++I   QI+ +LG+    N F      V   +E T   D   G+  +V+LL      +C++      V     S  +R VNKILW +  + N ++V+   I+ + L   E G    + G I  GLP  +LP    +   ET    ++ F E+    G+G+ ++ LI+L+E +AI KAFA  NG  + +SQE IAIG +NI  SF Q+ P TG+ SR A+N+    ++P S + +G +V++AL FL PYF FIP+ +LAAIII AV+FM + K +   W+ K+ D +    TFV  L L +E+G+LIG+GL+ + I++ A+RPK   ++    S  + S       L FP +  +  +++       + + +D + VY AD   + +I++LI    DF  R +
Sbjct:   68 LQDCQRRTFNRKTLHKRLPILGWLPKYNSQDAVGDLVAGITVGLTVIPQALAYAGIAGLPVAYGLYASFVGCFVYIFLGSCKDVPMGPSAIVALLTYQAAQGS-----WQKSVLLCLLSGIVELLMGLFGLGFLIDFVSGPVSSGFTSAVSLIILTSQIQSVLGITAKGNTFVEIWTQVFHNIEHTRAGDTVLGLTCIVILLLMRSLSSCRI----GPVDEKECSSFQRAVNKILWIVGTARNAILVVVCCIMGYMLHTEEHGAPFRVVGEIPPGLPSIQLPP-TSLTANETSNGVAEGFVEMVHSMGSGLVVIPLISLMENIAICKAFA--NGKPVDASQELIAIGTANIFNSFVQAFPGTGALSRGAVNNASGVRTPLSNIYSGGLVMIALLFLTPYFYFIPRPTLAAIIISAVVFMIEVKVVKPMWRSKKSDLVPGVGTFVACLVLPLEWGILIGVGLNVIFILYHAARPKLSTELLTTQSGVEYSMITPDRCLIFPSVDYVRNLVNKQSIRQNVPVVIDASHVYGADFTTATVIDSLIS---DFNQRGQ 605          
BLAST of slc26a-2 vs. Ensembl Fly
Match: CG9702 (gene:FBgn0039787 transcript:FBtr0336448)

HSP 1 Score: 293.893 bits (751), Expect = 9.039e-90
Identity = 181/540 (33.52%), Postives = 291/540 (53.89%), Query Frame = 1
Query:  160 RLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKS--RRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVI--MNGTETV-------KTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQG---------SFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNK 1719
            + + K  P + W+ +Y       D+++G +VGLTVIPQGLAY  V GL P+YGL+ +F G F+Y + GT KD TIG TA+ SL+   ++  S        SV+L+ + G I++++ +F LG +  ++S  V +GFTS+ A+++   Q++ +LG+K    +F  +   +   +E   + D   G   V++LL  + L  +    +    ++  +R+VN ++ F+  S N  VVI  T +  YL         LTGNI KG+P   LP F I    G ET        +T  ++ + +G G+ IV L+AL+E M++ KAFA+  G +I  +QE IA G+ NI  S F      G  +R+A+N+    ++  S +  G +V+LAL FL  Y  FIPKA LAAIII AV+F   ++ +   W+ KR D +     FV  L L +E G+++ IG++ L I++ A+RPK  + E     QG           L FP +  +  M+  + +++ + + +D T +Y+AD      +  I  DF  R +
Sbjct:   72 KTLLKRLPFLTWLPHYNRQDCIGDLIAGFTVGLTVIPQGLAYSGVVGLPPEYGLYGSFMGCFVYVLLGTCKDSTIGSTAVASLMTFQFAQGS-----WQRSVLLTFLTGIIEILMAIFKLGCLVEFVSGPVSAGFTSAVALIVSTSQMRSMLGVKSDGGSFLATWISMFRDIENVRVADTCLGFGCVILLLAMRSLGKFTIGPKDESRRNGFQRVVNTVIKFLSTSRNASVVILFTAVTMYLDANGTNPFRLTGNIPKGMPTPSLPPFSIEPQPGNETAGIPAVEGQTFPEMVQSLGYGLVIVPLMALLETMSVCKAFAK--GKQIDITQEMIACGVGNIATSLFSGYRCNGGLARSAVNNASGCRTNMSNLYIGVIVVLALNFLTEYIAFIPKAVLAAIIISAVIFQVQYQVVTPMWRSKRSDLVPGILAFVTCLVLPLEIGIMVAIGVNLLFILYYAARPKVTL-EQLETQQGIRFVKITPDRCLIFPSVEFVRNMVLKLGSKSTLPVVIDCTYIYAADFTAAKVISSIVDDFRRRQQ 603          
BLAST of slc26a-2 vs. Ensembl Fly
Match: CG9702 (gene:FBgn0039787 transcript:FBtr0085664)

HSP 1 Score: 293.893 bits (751), Expect = 9.039e-90
Identity = 181/540 (33.52%), Postives = 291/540 (53.89%), Query Frame = 1
Query:  160 RLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKS--RRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVI--MNGTETV-------KTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQG---------SFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNK 1719
            + + K  P + W+ +Y       D+++G +VGLTVIPQGLAY  V GL P+YGL+ +F G F+Y + GT KD TIG TA+ SL+   ++  S        SV+L+ + G I++++ +F LG +  ++S  V +GFTS+ A+++   Q++ +LG+K    +F  +   +   +E   + D   G   V++LL  + L  +    +    ++  +R+VN ++ F+  S N  VVI  T +  YL         LTGNI KG+P   LP F I    G ET        +T  ++ + +G G+ IV L+AL+E M++ KAFA+  G +I  +QE IA G+ NI  S F      G  +R+A+N+    ++  S +  G +V+LAL FL  Y  FIPKA LAAIII AV+F   ++ +   W+ KR D +     FV  L L +E G+++ IG++ L I++ A+RPK  + E     QG           L FP +  +  M+  + +++ + + +D T +Y+AD      +  I  DF  R +
Sbjct:   72 KTLLKRLPFLTWLPHYNRQDCIGDLIAGFTVGLTVIPQGLAYSGVVGLPPEYGLYGSFMGCFVYVLLGTCKDSTIGSTAVASLMTFQFAQGS-----WQRSVLLTFLTGIIEILMAIFKLGCLVEFVSGPVSAGFTSAVALIVSTSQMRSMLGVKSDGGSFLATWISMFRDIENVRVADTCLGFGCVILLLAMRSLGKFTIGPKDESRRNGFQRVVNTVIKFLSTSRNASVVILFTAVTMYLDANGTNPFRLTGNIPKGMPTPSLPPFSIEPQPGNETAGIPAVEGQTFPEMVQSLGYGLVIVPLMALLETMSVCKAFAK--GKQIDITQEMIACGVGNIATSLFSGYRCNGGLARSAVNNASGCRTNMSNLYIGVIVVLALNFLTEYIAFIPKAVLAAIIISAVIFQVQYQVVTPMWRSKRSDLVPGILAFVTCLVLPLEIGIMVAIGVNLLFILYYAARPKVTL-EQLETQQGIRFVKITPDRCLIFPSVEFVRNMVLKLGSKSTLPVVIDCTYIYAADFTAAKVISSIVDDFRRRQQ 603          
BLAST of slc26a-2 vs. Ensembl Fly
Match: CG5002 (gene:FBgn0034275 transcript:FBtr0089546)

HSP 1 Score: 288.115 bits (736), Expect = 1.698e-88
Identity = 176/470 (37.45%), Postives = 271/470 (57.66%), Query Frame = 1
Query:  118 QDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILW-FICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            +D     C+ S     +T  FPI++W+  YR  Y+  D ++G +VGLT IPQ +AYG VAGL PQYGL++AF G F Y +FG+ KD+TI  TAI++L+V  Y+  S       Y+V++  +AG I L+LGL ++G +  ++S  V++GFT +AA  IG  QI  I+GL    N+   +  +  + L    L D   G+ S+V LL             +   K  +  N+I W ++ +S N L VI  T LA+ L +       +TGNI  G+P F LP F      E V +  ++   +G  +  + LI+++E +AI KAF++  G  + +SQE +A+G+ NI+GSF  S+P TGSF+RTA+N+    K+P  G +TG +VL+AL FL   F FIPK +LAAIII A++ + +   +   WK K+ D   +  T +  +   +EYG+L GIG + + I++ ++RP   +
Sbjct:   21 RDGGRKLCRPST----VTNKFPILKWLPRYRLEYIMQDFIAGFTVGLTTIPQAIAYGVVAGLEPQYGLYSAFMGCFTYIVFGSCKDVTIATTAIMALMVNQYATISP-----DYAVLVCFLAGCIVLLLGLLNMGVLVRFISIPVITGFTMAAATTIGSAQINNIVGLTSPSNDLLPAWKNFFTHLTSIRLWDALLGVSSLVFLLL------------MTRVKDIKWGNRIFWKYLGLSRNALAVIFGTFLAYILSRDGNQPFRVTGNITAGVPPFRLPPFSTTVDGEYV-SFGEMISTVGASLGSIPLISILEIVAISKAFSK--GKIVDASQEMVALGMCNIMGSFVLSMPVTGSFTRTAVNNASGVKTPLGGAVTGALVLMALAFLTQTFYFIPKCTLAAIIIAAMISLVELHKIKDMWKSKKKDLFPFVVTVLTCMFWSLEYGILCGIGANMVYILYSSARPHVDI 466          
BLAST of slc26a-2 vs. Ensembl Zebrafish
Match: slc26a11 (solute carrier family 26 member 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5349])

HSP 1 Score: 362.459 bits (929), Expect = 4.449e-117
Identity = 214/519 (41.23%), Postives = 310/519 (59.73%), Query Frame = 1
Query:  178 FPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDF--VIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQ--GSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRN 1716
            FPI+ W+  Y  T+LK D+++GL+VGLT +PQ LAY  VAGL  QYGL++AF G F+Y IFGTSKD+T+GPTAI+SLL + Y     I  D  ++V+L+L+ G IQ  + L  LGF+ +++S  V+ GFT +AA+ IG+GQ+K ILGLK I   FFL +Y    K+ E  + D+  G+  +  LL    +   +S      S   R   ++LW +    N LVVI+   +A+  +       SLTG   KGLP F  P     I NGT  V T S I K++G G+ ++ L+ ++E++AI KAF   N Y+I ++QE  AIG++NI+GSF  + P TGSF RTA+NSQ    SP  G+IT  +VLL+L FL P F +IPKASLAA+II AV  M DF+     W++KR D + +  TF+LS    V+YG+  G+ +S   +++I +RPK +V ++        + L FP    L+ ++    + A    S+ LD + + S D  +I+ L D+   F  R 
Sbjct:   15 FPIITWLPRYNLTWLKMDVIAGLTVGLTAVPQALAYAEVAGLPVQYGLYSAFMGGFIYCIFGTSKDITLGPTAIMSLLCSSY-----ITGDPVFAVVLTLLCGVIQTGMALLRLGFLLDFISYPVIKGFTCAAAVTIGFGQVKNILGLKEIPQQFFLQVYYTFHKIPEARVGDVILGLSCLFFLLILTFMKNSLSSAEDEASFLVRSARQLLWSLATIRNALVVIAAAGVAYSAEVTGNHFFSLTGKTAKGLPPFRAPPLSETIANGT--VITFSDIAKDLGGGLAVIPLMGVLESIAIAKAFGSKNNYRIDANQELFAIGLTNIMGSFVSAYPVTGSFGRTAVNSQTGVCSPAGGIITSVIVLLSLAFLMPLFFYIPKASLAAVIICAVSPMVDFRVPLHIWRVKRLDLLPFLVTFLLSF-WEVQYGIAGGVLVSAFMLLYIMARPKVKVSDHGVIVLEIDNGLNFPSTEHLSRLVYKHALHASPPRSLVLDCSQISSIDFTVIHELTDLLKQFQIRG 525          
BLAST of slc26a-2 vs. Ensembl Zebrafish
Match: slc26a11 (solute carrier family 26 member 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5349])

HSP 1 Score: 362.459 bits (929), Expect = 4.449e-117
Identity = 214/519 (41.23%), Postives = 310/519 (59.73%), Query Frame = 1
Query:  178 FPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDF--VIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQ--GSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRN 1716
            FPI+ W+  Y  T+LK D+++GL+VGLT +PQ LAY  VAGL  QYGL++AF G F+Y IFGTSKD+T+GPTAI+SLL + Y     I  D  ++V+L+L+ G IQ  + L  LGF+ +++S  V+ GFT +AA+ IG+GQ+K ILGLK I   FFL +Y    K+ E  + D+  G+  +  LL    +   +S      S   R   ++LW +    N LVVI+   +A+  +       SLTG   KGLP F  P     I NGT  V T S I K++G G+ ++ L+ ++E++AI KAF   N Y+I ++QE  AIG++NI+GSF  + P TGSF RTA+NSQ    SP  G+IT  +VLL+L FL P F +IPKASLAA+II AV  M DF+     W++KR D + +  TF+LS    V+YG+  G+ +S   +++I +RPK +V ++        + L FP    L+ ++    + A    S+ LD + + S D  +I+ L D+   F  R 
Sbjct:   15 FPIITWLPRYNLTWLKMDVIAGLTVGLTAVPQALAYAEVAGLPVQYGLYSAFMGGFIYCIFGTSKDITLGPTAIMSLLCSSY-----ITGDPVFAVVLTLLCGVIQTGMALLRLGFLLDFISYPVIKGFTCAAAVTIGFGQVKNILGLKEIPQQFFLQVYYTFHKIPEARVGDVILGLSCLFFLLILTFMKNSLSSAEDEASFLVRSARQLLWSLATIRNALVVIAAAGVAYSAEVTGNHFFSLTGKTAKGLPPFRAPPLSETIANGT--VITFSDIAKDLGGGLAVIPLMGVLESIAIAKAFGSKNNYRIDANQELFAIGLTNIMGSFVSAYPVTGSFGRTAVNSQTGVCSPAGGIITSVIVLLSLAFLMPLFFYIPKASLAAVIICAVSPMVDFRVPLHIWRVKRLDLLPFLVTFLLSF-WEVQYGIAGGVLVSAFMLLYIMARPKVKVSDHGVIVLEIDNGLNFPSTEHLSRLVYKHALHASPPRSLVLDCSQISSIDFTVIHELTDLLKQFQIRG 525          
BLAST of slc26a-2 vs. Ensembl Zebrafish
Match: slc26a6l (solute carrier family 26 member 6, like [Source:ZFIN;Acc:ZDB-GENE-080220-10])

