Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30033145
Length (bp)1975
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30033145) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30033145) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30033145) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30033145) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033145

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033145SMESG000026756.1 dd_Smed_v4_11663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033145SMESG000026756.1 dd_Smed_v4_11663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033145SMESG000026756.1 dd_Smed_v4_11663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033145SMESG000026756.1 dd_Smed_v4_11663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033145SMESG000026756.1 dd_Smed_v4_11663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033145SMESG000026756.1 dd_Smed_v4_11663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033145SMESG000026756.1 Contig4611uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033145SMESG000026756.1 Contig4611newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033145SMESG000016054.1 Contig4611uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033145SMESG000016054.1 Contig4611newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30033145SMESG000026756.1 dd_Smed_v4_11663_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 96.2857 bits (238), Expect = 6.745e-40
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL    ++    +    P+H A + G++ +VRLL+  G  IE   KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+     +D  +L    P+H A+  GH  + K+LL +
Sbjct:  208 TPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK 360          

HSP 2 Score: 88.9669 bits (219), Expect = 6.745e-40
Identity = 49/145 (33.79%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            +H AC + H+ ++E+LL     I+A  ++   P+H A   GH  IVK L+       V +    TP+H A   G+ +V   LL N  KV    KDD  P+H A   GH ++VK+L+  N N    T    +PL +A+++G  + V
Sbjct:  375 LHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETV 519          

HSP 3 Score: 94.7449 bits (234), Expect = 7.491e-38
Identity = 48/154 (31.17%), Postives = 81/154 (52.60%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + ++P+H AA+ GH +    LL++   + A  K D+ P+H A + GH N+V+LL+    +  +       P+H A +  HVE V  LL+ + +     K G  P+H A  +G V + +LL+      +A    G  P+H A  + + +IVK+LL
Sbjct:  436 KVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 589          

HSP 4 Score: 83.5741 bits (205), Expect = 7.491e-38
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + +   LL      NA       P+H A Q GH E+V LL+S + +  + +++ LTP+H     G+  V  VL+ +   V+   +    P+H A  +G++ +VK L+    ++ A TK  +SPL  A+Q+G + IV LL
Sbjct:  606 LHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLL 753          

HSP 5 Score: 108.227 bits (269), Expect = 2.523e-37
Identity = 58/151 (38.41%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + K+LL       +   NG  P+H AC   +V +++LL+     +DA + +G  P+H ASF GH  IVK LL
Sbjct:  274 TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL 424          

HSP 6 Score: 68.5514 bits (166), Expect = 2.523e-37
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL    ++NA  K+ + P+H A + GH  +VKLL+    +  +      TP+H A   G+ + +  LL          K    P+H A  +G + + ++L+ ++ +  A  K   +PL +A       IV+LL
Sbjct:  441 LHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 588          

HSP 7 Score: 82.0333 bits (201), Expect = 3.351e-32
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+N      ++LL+++   +   K    P+H A    +LNV +LL++ G S+    ++   P+H A +  +V +V+LLL     +E   K+ L P+H A  +G+V I ++L+ +   + A++  G  PIH A+   H + V++LL     I+
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID 332          

HSP 8 Score: 77.411 bits (189), Expect = 3.351e-32
Identity = 45/155 (29.03%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLL-------INNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + ++LL +  + N+   N   P+H AC+  H  +++LL+      +   E+ LTP+H A F G+  ++  LL       ++N KVE        P+H A   GH  + K L+     + A  K++ +PL  A++ G + +V+LL
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-------PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 489          

HSP 9 Score: 83.5741 bits (205), Expect = 2.496e-29
Identity = 54/156 (34.62%), Postives = 79/156 (50.64%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRD--ENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y  D E+ D   + LTP+H A   G+  V  VLL    K      +   P+H AC   H+ ++++L+    +I+A T+   +PL +AS  G   IV+ L
Sbjct:  270 KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQY--DAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNL 423          

HSP 10 Score: 66.6254 bits (161), Expect = 2.496e-29
Identity = 46/186 (24.73%), Postives = 79/186 (42.47%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H A++ GHV  V  LL     +E   K     +H A   G   VVR L++ G ++    +    P++ A Q NH+E+VK LL++  N   + ++G  P+  A   G+  +V                              +L+ N    D  S TG  P+H A+ Y +  + ++LL+   ++  
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNF 234          

HSP 11 Score: 77.411 bits (189), Expect = 4.987e-29
Identity = 44/148 (29.73%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    HL+ V +LL    EI+    ++  P+H A   GH  + K+L+        R  N  TP+H AC   +  VM +LL     ++   +    P+H A F GHL IVK L+ +  +      +  +PL +A++ G +++ + L
Sbjct:  309 IHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 456          

HSP 12 Score: 71.633 bits (174), Expect = 4.987e-29
Identity = 51/193 (26.42%), Postives