HSP 1 Score: 225.713 bits (574), Expect = 2.119e-63
Identity = 147/507 (28.99%), Postives = 258/507 (50.89%), Query Frame = 1
Query:  136 ACKNSKFYRLITKYFPIVEWIQYYR-FTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVA----------------------HYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIY----DVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRT---WKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWF 1566
            +C   +  R I  + P++ W+  Y  + Y   D++SG+SVG+  +PQG+AY  +A L P +GL+ + +   +YFIFGTS+ +++G   ILS+++                          +AS   + +  +   +++ G IQ++LGL   GF+  Y+S  +V G+T++A+      Q+KYILG+   R N  LSI     D+ + L ET+L  +   +VS+VVL+T K          L+ +  ++++      I I   +  ++  T+++FY +  E   +S+ G+I  GL    +P+  I             F E+      +A++    ++++GK FA  +GYK+ S+QE +A+G+SN VG FFQ      S SR+ I      K+  +GV++G +VL+ +  L   F  +PKA L+AI+ V +  M  FK  Y     W+  + D + W  TFV ++   ++ G+   +G + L ++F   RP + +     H  G+ L+ 
Sbjct:   45 SCSVPRIKRSIVGFLPVLSWLPRYSIWDYGMPDLISGISVGIMHLPQGMAYALLASLPPVFGLYTSLYPSLIYFIFGTSRHISVGTFTILSIMIGSVTERLAPDTDFLIYNGTNVTGEVDIASRDLYRVQVAAAATVLGGLIQVVLGLVQFGFVGTYLSEPLVRGYTTAASAHAVVAQLKYILGVSPKRFNGPLSIVYTLVDLFTLLPETHLPTLVASVVSIVVLITAK---------ELNNALKKKMI------IPIPVELCTIVVATVISFYTRLNESYKISVVGDIPSGLQPPSVPNVYI-------------FSEVVLDAFAMAIVGYAISISLGKTFALKHGYKVESNQELVALGLSNTVGGFFQCFSVCSSMSRSLIQESTGGKTQIAGVVSGVIVLVTVLKLGSLFQELPKAVLSAIVFVNLKGM--FKQYYDIVTLWRSNKIDLLIWLVTFVSTVLFNLDMGLGASMGFALLTVIFRTQRPSYSLL---GHLPGTELYL 518          
BLAST of slc26a-2 vs. Ensembl Zebrafish
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 199.519 bits (506), Expect = 3.196e-54
Identity = 138/499 (27.66%), Postives = 248/499 (49.70%), Query Frame = 1
Query:  109 MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYY--RFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYS--LASEIPF-------------------DITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIR----NNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAV--MFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF 1518
            + ++  D   C   ++   I  + P++ WI  Y  R   L  D+VSG+SVG+  +PQG+AY  +A + P +GL+ +F+   +YFIFGTSK ++IG  A++S+++   S  LA +  F                    +  +   +L+ G  Q++LG+   GF+  Y+S  +V G+T+ AA      Q+KY+ G+   R         ++ ++C  L +T++  +   +VS+  L         V VK ++   S R+       + I   ++V+ + T+++ Y +   I  + + G I KGL    +P+                F  +      VA++    ++++GK FA  +GYK+ S+QE +A+G+SN +G FFQ    T S SR+ I      K+  +G+I+  +VL+ +  L P F  +P A L+ I+ V +  MFM   + L   W+  + D + W  TF+ ++ L ++ G+   I  + L ++F   RP++
Sbjct:   44 LKEKIRDSLRCTVGQWKVWILAWMPVLSWIPCYSIRENGL-GDLVSGVSVGIMHLPQGMAYALLASVPPVFGLYTSFYPVLVYFIFGTSKHISIGTFAVISIMIGSVSERLAPDGHFLTNGTNGLVVVDTEARDLQRLKVAAATTLLCGIFQVLLGVVRFGFVVTYLSEPLVRGYTTGAAAHAITAQLKYMFGVSPRRFTGPLQLLYTLVELCGLLPQTHVPTLVVSLVSLTAL---------VIVKEINSCYSHRLP------LPIPIELMVITAGTLISHYTEMKTINGVDVVGEIPKGLMPPRVPEVCF-------------FSSVAGDAFAVAVVGYAISISLGKIFALKHGYKVDSNQELVALGLSNTIGGFFQCYAVTSSMSRSLIQESTGGKTQVAGLISAVIVLITVLKLGPLFEELPTAVLSTIVFVNLKGMFM-QCRDLPALWRSNKVDLLVWLVTFLCTVLLNLDLGLAASITFTLLTVIFRTQRPRY 512          
BLAST of slc26a-2 vs. Ensembl Zebrafish
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 199.134 bits (505), Expect = 3.387e-54
Identity = 138/501 (27.54%), Postives = 249/501 (49.70%), Query Frame = 1
Query:  109 MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYY--RFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYS--LASEIPF-------------------DITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIR----NNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAV--MFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            + ++  D   C   ++   I  + P++ WI  Y  R   L  D+VSG+SVG+  +PQG+AY  +A + P +GL+ +F+   +YFIFGTSK ++IG  A++S+++   S  LA +  F                    +  +   +L+ G  Q++LG+   GF+  Y+S  +V G+T+ AA      Q+KY+ G+   R         ++ ++C  L +T++  +   +VS+  L         V VK ++   S R+       + I   ++V+ + T+++ Y +   I  + + G I KGL    +P+                F  +      VA++    ++++GK FA  +GYK+ S+QE +A+G+SN +G FFQ    T S SR+ I      K+  +G+I+  +VL+ +  L P F  +P A L+ I+ V +  MFM   + L   W+  + D + W  TF+ ++ L ++ G+   I  + L ++F   RP++ +
Sbjct:   44 LKEKIRDSLRCTVGQWKVWILAWMPVLSWIPCYSIRENGL-GDLVSGVSVGIMHLPQGMAYALLASVPPVFGLYTSFYPVLVYFIFGTSKHISIGTFAVISIMIGSVSERLAPDGHFLTNGTNGLVVVDTEARDLQRLKVAAATTLLCGIFQVLLGVVRFGFVVTYLSEPLVRGYTTGAAAHAITAQLKYMFGVSPRRFTGPLQLLYTLVELCGLLPQTHVPTLVVSLVSLTAL---------VIVKEINSCYSHRLP------LPIPIELMVITAGTLISHYTEMKTINGVDVVGEIPKGLMPPRVPEVCF-------------FSSVAGDAFAVAVVGYAISISLGKIFALKHGYKVDSNQELVALGLSNTIGGFFQCYAVTSSMSRSLIQESTGGKTQVAGLISAVIVLITVLKLGPLFEELPTAVLSTIVFVNLKGMFM-QCRDLPALWRSNKVDLLVWLVTFLCTVLLNLDLGLAASITFTLLTVIFRTQRPRYSL 514          
BLAST of slc26a-2 vs. Ensembl Xenopus
Match: cnga1 (cyclic nucleotide gated channel alpha 1 [Source:Xenbase;Acc:XB-GENE-950954])

HSP 1 Score: 357.451 bits (916), Expect = 4.260e-115
Identity = 213/527 (40.42%), Postives = 321/527 (60.91%), Query Frame = 1
Query:  166 ITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDF--VIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVY----ENTSHFQG------SFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDF 1704
            + K  P ++W+  Y   +L+ DI++G++VGLTV+PQ LAY  VAGL  Q+GL+++F G F+Y   GTSKD+T+GPTAI+SLLV  Y+L      D++ +++L+ ++G IQL +GL + GF+ +++S  V+  FTS+AAI I + Q+K +LGL+ I   F L +Y    KL  T   D   GI+ + +LL  K +  + S     +S   RI   I+W +  + N L+V+   ++A+    M +    LTG   KGLP+F+LP F  +  NGT   KT S++ + IG+GI I+ L+ L+E++AI +AFA  N Y+I+++QE +AIG++NI+GSF  S P TGSF RTA+NSQ    +P  G+ITG +VLL+L +L P F FIPKA+LAA+II AV  M D +     WK+KR D I +F TF+LS    ++YG+L G  +S + + +  +RP+ +V      N S   G      S L FP +  L   I   T    +  S+TLD T V + D  ++  L ++  +F
Sbjct:   28 LQKRLPFLQWLPRYSLQWLQLDIIAGITVGLTVVPQALAYAEVAGLPVQFGLYSSFVGCFIYCFLGTSKDVTLGPTAIMSLLVFVYTLG-----DLSLAILLTFISGCIQLAMGLLNFGFLLDFISYPVIKAFTSAAAITIAFSQVKNLLGLQDIPRQFILQVYQTFRKLPSTRPGDAILGILCIAILLALKWMKDHTSRPYQGMSICHRICYLIVWIMTTARNALIVVGAGLVAYSFHVMGLHPFILTGKTAKGLPQFQLPPFSEITPNGT---KTFSEMVQVIGSGILIIPLMGLLESVAIARAFASQNNYRIKTNQELLAIGLTNILGSFLSSYPVTGSFGRTALNSQTGVCTPAGGIITGLLVLLSLGYLTPAFYFIPKAALAAVIICAVAPMFDLRICKSMWKVKRLDLIPFFVTFLLSF-WEIQYGILAGTFVSIIFLCYPIARPEIKVSLPVGHNVSDMDGLILTPMSGLSFPAMEYLKDKIYEKTFTVSSPQSVTLDFTHVTAIDYTVVVGLAELLSEF 545          
BLAST of slc26a-2 vs. Ensembl Xenopus
Match: cnga1 (cyclic nucleotide gated channel alpha 1 [Source:Xenbase;Acc:XB-GENE-950954])

HSP 1 Score: 357.451 bits (916), Expect = 6.424e-115
Identity = 213/527 (40.42%), Postives = 321/527 (60.91%), Query Frame = 1
Query:  166 ITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDF--VIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVY----ENTSHFQG------SFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDF 1704
            + K  P ++W+  Y   +L+ DI++G++VGLTV+PQ LAY  VAGL  Q+GL+++F G F+Y   GTSKD+T+GPTAI+SLLV  Y+L      D++ +++L+ ++G IQL +GL + GF+ +++S  V+  FTS+AAI I + Q+K +LGL+ I   F L +Y    KL  T   D   GI+ + +LL  K +  + S     +S   RI   I+W +  + N L+V+   ++A+    M +    LTG   KGLP+F+LP F  +  NGT   KT S++ + IG+GI I+ L+ L+E++AI +AFA  N Y+I+++QE +AIG++NI+GSF  S P TGSF RTA+NSQ    +P  G+ITG +VLL+L +L P F FIPKA+LAA+II AV  M D +     WK+KR D I +F TF+LS    ++YG+L G  +S + + +  +RP+ +V      N S   G      S L FP +  L   I   T    +  S+TLD T V + D  ++  L ++  +F
Sbjct:   24 LQKRLPFLQWLPRYSLQWLQLDIIAGITVGLTVVPQALAYAEVAGLPVQFGLYSSFVGCFIYCFLGTSKDVTLGPTAIMSLLVFVYTLG-----DLSLAILLTFISGCIQLAMGLLNFGFLLDFISYPVIKAFTSAAAITIAFSQVKNLLGLQDIPRQFILQVYQTFRKLPSTRPGDAILGILCIAILLALKWMKDHTSRPYQGMSICHRICYLIVWIMTTARNALIVVGAGLVAYSFHVMGLHPFILTGKTAKGLPQFQLPPFSEITPNGT---KTFSEMVQVIGSGILIIPLMGLLESVAIARAFASQNNYRIKTNQELLAIGLTNILGSFLSSYPVTGSFGRTALNSQTGVCTPAGGIITGLLVLLSLGYLTPAFYFIPKAALAAVIICAVAPMFDLRICKSMWKVKRLDLIPFFVTFLLSF-WEIQYGILAGTFVSIIFLCYPIARPEIKVSLPVGHNVSDMDGLILTPMSGLSFPAMEYLKDKIYEKTFTVSSPQSVTLDFTHVTAIDYTVVVGLAELLSEF 541          
BLAST of slc26a-2 vs. Ensembl Xenopus
Match: cnga1 (cyclic nucleotide gated channel alpha 1 [Source:Xenbase;Acc:XB-GENE-950954])

HSP 1 Score: 355.14 bits (910), Expect = 2.323e-114
Identity = 212/523 (40.54%), Postives = 320/523 (61.19%), Query Frame = 1
Query:  166 ITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDF--VIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQG------SFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDF 1704
            + K  P ++W+  Y   +L+ DI++G++VGLTV+PQ LAY  VAGL  Q+GL+++F G F+Y   GTSKD+T+GPTAI+SLLV  Y+L      D++ +++L+ ++G IQL +GL + GF+ +++S  V+  FTS+AAI I + Q+K +LGL+ I   F L +Y    KL  T   D   GI+ + +LL  K +  + S     +S   RI   I+W +  + N L+V+   ++A+    M +    LTG   KGLP+F+LP F  +  NGT   KT S++ + IG+GI I+ L+ L+E++AI +AFA  N Y+I+++QE +AIG++NI+GSF  S P TGSF RTA+NSQ    +P  G+ITG +VLL+L +L P F FIPKA+LAA+II AV  M D +     WK+KR D I +F TF+LS    ++YG+L G  +S + + +  +RP+ +V    S   G      S L FP +  L   I   T    +  S+TLD T V + D  ++  L ++  +F
Sbjct:    8 LQKRLPFLQWLPRYSLQWLQLDIIAGITVGLTVVPQALAYAEVAGLPVQFGLYSSFVGCFIYCFLGTSKDVTLGPTAIMSLLVFVYTLG-----DLSLAILLTFISGCIQLAMGLLNFGFLLDFISYPVIKAFTSAAAITIAFSQVKNLLGLQDIPRQFILQVYQTFRKLPSTRPGDAILGILCIAILLALKWMKDHTSRPYQGMSICHRICYLIVWIMTTARNALIVVGAGLVAYSFHVMGLHPFILTGKTAKGLPQFQLPPFSEITPNGT---KTFSEMVQVIGSGILIIPLMGLLESVAIARAFASQNNYRIKTNQELLAIGLTNILGSFLSSYPVTGSFGRTALNSQTGVCTPAGGIITGLLVLLSLGYLTPAFYFIPKAALAAVIICAVAPMFDLRICKSMWKVKRLDLIPFFVTFLLSF-WEIQYGILAGTFVSIIFLCYPIARPEIKV----SDMDGLILTPMSGLSFPAMEYLKDKIYEKTFTVSSPQSVTLDFTHVTAIDYTVVVGLAELLSEF 517          
BLAST of slc26a-2 vs. Ensembl Xenopus
Match: cnga1 (cyclic nucleotide gated channel alpha 1 [Source:Xenbase;Acc:XB-GENE-950954])

HSP 1 Score: 356.295 bits (913), Expect = 3.975e-114
Identity = 212/523 (40.54%), Postives = 320/523 (61.19%), Query Frame = 1
Query:  166 ITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDF--VIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQG------SFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDF 1704
            + K  P ++W+  Y   +L+ DI++G++VGLTV+PQ LAY  VAGL  Q+GL+++F G F+Y   GTSKD+T+GPTAI+SLLV  Y+L      D++ +++L+ ++G IQL +GL + GF+ +++S  V+  FTS+AAI I + Q+K +LGL+ I   F L +Y    KL  T   D   GI+ + +LL  K +  + S     +S   RI   I+W +  + N L+V+   ++A+    M +    LTG   KGLP+F+LP F  +  NGT   KT S++ + IG+GI I+ L+ L+E++AI +AFA  N Y+I+++QE +AIG++NI+GSF  S P TGSF RTA+NSQ    +P  G+ITG +VLL+L +L P F FIPKA+LAA+II AV  M D +     WK+KR D I +F TF+LS    ++YG+L G  +S + + +  +RP+ +V    S   G      S L FP +  L   I   T    +  S+TLD T V + D  ++  L ++  +F
Sbjct:   26 LQKRLPFLQWLPRYSLQWLQLDIIAGITVGLTVVPQALAYAEVAGLPVQFGLYSSFVGCFIYCFLGTSKDVTLGPTAIMSLLVFVYTLG-----DLSLAILLTFISGCIQLAMGLLNFGFLLDFISYPVIKAFTSAAAITIAFSQVKNLLGLQDIPRQFILQVYQTFRKLPSTRPGDAILGILCIAILLALKWMKDHTSRPYQGMSICHRICYLIVWIMTTARNALIVVGAGLVAYSFHVMGLHPFILTGKTAKGLPQFQLPPFSEITPNGT---KTFSEMVQVIGSGILIIPLMGLLESVAIARAFASQNNYRIKTNQELLAIGLTNILGSFLSSYPVTGSFGRTALNSQTGVCTPAGGIITGLLVLLSLGYLTPAFYFIPKAALAAVIICAVAPMFDLRICKSMWKVKRLDLIPFFVTFLLSF-WEIQYGILAGTFVSIIFLCYPIARPEIKV----SDMDGLILTPMSGLSFPAMEYLKDKIYEKTFTVSSPQSVTLDFTHVTAIDYTVVVGLAELLSEF 535          
BLAST of slc26a-2 vs. Ensembl Xenopus
Match: cnga1 (cyclic nucleotide gated channel alpha 1 [Source:Xenbase;Acc:XB-GENE-950954])

HSP 1 Score: 355.91 bits (912), Expect = 4.027e-114
Identity = 212/523 (40.54%), Postives = 320/523 (61.19%), Query Frame = 1
Query:  166 ITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDF--VIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQG------SFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDF 1704
            + K  P ++W+  Y   +L+ DI++G++VGLTV+PQ LAY  VAGL  Q+GL+++F G F+Y   GTSKD+T+GPTAI+SLLV  Y+L      D++ +++L+ ++G IQL +GL + GF+ +++S  V+  FTS+AAI I + Q+K +LGL+ I   F L +Y    KL  T   D   GI+ + +LL  K +  + S     +S   RI   I+W +  + N L+V+   ++A+    M +    LTG   KGLP+F+LP F  +  NGT   KT S++ + IG+GI I+ L+ L+E++AI +AFA  N Y+I+++QE +AIG++NI+GSF  S P TGSF RTA+NSQ    +P  G+ITG +VLL+L +L P F FIPKA+LAA+II AV  M D +     WK+KR D I +F TF+LS    ++YG+L G  +S + + +  +RP+ +V    S   G      S L FP +  L   I   T    +  S+TLD T V + D  ++  L ++  +F
Sbjct:   26 LQKRLPFLQWLPRYSLQWLQLDIIAGITVGLTVVPQALAYAEVAGLPVQFGLYSSFVGCFIYCFLGTSKDVTLGPTAIMSLLVFVYTLG-----DLSLAILLTFISGCIQLAMGLLNFGFLLDFISYPVIKAFTSAAAITIAFSQVKNLLGLQDIPRQFILQVYQTFRKLPSTRPGDAILGILCIAILLALKWMKDHTSRPYQGMSICHRICYLIVWIMTTARNALIVVGAGLVAYSFHVMGLHPFILTGKTAKGLPQFQLPPFSEITPNGT---KTFSEMVQVIGSGILIIPLMGLLESVAIARAFASQNNYRIKTNQELLAIGLTNILGSFLSSYPVTGSFGRTALNSQTGVCTPAGGIITGLLVLLSLGYLTPAFYFIPKAALAAVIICAVAPMFDLRICKSMWKVKRLDLIPFFVTFLLSF-WEIQYGILAGTFVSIIFLCYPIARPEIKV----SDMDGLILTPMSGLSFPAMEYLKDKIYEKTFTVSSPQSVTLDFTHVTAIDYTVVVGLAELLSEF 535          
BLAST of slc26a-2 vs. Ensembl Mouse
Match: Slc26a11 (solute carrier family 26, member 11 [Source:MGI Symbol;Acc:MGI:2444589])

HSP 1 Score: 353.984 bits (907), Expect = 1.366e-113
Identity = 210/570 (36.84%), Postives = 338/570 (59.30%), Query Frame = 1
Query:  127 DLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMIDT--MEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAK 1824
            D   C  +   R +    P++ W+  Y   +L+ D ++GLSVGLTVIPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +GL  LGF+ +++S  V+ GFTS+A+I IG+GQIK +LGL++I   FFL +Y     + ET + D   G+ S+++LL  K +  ++      +  + +    ++W +  + N LVV S  ++A+  +        LTG I +GLP   +P F +    +T+ + S++ +++G G+ +V L+ L+E++A+ K+FA  N Y+I ++QE +AIG++N++GS   S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II AV  + D K     W+++R D +    TF+LS    ++YG+L G  +S L ++   +RPK QV E         S L+FP I  L   I    +EA    S  L+ T + S D  +I  L ++  DF  + K + +     Q+  +   + AD  G + + ++E+A+
Sbjct:    4 DTCCCSATALRRRL----PVLAWVPDYSLQWLRLDFIAGLSVGLTVIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFR-----EPAYAVLLAFLSGCIQLAMGLLHLGFLLDFISCPVIKGFTSAASITIGFGQIKNLLGLQKIPRQFFLQVYHTFLHIGETRVGDAVLGLASMLLLLVLKCMREHMPPPHPEMPLAVKFSRGLVWTVTTARNALVVSSAALIAYAFEVTGSHPFVLTGKIAEGLPPVRIPPFSVTRDNKTI-SFSEMVQDMGAGLAVVPLMGLLESIAVAKSFASQNNYRIDANQELLAIGLTNVLGSLVSSYPVTGSFGRTAVNAQTGVCTPAGGLVTGALVLLSLNYLTSLFSYIPKSALAAVIITAVTPLFDVKIFRSLWRVQRLDLLPLCVTFLLSF-WEIQYGILAGSLVSLLILLHSVARPKTQVSEGQIFVLQPASGLYFPAIDALREAITNRALEASPPRSAVLECTHISSVDYTVIVGLGELLEDF--QKKGVALAFVGLQVPVLRTLLAADLKGFRYFTTLEEAE 560          
BLAST of slc26a-2 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 202.216 bits (513), Expect = 3.834e-56
Identity = 146/500 (29.20%), Postives = 262/500 (52.40%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH--YSLASEIPF-----------DITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSI----YDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV---------YENTSHFQGS 1554
            C  ++ + L+ ++ P++ W+  Y    +L  D++SGLSV +  +PQGLAY  +AGL P +GL+++F+  F+YF+FGTS+ +++G  A++S++V     SL ++  F            +  +  LS + G  Q+ LGL   GF+  Y+S  +V  +T++A++ +   Q+KY+ G+K   ++  LS+     +VC++L ET    +   IV+ V L+  KLL      ++LH    RR+       + I   +L +I  T +++ +K  +   + + GNI  GL    +P          V   +++F  +      +A++    A+++GK FA  +GY++ S+QE +A+G+SN++G FFQ  P + S SR+ +       +  +G ++   +LL +  L   F  +PKA LAA+IIV +   M  F  +   WK  R D + W  TFV ++ L ++ G+ + I  S L +V     P + V         Y + + + G+
Sbjct:   41 CSRARAHSLLLQHVPVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTADKAFVQGLNATADDARVQVAYTLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVKLLN-----EKLH----RRLP------LPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGL----IP---------PVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYSGA 512          
BLAST of slc26a-2 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 202.216 bits (513), Expect = 3.834e-56
Identity = 146/500 (29.20%), Postives = 262/500 (52.40%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH--YSLASEIPF-----------DITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSI----YDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV---------YENTSHFQGS 1554
            C  ++ + L+ ++ P++ W+  Y    +L  D++SGLSV +  +PQGLAY  +AGL P +GL+++F+  F+YF+FGTS+ +++G  A++S++V     SL ++  F            +  +  LS + G  Q+ LGL   GF+  Y+S  +V  +T++A++ +   Q+KY+ G+K   ++  LS+     +VC++L ET    +   IV+ V L+  KLL      ++LH    RR+       + I   +L +I  T +++ +K  +   + + GNI  GL    +P          V   +++F  +      +A++    A+++GK FA  +GY++ S+QE +A+G+SN++G FFQ  P + S SR+ +       +  +G ++   +LL +  L   F  +PKA LAA+IIV +   M  F  +   WK  R D + W  TFV ++ L ++ G+ + I  S L +V     P + V         Y + + + G+
Sbjct:   41 CSRARAHSLLLQHVPVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTADKAFVQGLNATADDARVQVAYTLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVKLLN-----EKLH----RRLP------LPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGL----IP---------PVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYSGA 512          
BLAST of slc26a-2 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 202.216 bits (513), Expect = 3.834e-56
Identity = 146/500 (29.20%), Postives = 262/500 (52.40%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH--YSLASEIPF-----------DITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSI----YDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV---------YENTSHFQGS 1554
            C  ++ + L+ ++ P++ W+  Y    +L  D++SGLSV +  +PQGLAY  +AGL P +GL+++F+  F+YF+FGTS+ +++G  A++S++V     SL ++  F            +  +  LS + G  Q+ LGL   GF+  Y+S  +V  +T++A++ +   Q+KY+ G+K   ++  LS+     +VC++L ET    +   IV+ V L+  KLL      ++LH    RR+       + I   +L +I  T +++ +K  +   + + GNI  GL    +P          V   +++F  +      +A++    A+++GK FA  +GY++ S+QE +A+G+SN++G FFQ  P + S SR+ +       +  +G ++   +LL +  L   F  +PKA LAA+IIV +   M  F  +   WK  R D + W  TFV ++ L ++ G+ + I  S L +V     P + V         Y + + + G+
Sbjct:   41 CSRARAHSLLLQHVPVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTADKAFVQGLNATADDARVQVAYTLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVKLLN-----EKLH----RRLP------LPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGL----IP---------PVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYSGA 512          
BLAST of slc26a-2 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 202.216 bits (513), Expect = 3.834e-56
Identity = 146/500 (29.20%), Postives = 262/500 (52.40%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH--YSLASEIPF-----------DITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSI----YDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV---------YENTSHFQGS 1554
            C  ++ + L+ ++ P++ W+  Y    +L  D++SGLSV +  +PQGLAY  +AGL P +GL+++F+  F+YF+FGTS+ +++G  A++S++V     SL ++  F            +  +  LS + G  Q+ LGL   GF+  Y+S  +V  +T++A++ +   Q+KY+ G+K   ++  LS+     +VC++L ET    +   IV+ V L+  KLL      ++LH    RR+       + I   +L +I  T +++ +K  +   + + GNI  GL    +P          V   +++F  +      +A++    A+++GK FA  +GY++ S+QE +A+G+SN++G FFQ  P + S SR+ +       +  +G ++   +LL +  L   F  +PKA LAA+IIV +   M  F  +   WK  R D + W  TFV ++ L ++ G+ + I  S L +V     P + V         Y + + + G+
Sbjct:   41 CSRARAHSLLLQHVPVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTADKAFVQGLNATADDARVQVAYTLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVKLLN-----EKLH----RRLP------LPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGL----IP---------PVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYSGA 512          
BLAST of slc26a-2 vs. UniProt/SwissProt
Match: sp|Q80ZD3|S2611_MOUSE (Sodium-independent sulfate anion transporter OS=Mus musculus OX=10090 GN=Slc26a11 PE=2 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 9.556e-113
Identity = 210/570 (36.84%), Postives = 338/570 (59.30%), Query Frame = 1
Query:  127 DLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMIDT--MEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAK 1824
            D   C  +   R +    P++ W+  Y   +L+ D ++GLSVGLTVIPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +GL  LGF+ +++S  V+ GFTS+A+I IG+GQIK +LGL++I   FFL +Y     + ET + D   G+ S+++LL  K +  ++      +  + +    ++W +  + N LVV S  ++A+  +        LTG I +GLP   +P F +    +T+ + S++ +++G G+ +V L+ L+E++A+ K+FA  N Y+I ++QE +AIG++N++GS   S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II AV  + D K     W+++R D +    TF+LS    ++YG+L G  +S L ++   +RPK QV E         S L+FP I  L   I    +EA    S  L+ T + S D  +I  L ++  DF  + K + +     Q+  +   + AD  G + + ++E+A+
Sbjct:    4 DTCCCSATALRRRL----PVLAWVPDYSLQWLRLDFIAGLSVGLTVIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFR-----EPAYAVLLAFLSGCIQLAMGLLHLGFLLDFISCPVIKGFTSAASITIGFGQIKNLLGLQKIPRQFFLQVYHTFLHIGETRVGDAVLGLASMLLLLVLKCMREHMPPPHPEMPLAVKFSRGLVWTVTTARNALVVSSAALIAYAFEVTGSHPFVLTGKIAEGLPPVRIPPFSVTRDNKTI-SFSEMVQDMGAGLAVVPLMGLLESIAVAKSFASQNNYRIDANQELLAIGLTNVLGSLVSSYPVTGSFGRTAVNAQTGVCTPAGGLVTGALVLLSLNYLTSLFSYIPKSALAAVIITAVTPLFDVKIFRSLWRVQRLDLLPLCVTFLLSF-WEIQYGILAGSLVSLLILLHSVARPKTQVSEGQIFVLQPASGLYFPAIDALREAITNRALEASPPRSAVLECTHISSVDYTVIVGLGELLEDF--QKKGVALAFVGLQVPVLRTLLAADLKGFRYFTTLEEAE 560          
BLAST of slc26a-2 vs. UniProt/SwissProt
Match: sp|Q86WA9|S2611_HUMAN (Sodium-independent sulfate anion transporter OS=Homo sapiens OX=9606 GN=SLC26A11 PE=1 SV=2)

HSP 1 Score: 345.895 bits (886), Expect = 1.683e-109
Identity = 212/577 (36.74%), Postives = 336/577 (58.23%), Query Frame = 1
Query:  133 SACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINER 1851
            SAC  S     + +  PI+ W+  Y   +LK D V+GLSVGLT IPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ ++G IQL +G+  LGF+ +++S  V+ GFTS+AA+ IG+GQIK +LGL+ I   FFL +Y    ++ ET + D   G+V +++LL  KL+  +V      +    R+   ++W    + N LVV    ++A+  +        LTG   +GLP   +P F +     T+  T ++ +++G G+ +V L+ L+E++A+ KAFA  N Y+I ++QE +AIG++N++GS   S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II+AV  + D K     W++KR D +    TF+L     V+YG+L G  +S L ++  A+RP+ +V E         S L FP +  L   I    +E      + L+ T V S D  ++  L ++  DF  + + + +     Q+  +   + AD  G Q + ++E+A+    H+ + 
Sbjct:   21 SACCCSP--AALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF-----HEPAYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT-EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFDTKIFRTLWRVKRLDLLPLCVTFLLCF-WEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDF--QKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAE---KHLRQE 583          
BLAST of slc26a-2 vs. UniProt/SwissProt
Match: sp|Q58DD2|S2611_BOVIN (Sodium-independent sulfate anion transporter OS=Bos taurus OX=9913 GN=SLC26A11 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 6.283e-109
Identity = 206/533 (38.65%), Postives = 317/533 (59.47%), Query Frame = 1
Query:  130 LSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF--QGSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRN 1716
            +S C +++    + K+ P + W+  Y +  LK D ++G+SVGLTVIPQ LAY  VAGL PQYGL++AF G F+YF  GTS+D+T+GPTAI+SLLV+ Y+       +  Y+V+L+ + G IQL +G   LG + +++S  V+ GFTS+AAI+IG+GQIK +LGL+ I   FFL +Y     + ET + D   G+V +V+LL  KL+  +V      +    R+ + ++W    + N LVV    ++A+  +        LTG   +GLP   +P F +     T+  T ++ + +G G+ +V L+ L+E++A+ K+FA  N Y+I S+QE +A+G +NI+GS F S P TGSF RTA+N+Q    +P  G++TG +VLL+L +L   F +IPK++LAA+II+AV+ + D K +   W++KR D +    TF+L     V+YG+L G  +S L ++   +RPK QV E         S L FP I  L   +    +E     S+ LD T + S D  ++  L ++  DF  R 
Sbjct:   17 MSCCWSTE---TMQKWLPFLGWLPDYTWYALKMDFIAGISVGLTVIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF-----HEPAYAVLLAFLTGCIQLGMGFLRLGLLLDFISCPVIKGFTSAAAIIIGFGQIKNLLGLQHIPRQFFLQVYYTFHNIGETRVGDAVLGLVCMVLLLVLKLMRDHVPPVHPEMPTGVRLSHGLVWTATTARNALVVSFAALVAYSFQVTGYQPFVLTGKTPEGLPDAHIPPFSVTTANGTISFT-EMVQGMGAGLVVVPLMGLLESIAVAKSFASQNNYRINSNQELLALGFTNILGSLFSSYPVTGSFGRTAVNAQSGVCTPAGGLMTGALVLLSLDYLTSLFYYIPKSALAAVIIMAVVPLFDTKIVKTLWRVKRLDLLPLCVTFLLCF-WEVQYGILAGTLVSVLILLHSVARPKIQVSEGPMLVLQPASGLHFPAIETLREALLSRALETSPPRSVALDCTHICSIDYTVVLGLGELLEDFHKRG 539          
BLAST of slc26a-2 vs. UniProt/SwissProt
Match: sp|Q8GYH8|SUT42_ARATH (Probable sulfate transporter 4.2 OS=Arabidopsis thaliana OX=3702 GN=SULTR4;2 PE=2 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 2.540e-72
Identity = 158/469 (33.69%), Postives = 264/469 (56.29%), Query Frame = 1
Query:  142 KNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYS---VILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYD-VCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALI---ALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            K   F+  I   FP   WI+ YR+  Y K D+++G++VG+ ++PQ ++Y  +AGL+P YGL+++F   F+Y +FG+S+ L +GP A++SLLV++       P +  Y+   ++L+LM G  + I+G   LG++  ++S  V+SGFT+++A++IG  Q+KY LG    R++  + + D + +  ++        G   +V+LL  K           H+ K++    K L FI  +  +  +   TI+A   K     +++L G+I +GLPKF  P               + F      +P  ALI   A++E++ I KA A  N Y++ S+ E   +G++NI GS F + PTTGSFSR+A+NS+  +K+  SG++TG ++  +L FL P F FIP+ +LAAI+I AV  + D++     W++ + D   W  T   +L  G+E GVLIG+G S   ++  ++ P   V
Sbjct:   55 KRMTFFDWIDAIFPCFLWIRTYRWHQYFKLDLMAGITVGIMLVPQAMSYARLAGLQPIYGLYSSFVPVFVYAVFGSSRQLAVGPVALVSLLVSNALSGIVDPSEELYTELAILLALMVGIFESIMGFLRLGWLIRFISHSVISGFTTASAVVIGLSQLKYFLGYSVSRSSKIMPVIDSIIAGADQFKWPPFLLGCTILVILLVMK-----------HVGKAK----KELRFIRAAGPLTGLALGTIIA---KVFHPPSITLVGDIPQGLPKFSFP---------------KSFDHAKLLLPTSALITGVAILESVGIAKALAAKNRYELDSNSELFGLGVANIFGSLFSAYPTTGSFSRSAVNSESEAKTGLSGLVTGIIIGCSLLFLTPMFKFIPQCALAAIVISAVSGLVDYEGAIFLWRVDKRDFTLWTITSTTTLFFGIEIGVLIGVGFSLAFVIHESANPHIAV 490          
BLAST of slc26a-2 vs. UniProt/SwissProt
Match: sp|Q9FY46|SUT41_ARATH (Sulfate transporter 4.1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SULTR4;1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 7.105e-70
Identity = 157/469 (33.48%), Postives = 264/469 (56.29%), Query Frame = 1
Query:  142 KNSKFYRLITKYFPIVEWIQYYRFT-YLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYS---LASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYD-VCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALI---ALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            K  +    I   FP   WI+ YR++ Y K D+++G++VG+ ++PQ ++Y  +AGL P YGL+++F   F+Y IFG+S+ L IGP A++SLLV++       +     I  +++L+L+ G ++ I+GL  LG++  ++S  V+SGFTS++AI+IG  QIKY LG    R++  + I + + +  ++        G + +V+L   K           H+ K++    K L F+  +A +  ++  T +A   K     ++SL G I +GLP F  P               + F    T +P  ALI   A++E++ I KA A  N Y++ S+ E   +G++NI+GS F + P TGSFSR+A+N++  +K+  SG+ITG ++  +L FL P F +IP+ +LAAI+I AV  + D+      W++ + D   W  T  ++L  G+E GVL+G+G S   ++  ++ P   V
Sbjct:   68 KRMRLVDWIDTLFPCFRWIRTYRWSEYFKLDLMAGITVGIMLVPQAMSYAKLAGLPPIYGLYSSFVPVFVYAIFGSSRQLAIGPVALVSLLVSNALGGIADTNEELHIELAILLALLVGILECIMGLLRLGWLIRFISHSVISGFTSASAIVIGLSQIKYFLGYSIARSSKIVPIVESIIAGADKFQWPPFVMGSLILVILQVMK-----------HVGKAK----KELQFLRAAAPLTGIVLGTTIA---KVFHPPSISLVGEIPQGLPTFSFP---------------RSFDHAKTLLPTSALITGVAILESVGIAKALAAKNRYELDSNSELFGLGVANILGSLFSAYPATGSFSRSAVNNESEAKTGLSGLITGIIIGCSLLFLTPMFKYIPQCALAAIVISAVSGLVDYDEAIFLWRVDKRDFSLWTITSTITLFFGIEIGVLVGVGFSLAFVIHESANPHIAV 503          
BLAST of slc26a-2 vs. TrEMBL
Match: A0A0H3YJ92 (Slc26a-2 OS=Schmidtea mediterranea OX=79327 GN=slc26a-2 PE=2 SV=1)

HSP 1 Score: 1147.5 bits (2967), Expect = 0.000e+0
Identity = 583/583 (100.00%), Postives = 583/583 (100.00%), Query Frame = 1
Query:  109 MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINERMP 1857
            MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKILIIVISNPQIISILQKVHADDFGIQCYKSIEDAKVIHSHINERMP
Sbjct:    1 MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKILIIVISNPQIISILQKVHADDFGIQCYKSIEDAKVIHSHINERMP 583          
BLAST of slc26a-2 vs. TrEMBL
Match: V4CH35 (STAS domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_212898 PE=3 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.595e-128
Identity = 233/535 (43.55%), Postives = 338/535 (63.18%), Query Frame = 1
Query:  142 KNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVL-LTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEI-GTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF------QG-SFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNK 1719
            KN      + K FPI +W+  Y  + L+ D++SGL+VGLTVIPQGLAY  +AGL PQYGL+++F G F+Y   GTSKD+T+GPTAI+SL+   +++ S IP D TY++IL+LM G +QL++GL +LG + N++S  V++ FTS+AAI I +GQ+K+I GLK I  +F   +YD  + L +T + DM  G  S+V L L  KL       +    S S+++  K LW     AN +VVIS   +A  L  M I   +++TG++ +GLP  ++P F I     T ++T +IF +IG G  IV L+ LVE +AIGKAFAR N YKI  +QE IAIG++NI+  F  S P TGSFSRTA+NSQ   +SP SG++TG ++LLAL+ L P F ++P+A+L A+II AV+ M D+K L   W + + D +    TF+ SL +G+EYG+++GIGLS L +++  +RPK + Y N  +       QG +F    FIS+      T    NR S+  D   +Y+ D + I  L ++  D + +NK
Sbjct:   30 KNICTKETLKKKFPISKWLPKYSLSDLQCDVISGLTVGLTVIPQGLAYAKIAGLPPQYGLYSSFMGCFVYCFLGTSKDITLGPTAIMSLMTGTFAI-SPIPNDATYAIILTLMCGVVQLVMGLLNLGILVNFISYPVINAFTSAAAITIAFGQVKHIFGLKNIPRDFLPMVYDTFANLGQTKVWDMVLGFASLVALYLIKKLRSIKWQDEDEPKSTSQKVARKFLWLFGTGANAVVVISAAGIAASLISMNIKDKITITGHLKQGLPPLQVPAFSIHTRNIT-QSTGEIFSKIGAGFFIVPLLGLVETIAIGKAFARQNSYKIDPTQELIAIGVANIISCFISSYPVTGSFSRTAVNSQSGVRSPASGIVTGALILLALQVLTPLFYYVPQAALGAVIISAVLQMIDWKILKILWNVDKIDLVPLIITFISSLVIGIEYGIMVGIGLSLLMLLYPLARPKLK-YINQGNILVVQPNQGMNFPSAEFISETIVQKATEGGSNR-SVIFDCCHIYNIDYSAILGLKELVID-LEKNK 559          
BLAST of slc26a-2 vs. TrEMBL
Match: A0A210QTN2 (Sodium-independent sulfate anion transporter OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06244 PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 3.231e-126
Identity = 227/587 (38.67%), Postives = 350/587 (59.63%), Query Frame = 1
Query:  118 QDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLF---WYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIG-TLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENT----SHFQG-SFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINER 1851
            ++Y +  C        + + FPI  W+  Y    L+ D+V+GL+V LTVIPQGLAY  +A L  QYGL++AF G F+Y   GT+KD+T+GPTAI+SL+ A +++ S +  D TY+++L L+ G +QL++G+ +LG + N++S  V++ FTS+AAI IG+GQ+K +LGL  I   F   +Y+   K+ ET + DM  G+V +V+L   K +    W         +   +    ++W    +AN ++VIS + +   L+   I   +S+TG+I +GLP F  P F + NG +T+ +   I   IG GI IV L+ LVE +AIGKAFAR N YKI  SQE IA+G +NI+ SF  S P TGSFSRTA+NSQ   K+P SG+ITG V+LL+L+FL P F +IPKA+L+A+II AV+ M D+K + + WK  + D I  F TF+ SLG+G+EYG++IG+G+  L +++  +RPK  V +         QG  F    +I        T++ +   S+ +D T V + D + +   I++  +F  +   ++    N +++  LQ  +  D  + C    E  K++   +N+ 
Sbjct:   41 KNYCVKCCSKET----LKQRFPITNWLPKYSLQALQCDLVAGLTVALTVIPQGLAYAKIARLPSQYGLYSAFMGCFVYCFLGTAKDITLGPTAIMSLMTASFAI-SPVENDATYAIVLCLLCGCVQLLMGILNLGILVNFISYPVINAFTSAAAITIGFGQVKGLLGLTDIPREFLHMVYETFRKIPETKVWDMTMGLVCLVLLFLLKKMRAIQWNDPPDSPPPNLCVQFCRYLIWLTGTAANAIIVISASGVVAILRSQNINDAISITGDIQQGLPSFSAPSFSVQNGNDTI-SAGTILSGIGAGIGIVPLLGLVELIAIGKAFARQNDYKIYPSQELIAVGTANILSSFISSYPVTGSFSRTAVNSQSGVKTPASGLITGAVILLSLQFLTPLFFYIPKAALSAVIISAVIQMVDYKIVKKLWKANKIDLIPLFVTFLSSLGVGIEYGIIIGVGVDLLTLLYPMARPKINVSDVGVVVLKMDQGVRFPAVDYIQSRVTEAATVKGDKLRSVVVDCTFVTATDYSSMQGFIELIAEFKRKGARIVFACLNAKVLKSLQDKNIPDL-LVCSTVDEGCKLLQDELNQE 620          
BLAST of slc26a-2 vs. TrEMBL
Match: A0A1S3JX49 (LOW QUALITY PROTEIN: sodium-independent sulfate anion transporter-like OS=Lingula unguis OX=7574 GN=LOC106176871 PE=3 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.311e-125
Identity = 221/516 (42.83%), Postives = 322/516 (62.40%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLL--FWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYEN----TSHFQGSFLWFPFISKLTAMIDTME--AENRMSITLDLTGVYSAD 1662
            CK +   + + + FPI+ W+  YR  +L+ D+++GL+VGLTV+PQGLAY  +A L PQYGL++AF G F+Y   GTSKD+T+GPTAI+SL+ A +     +P + T ++IL+  AG IQ+I+G   LGFI  ++S  V++GFTS+A+I I +GQ+K +LGLK I  +F   +Y+   K+ ETN+ D+  G+ S+V+L+  K +    Y   + + L  S ++  KILW +  + N +VV++   +A  L   +I  LSLTGNI +GLP F+LP+F +         T Q+F+ IG G  I+ LI L+E +AIGKAFAR N Y I  +QE IA+G +N + SF  S P TGSFSRTA+NS    ++P  G+ TG +V+LAL  L P F +IP A+LAA+II AV+ M D+K     W++K+ D I  FSTF++S  LG+EYG+LIGIGLS + +++  +RP  ++           QG  L FP +  +   I T     E   S+  D T V   D
Sbjct:    8 CKEAFSVKTLKRRFPIITWLPKYRLKHLQGDVIAGLTVGLTVLPQGLAYAQIAELPPQYGLYSAFMGCFVYTFLGTSKDITMGPTAIMSLMTADFGQTEWLPHNATNAIILTFFAGIIQMIMGFLHLGFIVQFISFPVINGFTSAASITIAFGQLKNLLGLKGIPRDFLHMVYETFRKIPETNIWDLVMGLCSMVILVILKFIKDLKYDDEEGVVLPMSTKVSRKILWLVGTARNAVVVVAAAGIAAALLAKDIDVLSLTGNIQEGLPPFKLPNFTLQISPNETIGTGQLFQNIGAGFAIIPLIGLLETIAIGKAFARKNDYSIEPNQELIAMGAANFLSSFVSSYPITGSFSRTAVNSASGVRTPAGGIFTGLLVVLALALLTPLFYYIPDAALAAVIITAVLDMFDWKIYLTLWRVKKLDIIPLFSTFIMSFILGIEYGILIGIGLSLMIVLYPMARPHVKMGSKDIMLVQPDQG--LKFPGVEYVRDKIYTRALIGETPRSVVFDFTHVSGVD 521          
BLAST of slc26a-2 vs. TrEMBL
Match: K1QZQ4 (Sodium-independent sulfate anion transporter OS=Crassostrea gigas OX=29159 GN=CGI_10011152 PE=3 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 2.703e-121
Identity = 230/540 (42.59%), Postives = 339/540 (62.78%), Query Frame = 1
Query:  127 DLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLF---WYVSVKRLHLSKSRRIVNKILWFICISANILVVISTT-ILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHF----QGSFLWFPFISKL-TAMIDTMEAENR-MSITLDLTGVYSADSAIINTLIDIGHDFINRN 1716
             ++AC + +   L TK  PI +W+  Y    L+ D+++GL+VGLTVIPQGLAY  +A L PQYGL++AF G F+Y   GT+KD+T+GPTAI+SL+ A ++  S I  D TY+++L L+ G +QL+LGL +LG + N++S  V++ FTS+AAI IG+GQ+K ILGL  I  +F   +Y+ C K+ ET + D+  G+V + +L   K L    W   +     ++  R    ++W I  ++N +VVIS + + A  + Q +  TLS+TG++  GLP F+ PDF       T+ T S IF +IG G  IV L+ LVE +AIGKAFAR N YKI  SQE IAIG +NI+  F  S P TGSFSRTA+NSQ   K+P SG+ TG +++LAL  L P F +IPK++L+A+II +V+ M D   + + WK  + D I  F TF+  LG+G+EYG+LIGIG+S + +++ ++RPK +V           QG  L FP +  L   +++  EA+ +  S+ LD + V + D   I  + ++  DF +R 
Sbjct:   64 QINACCSKE--NLKTK-LPITKWLPKYSLQALQCDLIAGLTVGLTVIPQGLAYAKIADLPPQYGLYSAFMGCFVYCFLGTAKDITLGPTAIMSLMTATFA-TSPIEEDATYAIVLCLITGCVQLLLGLLNLGILVNFISYPVINAFTSAAAITIGFGQVKGILGLTHIPRDFPEMVYETCKKIPETKIWDLVMGLVCLALLYVLKKLRTINWNDDLDGPGPNRCVRFCRYLIWLIGTASNAIVVISASGVAAILISQGKNNTLSITGHLKPGLPDFKPPDFSYTKDNITI-TASTIFSDIGAGFGIVPLLGLVELIAIGKAFARQNHYKIYPSQELIAIGFANIISCFVGSYPVTGSFSRTAVNSQSGVKTPASGIFTGVLIVLALFTLTPLFYYIPKSALSAVIIFSVIQMVDVMVVKKLWKTNKIDLIPLFITFLSCLGVGMEYGILIGIGVSMIILLYPSARPKIKVEPGGVKVVKLDQG--LLFPAVEYLQECVLEANEADGKNNSVVLDCSHVSALDYTAIQGITELIVDFKSRE 596          
BLAST of slc26a-2 vs. Ensembl Cavefish
Match: slc26a11 (solute carrier family 26 member 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5349])

HSP 1 Score: 296.59 bits (758), Expect = 4.834e-92
Identity = 182/517 (35.20%), Postives = 295/517 (57.06%), Query Frame = 1
Query:  178 FPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARL----NGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQ--GSFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDF 1704
            FP++ W+  Y   + K D+++GL+VGLTV+PQGLAY  VAGL  QYGL++AF G F+Y +FGTSKD+T+GPTAI+SLL + Y     I  D  Y+V+L+L+ G IQ ++ L  LGF+ +++S  V+ GFT +AA+ IG+GQ+K ILGLK I   F L +Y    ++ E    D+  G++ ++ L+   ++   +     + S   R+   I+W      N LVVI+   +A+  +       +LTG   +GLP    P F       T  + S+I  ++G G+ ++ L+ ++E++AI KAFA +     G  + ++  +++ G++NI+GSF  + P TGSF R           P   +    VVLL+L FL P F +IPKASLAA+II AV  M D+K L + W++++ D + +  TF++S    V+YG++ G+ +S + ++++ +RP+ ++ ++        S L FP I  L  ++    +       + LD   V S D  ++  L D+   F
Sbjct:   15 FPLLAWLPRYNLAWFKMDLLAGLTVGLTVVPQGLAYAEVAGLPVQYGLYSAFMGCFVYCVFGTSKDITLGPTAIMSLLCSFY-----IAGDPVYAVLLTLLCGIIQTVMALLRLGFLLDFVSYPVIKGFTCAAAVTIGFGQVKNILGLKGIPQQFILQVYYTFYRIPEARAGDVILGLLCLIFLVMMTMMKSTLGSIEENPSLLVRVSRGIVWSFATVRNALVVIAAACVAYSSELAGSHFFTLTGKTAQGLPPLSPPAFSETTQNGTTISFSEIILDLGGGLAVIPLMGVLESIAIAKAFACVYLLYYGLIMINNWLYVSAGLTNILGSFVSAYPITGSFGRFV---------PLF-IFISVVVLLSLAFLMPLFYYIPKASLAAVIICAVAPMIDYKVLPQIWRVRKLDLLPFLVTFLVSF-WEVQYGIVGGVIVSGMMLLYLVARPELKISDHGVIVMELASGLNFPAIEHLCGVLRKHALHVSPARCVVLDCHHVSSIDYTVVTELKDLLKQF 515          
BLAST of slc26a-2 vs. Ensembl Cavefish
Match: slc26a6l (solute carrier family 26 member 6 [Source:NCBI gene;Acc:103035873])

HSP 1 Score: 207.994 bits (528), Expect = 3.098e-57
Identity = 146/504 (28.97%), Postives = 249/504 (49.40%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYR-FTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH--YSLASEIPF--------------------DITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIY----DVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWF 1566
            C  S   R +    P++ W+  Y  + Y   D+VSG+SVG+  +PQG+AY  +A L P +GL+ +F+   +YF FG+S+ ++IG   +LS++V      LA +  F                     +  +   +++AG IQ+ILGL   GF+  Y+S  +V G+TSSAA      Q+KYI G+   R +  LS+     DVC  L  T+L  +    VS+ VL+  K L             + R   K+   + I   ++V++  T++++Y    +   +S+ G I  GL    +P              + +F E+      +A++    ++++GK FA  +GYK+ S+QE +A+G+SN VG FFQ      S SR+ +      K+  +GV +  +VL+ +  L P F  +PKA LAA++ V +  M   +  +   W+  + D + W  T+V ++   ++ G+   IG + L ++F   RP++ V     H  G+ L+ 
Sbjct:   48 CSVSSLKRRVVGCLPVLYWLPRYSIWDYGMPDLVSGISVGIMHLPQGMAYSLLASLPPVFGLYTSFYPALVYFFFGSSRHISIGTFTVLSIMVGSVVERLAPDANFLIVNGTNATVEVNVTERDLYRVQVAAATTVLAGLIQVILGLVQFGFVGTYLSEPLVRGYTSSAAAHAVVAQLKYIFGVSPTRFSGPLSLVYTLVDVCMLLPSTHLPTLLISSVSITVLIVAKEL-------------NNRFRKKLP--VPIPVELIVIVVGTLISYYTHLNKNYEISVVGEIPSGLQPPTVPQ-------------TSVFSEVVVDAFALAIVGYAISISLGKTFALKHGYKVDSNQELVALGLSNAVGGFFQCYSVCASMSRSLVQETTGGKTQMAGVASAVIVLVTVLKLGPLFQDLPKAVLAAVVFVNLKGMFKQYSDILTLWRTSKIDLLVWLVTWVSTVLFNLDMGLGASIGFALLTVIFRTQRPRYSVL---GHLPGTELYL 520          
BLAST of slc26a-2 vs. Ensembl Cavefish
Match: slc26a3.2 (solute carrier family 26 member 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-041210-179])

HSP 1 Score: 191.045 bits (484), Expect = 1.314e-51
Identity = 155/496 (31.25%), Postives = 247/496 (49.80%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIP-----FDIT-------------YSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIY--DVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVL---LALRF-LNPYFVFIPKASLAAIIIV----AVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTS 1539
            C + +         PIV W++ YR   +L  DIVSG+S GL  I QGLAY  +A L   YGL+AAF+   +YF  GTS+ +++G   +LSL+V    +   +P      +IT              S  L+ + G  QL +GL  +GF+  Y+S  +VSGFT++AA+ I   Q+K+I GL     +  L+IY  ++ +++  TN+ D+   IV +VV+   K +             + R  +K+   I I   + ++      AF  K      + + G I      FE P          V    ++FKE       +A++    + A+ K +A  + Y I  +QE IA G+SNI G  F+SL ++ + SR+A+      K+  +G+++  +VL   LA+ F L P    +PK+ L A++IV     +M M +  +L   WK  R DCI W  TF+ S+ LG++ G+ +G+G+  L +VF    P+  V  N S
Sbjct:   44 CDSKRVKNAALSLVPIVGWMKMYRVKEWLLGDIVSGVSTGLVAILQGLAYSLLASLPAWYGLYAAFFPVIIYFFLGTSRHISVGAFPVLSLMVGAV-VTRMVPDGGPTVNITGLEGLSIDDQRAMVSASLTFLIGIFQLGMGLLQVGFVVIYLSDTLVSGFTTAAAVHILISQLKFIFGLSVPGFSGPLAIYIRNIFTQITSTNIHDLVTAIVVMVVVFAVKEI-------------NERFKSKLPVPIPIEVIMTIIACGVSYAFNFKDNH--GVDVVGLIPDS---FETP----------VAPNIEVFKETAVDAFPMAIVGFAISFAVAKVYAVKHDYVIDGNQELIAFGVSNIFGGAFKSLASSTALSRSAVQESTGGKTQIAGILSAIIVLIVTLAIGFLLEP----LPKSVLGAVVIVNLKGMLMQMREVPYL---WKKDRLDCIIWIVTFLASIFLGLDLGLAVGLGVELLAVVFRTQFPRCSVLANIS 503          
BLAST of slc26a-2 vs. Ensembl Cavefish
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:103026473])

HSP 1 Score: 190.274 bits (482), Expect = 2.238e-51
Identity = 141/490 (28.78%), Postives = 246/490 (50.20%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRFTYLK-NDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVA----------------HYSLASEIPFD------ITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLS----IYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            C   +         P++ W+  Y F      D+VSG+SVG+  +PQG+AY  +A + P +GL+++F+   +YFIFGTSK +++G  A++S+++                 + S +SEI F+      +  +  ++ ++G  QL+LGL   GF+  Y+S  +V  +T++AAI +   Q+KY  G+   R +  LS    + +VCS L +TN+  +   IV++V L+  K L  +++ K                 + +   ++ +I  T+L++         + + G+I  GL   +LP F +M               IG    + A++    A+++G+ FA   GYK+ S+QE +A+G+SN +G  FQ    + S SRT +      K+  +G ++  V+L+ L ++   F  +PKA LAAII V +   M  F  +   W+  + D + W  TFVL+L L  + G+   I  S L ++F    PK+ +
Sbjct:   48 CSGPQVKSCFLSCIPLLAWLPRYPFKENAFGDLVSGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPDSDFTLWNNISNSSEINFEARDIERVKIAAAVTFLSGIFQLLLGLVQFGFVVTYLSEPLVRAYTTAAAIHVIVSQLKYSFGISATRFSGPLSLIYTVLEVCSLLGQTNIGTLVVSIVTIVCLIIAKELNSWLARK---------------LPVPVPVELIAIIIATVLSWQFDFKTEYKVEVVGSIPSGLQPPKLPAFSMMGSM------------IGDAFAL-AVVGYGIAISLGRIFALKYGYKVDSNQELVALGLSNSIGGVFQCFAISCSMSRTMVQISTGGKTQVAGALSAIVMLVILLWIGSLFEDLPKAVLAAIIYVNLHGMMKQFADIPSLWRSNKVDMLVWLVTFVLTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSL 509          
BLAST of slc26a-2 vs. Ensembl Cavefish
Match: slc26a3.2 (solute carrier family 26 member 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-041210-179])

HSP 1 Score: 189.119 bits (479), Expect = 8.058e-51
Identity = 153/494 (30.97%), Postives = 244/494 (49.39%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIP-----FDIT-------------YSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVL---LALRF-LNPYFVFIPKASLAAIIIV----AVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTS 1539
            C + +         PIV W++ YR   +L  DIVSG+S GL  I QGLAY  +A L   YGL+AAF+   +YF  GTS+ +++G   +LSL+V    +   +P      +IT              S  L+ + G  QL +GL  +GF+  Y+S  +VSGFT++AA+ I   Q+K+I GL     +  L +  + +++  TN+ D+   IV +VV+   K +             + R  +K+   I I   + ++      AF  K      + + G I      FE P          V    ++FKE       +A++    + A+ K +A  + Y I  +QE IA G+SNI G  F+SL ++ + SR+A+      K+  +G+++  +VL   LA+ F L P    +PK+ L A++IV     +M M +  +L   WK  R DCI W  TF+ S+ LG++ G+ +G+G+  L +VF    P+  V  N S
Sbjct:   45 CDSKRVKNAALSLVPIVGWMKMYRVKEWLLGDIVSGVSTGLVAILQGLAYSLLASLPAWYGLYAAFFPVIIYFFLGTSRHISVGAFPVLSLMVGAV-VTRMVPDGGPTVNITGLEGLSIDDQRAMVSASLTFLIGIFQLGMGLLQVGFVVIYLSDTLVSGFTTAAAVHILISQLKFIFGLSVPGFSGPLILESIFTQITSTNIHDLVTAIVVMVVVFAVKEI-------------NERFKSKLPVPIPIEVIMTIIACGVSYAFNFKDNH--GVDVVGLIPDS---FETP----------VAPNIEVFKETAVDAFPMAIVGFAISFAVAKVYAVKHDYVIDGNQELIAFGVSNIFGGAFKSLASSTALSRSAVQESTGGKTQIAGILSAIIVLIVTLAIGFLLEP----LPKSVLGAVVIVNLKGMLMQMREVPYL---WKKDRLDCIIWIVTFLASIFLGLDLGLAVGLGVELLAVVFRTQFPRCSVLANIS 502          
BLAST of slc26a-2 vs. Ensembl Sea Lamprey
Match: slc26a11 (solute carrier family 26 member 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5349])

HSP 1 Score: 309.301 bits (791), Expect = 2.982e-98
Identity = 184/426 (43.19%), Postives = 272/426 (63.85%), Query Frame = 1
Query:  205 YRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTT----SQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGI 1470
            Y    L+ D+V+GL+VGLTV+PQ LAY  VAGL  QYGL++AF G F+Y + GTSKD+T+GPTAI+SL+V+ Y     +  D  Y+V+L+ ++G+IQL++G+  LGF+  ++S  V+ GFT +AAI IG+ QIK +LGLK I   FF  +Y   S++ ET L D   G  S+++L+  +++     +        R I N I        N +VV++  ++AF  +   +   +LTG+I +GLP F  P F     +ET + T     QI +++G  + ++ L+  +E++AI KAFA  N Y+I  SQE IAIG++N++GSF  S P TGSF RTA+NS+    +P  G++TGTVVLL+L FL P+F FIP+A+L+AIII AV  + D + L+R WKIK+ D + +  TF L L   + YG+L G+
Sbjct:    1 YTLGSLRMDLVAGLTVGLTVVPQSLAYAQVAGLPAQYGLYSAFMGCFVYCLLGTSKDVTLGPTAIMSLVVSVY-----VRRDPVYAVLLTFLSGAIQLLMGILRLGFLVEFISLPVLKGFTCAAAITIGFSQIKTLLGLKDIPQQFFQEVYYTFSRIAETRLADALLGGSSLLLLILLRVIAARSPIPPPIPVSVR-ISNSITSIFGTVRNAVVVLAAALVAFACESQRLHPFTLTGHIAQGLPPFHPPAF-----SETKEGTFIPFLQIVRDLGLALLVIPLLGFLESIAIAKAFATKNMYRIDPSQELIAIGLTNVLGSFTSSYPVTGSFGRTAVNSETGVATPAGGLVTGTVVLLSLAFLTPWFYFIPQAALSAIIICAVAPLFDCRILWRLWKIKKSDALVFVLTFALCL-WEIPYGLLGGV 414          
BLAST of slc26a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003427.1 (pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-1 gene:ENSPMAG00000003117.1 transcript:ENSPMAT00000003427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 7.807e-46
Identity = 134/522 (25.67%), Postives = 246/522 (47.13%), Query Frame = 1
Query:  136 ACKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVA----------------------------HYSLASE----------IP-----FDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNN----FFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVY---ENTSHF 1545
             C   +        FP++ W+  Y+   ++  D +SGL VG+ ++PQ +AY  +AG  P YGL+ +F+   +YF+ GTSK +++G   +L L++                             ++S + E          +P     F I     ++ MAG  Q+++G+F +GF++ Y+S  ++SGF + +++ +   Q+KY+LG+   R +       + Y + S++  TN+ D+   I+ ++VL+  K L         H     +    I         ++VV++ T+ + +    E  + S+ G+I  G      P++ +            I +     +PI A+I     +++ + FA+ +GY +R++QE IAIG  NIV +FF S  T+ + ++T +      ++  S V+T  V+LL L  + P F  + K  L  I IV +      F  + R W+  R D   WF T + S  +  E G+L+G+ +S L  +    RP+  +Y    +T++F
Sbjct:   42 CCSPHELKSFFLNLFPVLRWLPKYKVREWILGDFMSGLIVGILLVPQCIAYSLLAGQDPIYGLYTSFFACIIYFLMGTSKHISVGIFGVLCLMIGQVVDRELQVAGFAEEGIKGHDHVVNNSMNFSNSDEENGFTVMIGGLPCGRSCFAIAVGTTVTFMAGVYQVVMGIFQMGFVSIYLSEPMLSGFVTGSSLTVLTSQMKYLLGIHIPRASGAGALLKTWYHIFSQISNTNVCDVVTSIICILVLVPAKEL-------NEHFKARLKAPFPI--------ELVVVVAATLASHFGGFKENYSSSIAGHIPTGFLPPRAPEWTL------------IPRIAADAVPI-AIIGFAITVSLSEMFAKKHGYTVRANQEMIAIGFCNIVPAFFYSFTTSAALAKTLVKEATGCQTQMSAVVTAGVLLLVLLLIAPLFYSLQKCVLGVITIVNLRGAFRKFLDIPRMWQESRVDTSIWFVTMLASALISTEIGLLVGVCVSLLVFIVRTQRPRAALYGCVHDTNNF 535          
BLAST of slc26a-2 vs. Ensembl Sea Lamprey
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 120.553 bits (301), Expect = 6.170e-29
Identity = 94/367 (25.61%), Postives = 180/367 (49.05%), Query Frame = 1
Query:  451 ITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLS----IYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQ-EFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPK---ASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            ++ ++ ++ + G  QL LG+   G +A Y+S  +V GFT++ +I +   Q+KY+ G+   R +  L+      + CS L  TNL  +   ++  V L   K L               R  N++   I +   +++V+  T+ +  L+  E   + + G+I  GL    +P F +             F ++      +A++    A+++GK FA  +GY I S+Q E +AIG+SNI GS F S   + + SR+ +      ++  +G+++  +VL+ +  ++  F  +P+   A+LAA+++V +  M   F  + + W+  R D   W  TF  S+ LG++ G+ + +  + L +V     PK+ +
Sbjct:    1 VSVAIAVTFLCGIYQLSLGMLRFGVVATYLSEPMVRGFTTACSIHVCVTQLKYMFGVSVSRYSGPLASEQTTIEFCSHLGHTNLVSLLLCVICTVGLAGSKEL-------------GDRYRNRLPAPIPL--ELILVVLATLASSGLELNEKHAVDIIGDIPTGLKPPVVPSFTL-------------FGKVVVDAITLAIVGFSIAISMGKTFALKHGYNIDSNQQELVAIGLSNIFGSIFHSFTISCAMSRSLVQDATGGQTQVAGLVSALLVLIVILAISSLFRPLPRSGQAALAAVVLVNLKGMFKQFADVPQLWRTCRIDLAMWMVTFWASVLLGLDLGLAVAVSFALLSVVIRTQTPKYSI 339          
BLAST of slc26a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003699.1 (pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 gene:ENSPMAG00000003383.1 transcript:ENSPMAT00000003699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 5.494e-26
Identity = 74/246 (30.08%), Postives = 127/246 (51.63%), Query Frame = 1
Query:  493 QLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNN-------FFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINS 1209
            QLI+    LGF+A Y+S  +VS FT++AAI +   QIK +LGL+  R +        F ++ D+  KL  TN+ ++   +V + VL+  +       + + + SK +           I   +L+++  T+++FY +  E   +++ GNI  GLP  +LP            T +     I  G+ I A++    ++++ K FA+ +GY + ++QE  A G+ N+ GSFFQ  P+  S SRT+I  
Sbjct:    1 QLIMFSLQLGFVAIYLSDPLVSAFTNAAAIHVLVSQIKNMLGLQVPRFSGPASIFMVFQTMVDIFQKLPNTNIAELVTSLVCLTVLIPVR------EINQRYKSKLKA---------PIPVELLLIVLATVISFYARLEEKFGVTVVGNIPAGLPVPQLP------------TVTNFSSLIADGLAI-AIVGYAVSVSLAKIFAKKHGYTVDANQELFAHGVCNLFGSFFQCFPSAASISRTSIQE 218          
BLAST of slc26a-2 vs. Ensembl Yeast
Match: SUL1 (High affinity sulfate permease of the SulP anion transporter family; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000000498])

HSP 1 Score: 241.506 bits (615), Expect = 8.380e-70
Identity = 149/457 (32.60%), Postives = 249/457 (54.49%), Query Frame = 1
Query:  178 FPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHY--SLASEIPFDITY------SVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILG---LKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWY-----VSVKRLHLSKSRRIVNKILWFICISA---NILVVISTTILAFYL---KQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLS 1479
            FPI++W  +Y FT+   D+V+G++VG  ++PQ ++Y  +A L P+YGL+++F G F+Y +F TSKD+ IGP A++SL  A     +  + P D T       +  L L+ G +   LG+  LGF+   +S   V+GF + +A  I WGQI  ++G   L   R   +  + +    L  T L D   G++ +V+L   K   W+     +++   +     ++ N++  F   +    N +V++  T +++ +   K  +   +S+ G +  GL           N    +K    +   + + IP   ++ ++E +AI K+F R+N YK+   QE IAIG++N++G+FF S P TGSFSR+A+ ++C  ++PFSGV TG  VLLAL  L   F FIPKA+L+A+II AV   +T +K  +  WK    DCI++  T  +++   +E G+   +  S
Sbjct:  107 FPIIKWFPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKL-DAVFGLIPLVILYVWK---WWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPISILGTVPSGL-----------NEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWS 548          
BLAST of slc26a-2 vs. Ensembl Yeast
Match: SUL2 (High affinity sulfate permease; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000004082])

HSP 1 Score: 221.476 bits (563), Expect = 1.814e-62
Identity = 147/457 (32.17%), Postives = 250/457 (54.70%), Query Frame = 1
Query:  178 FPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHY--SLASEIPFD---ITYSVI---LSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILG---LKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSV--KRL---HLSKSRRIVNKILW---FICISANILVVISTTILAFYL---KQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLS 1479
            FPI+ W+ +Y F++   D+++G+++G  ++PQ ++Y  VA L  QYGL+++F G + Y  F TSKD+ IGP A++SL  A     + ++ P     IT  VI   L+L+ G I   +G   LGF+   +S   V+GF + +A  I WGQ+  ++G   L   R   +  + +    L +T L D   G++ + +L   K   W+      RL   + SK+ R+   I W   +   S N +++I  T + + +   K      +S+ G++  GL   E+  F +  G         +  ++G  +P   ++ L+E +AI K+F R+N YK+   QE IAIG+SN++G+FF + P TGSFSR+A+ ++C  ++P SG+ +G+ VLLAL  L   F +IPKA+L+A+II AV   +  ++  +  WK+   D I +  T ++++   +E G+   +  S
Sbjct:  123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKL-DAVFGLIPLFLLYVWK---WWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLK--EVGVFHVPPG---------LMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWS 564          
BLAST of slc26a-2 vs. Ensembl Yeast
Match: YPR003C_mRNA (Putative sulfate permease; physically interacts with Hsp82p; green fluorescent protein (GFP)-fusion protein localizes to the ER; YPR003C is not an essential gene [Source:SGD;Acc:S000006207])

HSP 1 Score: 114.39 bits (285), Expect = 6.972e-27
Identity = 124/514 (24.12%), Postives = 230/514 (44.75%), Query Frame = 1
Query:  175 YFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAY-GAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHY----SLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSI-YDVCSKLEETN-LTDMACGI--VSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAI-IIVAVMFMT----DFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAII 1674
            Y P   W+  Y F  L  D+++G+SV    IP  L+Y  ++A + P  GL++    PF+Y I G+   + +GP + +SL+V       +L  E    I  S +++ ++G+I L  G+   GF+ N +S  ++ GF SS  +++    +   L L +    F +S+     +  E+   L D A     +   +   C L+  +++  RL   K  +     ++F  I   +LVVI T +++          +S+ G+       F + +F  +    T +   ++  ++ +   IVA++   E+    K+        + S++E +A+G  NIV S F +LP  G + R+ IN+   ++S  SGV  G + L+ +  L  +  +IP   L+ I  I+ +  +     D KF  R       +   +  TF  ++   +E G+ IG   S + I+  +++ + Q+    +            S  T + D M    R S  LD+ G    +  +I
Sbjct:  104 YLPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKENVSLIDISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK----FLVSLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLT--RLLKRKLMKYHKSAIFFPDI---LLVVIVTILISMKFNLKHRYGISIIGD-------FSMDNFDELKNPLT-RPRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFS--ELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARVAG----------TSNFTNLDDYMMNMKRNS--LDVEGTEEIEGCMI 586          
BLAST of slc26a-2 vs. Ensembl Nematostella
Match: EDO48275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ6])

HSP 1 Score: 360.533 bits (924), Expect = 5.932e-117
Identity = 216/543 (39.78%), Postives = 326/543 (60.04%), Query Frame = 1
Query:  115 KQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSR--RIVNKILWFICISANILVVISTTILAFYLK-QMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYEN---TSHFQGSFLWF---PFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRN 1716
            ++  DL A K     +   K FPI +W+  Y   +L+ D+++GL+VGL V+PQGLAY  VAGL PQYGL++AF G F+Y +FGTSKD+T+GPTAI+SL+V+ Y   SEIP    + ++L+L++G IQL++G+  LGF+ N++S  VVSGFTSSAAI+I   QIK +LGLK I   F   IY     + +T   D+  G++ ++VLL  + L     VK +     R  +++ KI W I I+ N +V++  +++A  L         SLTG+++ GLP F+ P   I NG  T  +TS +  ++G G+ IV LI  +E++AI KAFAR N YK+ +SQE IA+G++N++ SF  S P TGSFSRTA+N+Q    +P  G+ TG +V+LAL  L P+F +IPKASLAA+II +V+ M +F+ + R W++K+ D I    TF       +EYG+L G+G+S    ++    P     E    T   +G   +      +S+L  +  T        I L+++ +   D  +   L+ +  +  N+N
Sbjct:   23 QRKIDLEAIK-----KYTKKRFPIAKWLSKYNLHFLQCDLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLGPTAIMSLIVSAYG-KSEIP---AFVMVLTLLSGVIQLLMGILKLGFLVNFISIPVVSGFTSSAAIIIAISQIKDVLGLKNIPRPFMKRIYQTFKNIGDTRRWDLVLGLICIIVLLLMRKLGRTRWVKDVIPETPRTIKVLKKICWLIAIARNAIVILVASVVAVLLYIHGHKSVFSLTGHLEPGLPPFKAPPMTITNGNVTY-STSDVLSQLGPGLAIVPLIGFLESIAIAKAFARKNRYKVDASQELIALGLANVLSSFVSSYPVTGSFSRTAVNAQSGVATPAGGIFTGAIVILALGVLTPFFKYIPKASLAALIISSVLTMVEFQIVPRIWRVKKIDLIPLLVTF-FGCFYEIEYGILAGMGVSLAIFLYPVIWPTLTKTEQDYITIRIKGDLAYTGVEHVVSELEEL--TFSDPPPRGIILNMSMIQHTDFTVTQCLLVVIEELGNKN 552          
BLAST of slc26a-2 vs. Ensembl Nematostella
Match: EDO49691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG03])

HSP 1 Score: 171.014 bits (432), Expect = 4.338e-45
Identity = 132/459 (28.76%), Postives = 222/459 (48.37%), Query Frame = 1
Query:  166 ITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH---------------------YSLASEIP-----------FDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNN-FFLSIYDVCSKLE---ETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIP---IVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFST 1419
            + K FPIV+W+  Y F      D+  G++VG+  IPQGLA+  +A L P  GL+ A     +Y + GTSK L+ G  A++ L+VA                      Y+ +S  P             +  +V L+L+ G +Q+++GL  LGF+A Y+S  ++SGFT+ +A+L+   Q+K+I G    +N   F SI      L+    +N   +  G++ +V+L+T K +      KRL               I I A +LVV   T +++     +   + + G I KGLP   +P F                K + T +P   +++++     +++ + FA+ NG  + ++QE +A G+ N+ GSFF   P   + +RT +    ++ +    +    ++LL L F+ P F ++PKA LAA++I  +   +  F  L + W I R D +TWF T
Sbjct:   69 LEKLFPIVQWLPKYNFRKEFVADLTGGMTVGVMHIPQGLAFAMLASLPPVTGLYTALIPVMIYMLMGTSKYLSQGSFAVICLMVAQVSEREVQSYTPTPLTTPITAPYNASSSQPPMVGPWSELDSRKMEIAVTLALLIGIMQILMGLCRLGFVATYLSDPLISGFTTGSAVLVVLSQLKHIFGQVVPQNTGAFASIKVAAHMLKFIASSNPGAIITGVLCLVILVTLKFINEKYK-KRLP--------------IPIPAELLVVALGTAISYGASLSDEFGVKVLGEIPKGLPPISIPSF----------------KRMRTIVPDAFVISVVIFATNISLARMFAKKNGQTVDANQELLAYGMCNVGGSFFSCFPICNALARTVVQEN-LASTQLCSIPVICLILLVLLFMAPLFYYLPKAILAAVVIANLGGLLKQFARLRQLWCICRTDAVTWFVT 495          
BLAST of slc26a-2 vs. Ensembl Nematostella
Match: EDO48274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ5])

HSP 1 Score: 154.451 bits (389), Expect = 7.059e-44
Identity = 82/165 (49.70%), Postives = 113/165 (68.48%), Query Frame = 1
Query:  181 PIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKL 675
            PI +W+ +Y F  L+ D++ GL+VGL VIPQGLAY  +AGL   YGL++AF G F+Y IFGTSKD+++GPTAI+SL+V  Y   SE   D  +++ L+  +G IQ  +G F  GF+  ++S  V+SGFTS+AAI I  GQ+K ILGL+ IR  F   +YD   K+
Sbjct:    2 PITKWLPHYSFNNLQCDMIGGLTVGLMVIPQGLAYATIAGLPTVYGLYSAFMGCFIYCIFGTSKDVSLGPTAIMSLIVNQYCHYSEEDEDTRFAIALAFFSGLIQFAMGFFRFGFLVRFISVPVISGFTSAAAITIAAGQLKSILGLQHIRREFIYCVYDTFRKI 166          
BLAST of slc26a-2 vs. Ensembl Nematostella
Match: EDO34158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ57])

HSP 1 Score: 107.071 bits (266), Expect = 5.381e-28
Identity = 51/93 (54.84%), Postives = 68/93 (73.12%), Query Frame = 1
Query:  127 DLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILS 405
            DL A K     +   K FPI +W+  Y   +L+ D+++GL+VGL V+PQGLAY  VAGL PQYGL++AF G F+Y +FGTSKD+T+GPTAI+S
Sbjct:    4 DLEAIK-----KYTKKRFPIAKWLSKYNLHFLQCDLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLGPTAIMS 91          
BLAST of slc26a-2 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 206.068 bits (523), Expect = 1.166e-56
Identity = 142/492 (28.86%), Postives = 246/492 (50.00%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVA-----------------HYSLASEIPFDITYSVIL----SLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLK--RIRNNFFL--SIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYEN 1533
            C       ++  + PI+ W+  Y F   +  D+VSG SVG+  +PQG+AY  +A LRP YGL+ + +   +Y +FGTS+ ++IG  A++S++V                  + SL   I     Y V +    +L++G  Q++LG+   GF+A Y+S  +V G+T+ AA  +   Q+KY+ G+K  R    F L  +I D+C  L +T + ++   +V++ VL+          VK ++   S+++       + +   ++VVI  TI+  +    E   + + G I  GL     PD             SQ+   IG  I  VA+++    +++GK FA   GYK+ S+QE IA+G+SN +GSFFQ    T S SR+ +       +  +GV++  ++L+ +  +   F  +PKA L+ I+ V +  M   F  +   WK  + D + W  TF+ ++   ++ G+ + +G S L  +F    P + +  N
Sbjct:   48 CSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAVISIMVGSVTERLAPDEAFYFNGTNGSLTVNIDARDAYRVQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIV---------VKEINACYSKKLP------LPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFF---------SQL---IGDAIA-VAIVSYAITISLGKTFALKYGYKVDSNQELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGN 511          
BLAST of slc26a-2 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 205.297 bits (521), Expect = 1.625e-56
Identity = 142/492 (28.86%), Postives = 246/492 (50.00%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVA-----------------HYSLASEIPFDITYSVIL----SLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLK--RIRNNFFL--SIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYEN 1533
            C       ++  + PI+ W+  Y F   +  D+VSG SVG+  +PQG+AY  +A LRP YGL+ + +   +Y +FGTS+ ++IG  A++S++V                  + SL   I     Y V +    +L++G  Q++LG+   GF+A Y+S  +V G+T+ AA  +   Q+KY+ G+K  R    F L  +I D+C  L +T + ++   +V++ VL+          VK ++   S+++       + +   ++VVI  TI+  +    E   + + G I  GL     PD             SQ+   IG  I  VA+++    +++GK FA   GYK+ S+QE IA+G+SN +GSFFQ    T S SR+ +       +  +GV++  ++L+ +  +   F  +PKA L+ I+ V +  M   F  +   WK  + D + W  TF+ ++   ++ G+ + +G S L  +F    P + +  N
Sbjct:   49 CSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAVISIMVGSVTERLAPDEAFYFNGTNGSLTVNIDARDAYRVQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIV---------VKEINACYSKKLP------LPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFF---------SQL---IGDAIA-VAIVSYAITISLGKTFALKYGYKVDSNQELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGN 512          
BLAST of slc26a-2 vs. Ensembl Medaka
Match: slc26a1 (sulfate anion transporter 1 [Source:NCBI gene;Acc:101158870])

HSP 1 Score: 200.675 bits (509), Expect = 3.908e-55
Identity = 139/523 (26.58%), Postives = 261/523 (49.90%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH-----------------------YSLASEIP--------------FDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSI----YDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF---------QVYENTSHFQG 1551
            C  SK  + +T +FP+V W+  Y+   Y+  D++SG+ VG+ ++PQ +AY  +AG+ P YGL+ +F+   +YF+ GTSK +++G  +++SL+V                         ++L  + P              + I+ +  ++ +AG  Q+++ +F LGF++ Y+S  ++ GF + A+  I   Q KY+LGLK  R++ + ++    +++ + + +TN+ D+    + + +L+  K +               R  N++   I +   ++VV   T+ + + K     + S++G+I  G     +P F +M                   IP+ A+I+    +++ + FA+ +GY +R +QE +AIG+ N++ SFF S  T+ + ++T +      ++  S +I+  VVLL L F  P+F  + K  LA IIIV++   +  FK +   W+  + D I W  T   +  + VE G+L+GI  S + I+F    PKF          +YE+   + G
Sbjct:   42 CSASKVQKTLTSFFPVVRWLPKYKLKEYVWGDVMSGMIVGIILVPQAIAYCLLAGVEPIYGLYTSFYANIIYFLMGTSKHVSVGIFSLMSLMVGQVVDRELFLSGFDLNDDPTSKADSFNLTDDDPHTVDLMGIPCSKECYAISIAAAVTFLAGVYQIMMAVFQLGFVSVYLSAPMLDGFATGASFTILTVQAKYLLGLKIPRHHGYGTVPVTWFNIFANIHKTNVCDLITSAICISILVAGKEI-------------QDRYKNRLK--IPLPTELVVVAGATLASHFGKLNSRYSSSVSGHIPTGFIPPSVPAFSLMPRVAL------------DAIPL-AVISFAFTVSLSEMFAKKHGYTVRPNQEMVAIGLCNVIPSFFHSFTTSAALAKTMVKDSTGCQTQVSSLISALVVLLVLLFFAPFFHALQKCVLACIIIVSLRGALRKFKEVPAKWRASKNDAIVWLITMFATALISVELGLLVGIIFSMVCIIFKTQNPKFSLLGRVSDTDLYEDLEEYTG 536          
BLAST of slc26a-2 vs. Ensembl Medaka
Match: slc26a1 (sulfate anion transporter 1 [Source:NCBI gene;Acc:101158870])

HSP 1 Score: 200.675 bits (509), Expect = 3.908e-55
Identity = 139/523 (26.58%), Postives = 261/523 (49.90%), Query Frame = 1
Query:  139 CKNSKFYRLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAH-----------------------YSLASEIP--------------FDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSI----YDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVM-FMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKF---------QVYENTSHFQG 1551
            C  SK  + +T +FP+V W+  Y+   Y+  D++SG+ VG+ ++PQ +AY  +AG+ P YGL+ +F+   +YF+ GTSK +++G  +++SL+V                         ++L  + P              + I+ +  ++ +AG  Q+++ +F LGF++ Y+S  ++ GF + A+  I   Q KY+LGLK  R++ + ++    +++ + + +TN+ D+    + + +L+  K +               R  N++   I +   ++VV   T+ + + K     + S++G+I  G     +P F +M                   IP+ A+I+    +++ + FA+ +GY +R +QE +AIG+ N++ SFF S  T+ + ++T +      ++  S +I+  VVLL L F  P+F  + K  LA IIIV++   +  FK +   W+  + D I W  T   +  + VE G+L+GI  S + I+F    PKF          +YE+   + G
Sbjct:   42 CSASKVQKTLTSFFPVVRWLPKYKLKEYVWGDVMSGMIVGIILVPQAIAYCLLAGVEPIYGLYTSFYANIIYFLMGTSKHVSVGIFSLMSLMVGQVVDRELFLSGFDLNDDPTSKADSFNLTDDDPHTVDLMGIPCSKECYAISIAAAVTFLAGVYQIMMAVFQLGFVSVYLSAPMLDGFATGASFTILTVQAKYLLGLKIPRHHGYGTVPVTWFNIFANIHKTNVCDLITSAICISILVAGKEI-------------QDRYKNRLK--IPLPTELVVVAGATLASHFGKLNSRYSSSVSGHIPTGFIPPSVPAFSLMPRVAL------------DAIPL-AVISFAFTVSLSEMFAKKHGYTVRPNQEMVAIGLCNVIPSFFHSFTTSAALAKTMVKDSTGCQTQVSSLISALVVLLVLLFFAPFFHALQKCVLACIIIVSLRGALRKFKEVPAKWRASKNDAIVWLITMFATALISVELGLLVGIIFSMVCIIFKTQNPKFSLLGRVSDTDLYEDLEEYTG 536          
BLAST of slc26a-2 vs. Ensembl Medaka
Match: slc26a11 (solute carrier family 26 member 11 [Source:NCBI gene;Acc:101170906])

HSP 1 Score: 189.504 bits (480), Expect = 1.121e-53
Identity = 107/312 (34.29%), Postives = 175/312 (56.09%), Query Frame = 1
Query:  793 RIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQG--SFLWFPFISKLTAMI--DTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRN 1716
            R+  K +W +    N L+V++ ++ AF  +       ++TG+  +GLP F  P         T  +  ++ K+ G G+ ++ L+ L+E++AI KAFA  N Y+I ++QE +AIG++NI+GSF  + P TGSF RTA+NSQ    +P  G++T  +VLL+L FL P F +IPKASLA +II AV  M D+  + R W + R D + +  TF+LS    V+YG++ G+ +S   +++  +RP+ +V ++        S L FP    L+  I    ++     S+ LD   V + D  +++ L D+   F  R 
Sbjct:   29 RMARKFIWTVATMRNALLVVAASLFAFSCEAYGHYFFTITGHTSQGLPPFRPPPTSDTTSNGTTVSFGEMLKDFGGGLALIPLMGLLESIAIAKAFASQNDYRIDANQELLAIGVTNIMGSFVSAYPVTGSFGRTAVNSQTGVCTPAGGILTSVIVLLSLEFLMPAFYYIPKASLAVVIICAVAPMLDYCAVARMWSVHRLDLLPFTITFLLSF-WQVQYGIMAGVAVSGAGLLYNMARPRIKVSDHGVLVMQPCSGLTFPATEHLSRFIHAHALQVSPPRSVVLDCHHVSAIDYTVVSELKDLLRQFQLRR 339          
BLAST of slc26a-2 vs. Planmine SMEST
Match: SMESG000073280.1 (SMESG000073280.1)

HSP 1 Score: 1143.64 bits (2957), Expect = 0.000e+0
Identity = 580/583 (99.49%), Postives = 582/583 (99.83%), Query Frame = 1
Query:  109 MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKXXXXXXXXXXXXXXXQKVHADDFGIQCYKSIEDAKVIHSHINERMP 1857
            MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIR NFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLK+MEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGT+VLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKILIIVISNPQIISILQKVHADDFGIQCYKSIEDAKVIHSHINERMP
Sbjct:    1 MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRTNFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKKMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTIVLLALRFLNPYFVFIPKASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTMEAENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKILIIVISNPQIISILQKVHADDFGIQCYKSIEDAKVIHSHINERMP 583          
BLAST of slc26a-2 vs. Planmine SMEST
Match: SMESG000064566.1 (SMESG000064566.1)

HSP 1 Score: 211.846 bits (538), Expect = 7.124e-60
Identity = 145/468 (30.98%), Postives = 244/468 (52.14%), Query Frame = 1
Query:  196 IQYYRFTYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLAS--EIPFDITYSVI------------------LSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYD----VCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            ++Y   T+L  D+++GL VG   IPQ  AY  + G++P YGL+ AF+   +Y+ FG+S+ ++IG  AI+SLL   +   S  + P + T +V                   L+L  G  QLI+G+F+LGF+  Y+S  ++SGFT  +AI++   Q+KY  G+   +     S+++    VC +L  TN+       +S+++L   K +   + +K++H                I   +LVV++ T+ + YL       +S+ G I +G+P   +P  VI N +  +           + I + A+IA   ++++GK FA+ +GYKI ++QEFIA G+ NI  SFF   P+ GS SR+A+      K+  + +++  ++L  L F+ P F  +P   LA++IIVA+  M   F  L   W    +D   W  TF+ ++ L V+YG++ G+ LS + IV     P   +
Sbjct:    1 MRYKWKTWLLLDLIAGLIVGTMQIPQSFAYAQLVGIQPIYGLYLAFFPVMVYYFFGSSRHISIGTIAIVSLLSGSFLEQSLIDFPLNTTKTVGNVSASVQNEAIKASRVAGLTLFVGISQLIMGVFNLGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFP--------------IPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGVPAPVIP--VIDNMSNYI-----------SNIIVTAIIAFSVSISLGKMFAKKHGYKIDATQEFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHI 441          
BLAST of slc26a-2 vs. Planmine SMEST
Match: SMESG000064571.1 (SMESG000064571.1)

HSP 1 Score: 201.83 bits (512), Expect = 3.493e-56
Identity = 132/437 (30.21%), Postives = 230/437 (52.63%), Query Frame = 1
Query:  280 AYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPF---------DITYSVI-----------LSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYD----VCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPK 1515
            AY  + G++P YGL+ AF+   +Y+ FG+SK ++IG  AI+SLL  ++   + I F         +++ SV            L+L  G  QLI+G+F++GF+  Y+S  ++SGFT  +AI++   Q+KY  G+   +     S+++    VC +L  TN+  M    +S+++L   K +   + +K++H                I   +L++++ T+ + +L+  +   +S+ GNID+G+P   +P  VI N T  +             I + A+I    ++++GK FA+ +GYK+ ++QEFIA G+ NI  SFF   P+  S SR+A+      K+  + +++  ++L  L F+ P F  +P   LA++IIVA+  M   F  L   W    +D   W  TF+ ++ L V+YG++ G+ LS + IV     P 
Sbjct:   95 AYAQLVGIKPIYGLYLAFFPVLVYYFFGSSKHISIGTVAIVSLLTGNFLEQTLIDFPLSKHTNFSNVSASVQNEAIKASRVAGLTLFVGISQLIMGVFNIGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIQKYYGIFSVWNTIIAVCKELPHTNVPTMVLTAISIIILAVTKNVVNPILMKKIHFP--------------IPVELLLIVTGTVSSHFLRLHDKYNVSIVGNIDQGVPAPVIP--VIKNMTNYIP-----------NIIVTAIIGFSVSISLGKMFAKKHGYKVDATQEFIAFGLMNIFSSFFYCYPSGASVSRSAVQESAGGKTQITSLVSAVLILFVLLFIGPLFKQLPNCLLASVIIVALKSMLMKFVELKELWLFSIWDFSVWVITFLFTIFLDVQYGLIAGVALSIISIVLRTQSPN 504          
BLAST of slc26a-2 vs. Planmine SMEST
Match: SMESG000064571.1 (SMESG000064571.1)

HSP 1 Score: 200.675 bits (509), Expect = 3.634e-56
Identity = 140/478 (29.29%), Postives = 242/478 (50.63%), Query Frame = 1
Query:  160 RLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPF---------DITYSVI-----------LSLMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYD----VCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAVMFM-TDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPK 1515
            R     FP +  +  Y++  +L  D+++GL VG   IPQ  AY  + G++P YGL+ AF+   +Y+ FG+SK ++IG  AI+SLL  ++   + I F         +++ SV            L+L  G  QLI+G+F++GF+  Y+S  ++SGFT  +AI++   Q+KY  G+   +     S+++    VC +L  TN+  M    +S+++L   K +   + +K++H                I   +L++++ T+ + +L+  +   +S+ GNID+G+P   +P  VI N T  +             I + A+I    ++++GK FA+ +GYK+ ++QEFIA G+ NI  SFF   P+  S SR+A+      K+  + +++  ++L  L F+ P F  +P   LA++IIVA+  M   F  L   W    +D                 YG++ G+ LS + IV     P 
Sbjct:   17 RFFLGKFPFIPILMRYKWKNWLLLDLIAGLIVGTMQIPQSFAYAQLVGIKPIYGLYLAFFPVLVYYFFGSSKHISIGTVAIVSLLTGNFLEQTLIDFPLSKHTNFSNVSASVQNEAIKASRVAGLTLFVGISQLIMGVFNIGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIQKYYGIFSVWNTIIAVCKELPHTNVPTMVLTAISIIILAVTKNVVNPILMKKIHFP--------------IPVELLLIVTGTVSSHFLRLHDKYNVSIVGNIDQGVPAPVIP--VIKNMTNYIPN-----------IIVTAIIGFSVSISLGKMFAKKHGYKVDATQEFIAFGLMNIFSSFFYCYPSGASVSRSAVQESAGGKTQITSLVSAVLILFVLLFIGPLFKQLPNCLLASVIIVALKSMLMKFVELKELWLFSIWDF----------------YGLIAGVALSIISIVLRTQSPN 451          
BLAST of slc26a-2 vs. Planmine SMEST
Match: SMESG000064562.1 (SMESG000064562.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.005e-51
Identity = 157/501 (31.34%), Postives = 245/501 (48.90%), Query Frame = 1
Query:  160 RLITKYFPIVEWIQYYRF-TYLKNDIVSGLSVGLTVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSLLVAHYSLASEIPFDI--------------------TYSVILS-------------------LMAGSIQLILGLFSLGFIANYMSPIVVSGFTSSAAILIGWGQIKYILGLKRIRN----NFFLSIYDVCSKLEETNLTDMACGIVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVISTTILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFKEIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSFFQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPKASLAAIIIVAV--MFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGVLIGIGLSFLPIVFIASRPKFQV 1524
            R I +  P +  +  Y++  +L  D ++GL VG+  IPQ +AY  +AGL+P YGL+ +F+   +YF FGTS+ ++IG  AI+SLL   +   S + F I                      S+ LS                    + G +QLI+G+F+LGF+  Y+S  ++SGFT  A++ +   QIKY  GL   +     N   + + +   L +TN+  +   +V ++VL   K   W           + R+V KI   + I   ++VVI  T+++ YL   E   + + G I +GLP   LPD                F      I I A+IA    +++ K F++ +GY+I ++QE IA GI N V SFF   P+  S SR+A+      K+  + +++  ++L  L F+ P F  +P   L+AIIIVA+  MFM  F  L   W    +D  TW   F+ +  + VEYG++IGIG S L I+     PK  +
Sbjct:   77 RCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLSFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKE--WI----------NPRVVKKIR--VPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDL-------------NNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFM-QFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHI 549          
The following BLAST results are available for this feature:
BLAST of slc26a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A113.504e-11036.74solute carrier family 26 member 11 [Source:HGNC Sy... [more]
SLC26A113.504e-11036.74solute carrier family 26 member 11 [Source:HGNC Sy... [more]
SLC26A113.504e-11036.74solute carrier family 26 member 11 [Source:HGNC Sy... [more]
SLC26A113.504e-11036.74solute carrier family 26 member 11 [Source:HGNC Sy... [more]
SLC26A113.455e-5247.21solute carrier family 26 member 11 [Source:HGNC Sy... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sulp-71.234e-4726.77Anion transporter SULP-7a; SULfate Permease family... [more]
sulp-81.203e-4427.12Anion transporter SULP-8a; Anion transporter SULP-... [more]
sulp-81.203e-4427.12Anion transporter SULP-8a; Anion transporter SULP-... [more]
sulp-81.203e-4427.12Anion transporter SULP-8a; Anion transporter SULP-... [more]
sulp-22.114e-4227.54Anion transporter SULP-2; SULfate Permease family ... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Esp1.707e-10035.99gene:FBgn0013953 transcript:FBtr0304054[more]
Esp1.707e-10035.99gene:FBgn0013953 transcript:FBtr0084703[more]
CG97029.039e-9033.52gene:FBgn0039787 transcript:FBtr0336448[more]
CG97029.039e-9033.52gene:FBgn0039787 transcript:FBtr0085664[more]
CG50021.698e-8837.45gene:FBgn0034275 transcript:FBtr0089546[more]
back to top
BLAST of slc26a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a114.449e-11741.23solute carrier family 26 member 11 [Source:ZFIN;Ac... [more]
slc26a114.449e-11741.23solute carrier family 26 member 11 [Source:ZFIN;Ac... [more]
slc26a6l2.119e-6328.99solute carrier family 26 member 6, like [Source:ZF... [more]
si:ch211-117c9.23.196e-5427.66si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
si:ch211-117c9.23.387e-5427.54si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga14.260e-11540.42cyclic nucleotide gated channel alpha 1 [Source:Xe... [more]
cnga16.424e-11540.42cyclic nucleotide gated channel alpha 1 [Source:Xe... [more]
cnga12.323e-11440.54cyclic nucleotide gated channel alpha 1 [Source:Xe... [more]
cnga13.975e-11440.54cyclic nucleotide gated channel alpha 1 [Source:Xe... [more]
cnga14.027e-11440.54cyclic nucleotide gated channel alpha 1 [Source:Xe... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc26a111.366e-11336.84solute carrier family 26, member 11 [Source:MGI Sy... [more]
Slc26a63.834e-5629.20solute carrier family 26, member 6 [Source:MGI Sym... [more]
Slc26a63.834e-5629.20solute carrier family 26, member 6 [Source:MGI Sym... [more]
Slc26a63.834e-5629.20solute carrier family 26, member 6 [Source:MGI Sym... [more]
Slc26a63.834e-5629.20solute carrier family 26, member 6 [Source:MGI Sym... [more]
back to top
BLAST of slc26a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80ZD3|S2611_MOUSE9.556e-11336.84Sodium-independent sulfate anion transporter OS=Mu... [more]
sp|Q86WA9|S2611_HUMAN1.683e-10936.74Sodium-independent sulfate anion transporter OS=Ho... [more]
sp|Q58DD2|S2611_BOVIN6.283e-10938.65Sodium-independent sulfate anion transporter OS=Bo... [more]
sp|Q8GYH8|SUT42_ARATH2.540e-7233.69Probable sulfate transporter 4.2 OS=Arabidopsis th... [more]
sp|Q9FY46|SUT41_ARATH7.105e-7033.48Sulfate transporter 4.1, chloroplastic OS=Arabidop... [more]
back to top
BLAST of slc26a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ920.000e+0100.00Slc26a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
V4CH352.595e-12843.55STAS domain-containing protein OS=Lottia gigantea ... [more]
A0A210QTN23.231e-12638.67Sodium-independent sulfate anion transporter OS=Mi... [more]
A0A1S3JX491.311e-12542.83LOW QUALITY PROTEIN: sodium-independent sulfate an... [more]
K1QZQ42.703e-12142.59Sodium-independent sulfate anion transporter OS=Cr... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a114.834e-9235.20solute carrier family 26 member 11 [Source:ZFIN;Ac... [more]
slc26a6l3.098e-5728.97solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a3.21.314e-5131.25solute carrier family 26 member 3, tandem duplicat... [more]
slc26a62.238e-5128.78solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a3.28.058e-5130.97solute carrier family 26 member 3, tandem duplicat... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc26a112.982e-9843.19solute carrier family 26 member 11 [Source:ZFIN;Ac... [more]
ENSPMAT00000003427.17.807e-4625.67pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-... [more]
si:ch211-117c9.26.170e-2925.61si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
ENSPMAT00000003699.15.494e-2630.08pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 ge... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SUL18.380e-7032.60High affinity sulfate permease of the SulP anion t... [more]
SUL21.814e-6232.17High affinity sulfate permease; sulfate uptake is ... [more]
YPR003C_mRNA6.972e-2724.12Putative sulfate permease; physically interacts wi... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO482755.932e-11739.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496914.338e-4528.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482747.059e-4449.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341585.381e-2854.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc26a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-117c9.21.166e-5628.86solute carrier family 26 member 6 [Source:NCBI gen... [more]
si:ch211-117c9.21.625e-5628.86solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a13.908e-5526.58sulfate anion transporter 1 [Source:NCBI gene;Acc:... [more]
slc26a13.908e-5526.58sulfate anion transporter 1 [Source:NCBI gene;Acc:... [more]
slc26a111.121e-5334.29solute carrier family 26 member 11 [Source:NCBI ge... [more]
back to top
BLAST of slc26a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073280.10.000e+099.49SMESG000073280.1[more]
SMESG000064566.17.124e-6030.98SMESG000064566.1[more]
SMESG000064571.13.493e-5630.21SMESG000064571.1[more]
SMESG000064571.13.634e-5629.29SMESG000064571.1[more]
SMESG000064562.11.005e-5131.34SMESG000064562.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033152
GenBankAKN21606.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033152 ID=SMED30033152|Name=slc26a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1950bp
AATGTTTAATTTATTCATAAGATTTTGAGAAAGTTTACCAGATTTTTCCA
ATACTAAATATTTGGAATTAATTTTAGCAGAATTTTTTAGTTTTACTATT
CAAAATTAATGAATAAACAAGATTATGATTTGTCAGCATGCAAAAATTCA
AAATTTTATAGATTGATAACAAAATATTTTCCAATTGTTGAATGGATTCA
ATATTACAGATTTACCTATTTAAAAAACGACATCGTTTCTGGTTTGTCTG
TCGGACTCACAGTAATTCCACAGGGCTTAGCATATGGAGCAGTTGCAGGT
TTAAGGCCACAATATGGATTATTTGCTGCCTTTTGGGGGCCATTTCTTTA
TTTTATATTTGGAACATCAAAAGATTTAACTATTGGTCCTACAGCCATAT
TAAGTTTATTAGTCGCTCATTATTCTTTAGCATCTGAAATTCCATTTGAT
ATAACTTACTCTGTAATCTTATCCTTAATGGCAGGGAGTATTCAATTAAT
ATTAGGATTATTTAGTCTTGGTTTCATTGCAAATTATATGAGTCCCATTG
TCGTGAGTGGTTTTACGAGTTCTGCCGCCATTCTCATAGGATGGGGTCAA
ATAAAATATATACTTGGATTGAAACGTATTCGGAACAATTTTTTTCTATC
TATTTATGATGTTTGTTCGAAGCTAGAAGAAACCAATTTGACAGACATGG
CCTGTGGTATTGTTTCAGTAGTTGTTCTGCTCACATGCAAACTGCTGTTT
TGGTATGTAAGTGTTAAAAGATTGCATTTGTCTAAATCTCGACGAATAGT
TAACAAAATTTTGTGGTTCATTTGTATCTCTGCTAATATCTTAGTGGTTA
TTTCAACAACTATTCTTGCATTTTATCTAAAGCAAATGGAAATTGGTACT
TTGTCCTTGACGGGAAATATTGACAAAGGTCTTCCAAAATTTGAATTACC
GGATTTTGTGATAATGAATGGTACTGAAACAGTTAAAACGACTTCTCAGA
TTTTTAAGGAAATTGGAACTGGAATCCCAATAGTGGCTTTAATAGCATTA
GTAGAGGCTATGGCTATTGGCAAAGCTTTTGCTAGGCTAAATGGATATAA
AATTAGATCTAGTCAAGAATTTATAGCAATCGGTATATCAAATATTGTTG
GGTCCTTTTTTCAGTCTTTACCTACAACAGGAAGTTTTTCAAGGACAGCA
ATAAATAGTCAATGTATGAGTAAATCTCCATTTTCTGGAGTAATAACCGG
TACAGTAGTCTTGTTGGCTCTTCGATTCTTAAACCCATATTTTGTCTTTA
TTCCAAAAGCCTCTTTGGCAGCTATAATAATTGTGGCTGTCATGTTTATG
ACGGATTTCAAATTTCTTTATCGGACATGGAAAATAAAAAGATATGATTG
CATCACTTGGTTTTCTACATTCGTTCTTTCTTTGGGTTTAGGAGTTGAAT
ATGGAGTCTTGATTGGCATAGGTTTATCTTTCTTGCCGATAGTATTCATT
GCTAGTCGTCCTAAATTTCAAGTTTATGAAAATACATCTCATTTCCAAGG
AAGTTTTCTGTGGTTTCCATTCATTTCAAAACTGACTGCAATGATCGATA
CAATGGAAGCAGAAAATCGAATGTCAATTACTCTTGATCTTACCGGCGTA
TATAGTGCTGATAGTGCAATTATCAATACTCTAATAGATATTGGGCATGA
TTTTATTAATCGAAATAAGATTCTTATTATTGTTATCAGTAATCCTCAGA
TCATTTCAATATTACAAAAAGTTCATGCAGATGATTTTGGTATTCAATGC
TATAAGTCAATTGAAGATGCCAAAGTTATTCATTCTCATATCAATGAAAG
AATGCCATTATTAAATGTGATTGGTTGACTTTTACTGGAACTTTCTGAAA
AATTTTGTACTTTATTTGTCAAAAATATATTGATTTTTAGTTAAAAAAAA
back to top

protein sequence of SMED30033152-orf-1

>SMED30033152-orf-1 ID=SMED30033152-orf-1|Name=SMED30033152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=590bp
MNKQDYDLSACKNSKFYRLITKYFPIVEWIQYYRFTYLKNDIVSGLSVGL
TVIPQGLAYGAVAGLRPQYGLFAAFWGPFLYFIFGTSKDLTIGPTAILSL
LVAHYSLASEIPFDITYSVILSLMAGSIQLILGLFSLGFIANYMSPIVVS
GFTSSAAILIGWGQIKYILGLKRIRNNFFLSIYDVCSKLEETNLTDMACG
IVSVVVLLTCKLLFWYVSVKRLHLSKSRRIVNKILWFICISANILVVIST
TILAFYLKQMEIGTLSLTGNIDKGLPKFELPDFVIMNGTETVKTTSQIFK
EIGTGIPIVALIALVEAMAIGKAFARLNGYKIRSSQEFIAIGISNIVGSF
FQSLPTTGSFSRTAINSQCMSKSPFSGVITGTVVLLALRFLNPYFVFIPK
ASLAAIIIVAVMFMTDFKFLYRTWKIKRYDCITWFSTFVLSLGLGVEYGV
LIGIGLSFLPIVFIASRPKFQVYENTSHFQGSFLWFPFISKLTAMIDTME
AENRMSITLDLTGVYSADSAIINTLIDIGHDFINRNKILIIVISNPQIIS
ILQKVHADDFGIQCYKSIEDAKVIHSHINERMPLLNVIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036513STAS_dom_sf
IPR001902SLC26A/SulP_fam
IPR002645STAS_dom
IPR011547SLC26A/SulP_dom
Vocabulary: molecular function
TermDefinition
GO:0015116sulfate transmembrane transporter activity
GO:0008271secondary active sulfate transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0008272sulfate transport
GO:0055085transmembrane transport
GO:1902358sulfate transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011547SLC26A/SulP transporter domainPFAMPF00916Sulfate_transpcoord: 38..437
e-value: 8.7E-93
score: 311.1
IPR036513STAS domain superfamilyGENE3DG3DSA:3.30.750.24coord: 476..578
e-value: 5.2E-6
score: 27.8
IPR036513STAS domain superfamilySUPERFAMILYSSF52091SpoIIaa-likecoord: 489..560
IPR001902SLC26A/SulP transporterPANTHERPTHR11814SULFATE TRANSPORTERcoord: 12..555
NoneNo IPR availablePANTHERPTHR11814:SF55SODIUM-INDEPENDENT SULFATE ANION TRANSPORTERcoord: 12..555
NoneNo IPR availableTMHMMTMhelixcoord: 234..256
NoneNo IPR availableTMHMMTMhelixcoord: 395..417
NoneNo IPR availableTMHMMTMhelixcoord: 374..391
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 80..102
NoneNo IPR availableTMHMMTMhelixcoord: 438..460
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
NoneNo IPR availableTMHMMTMhelixcoord: 115..137
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
NoneNo IPR availableTMHMMTMhelixcoord: 197..219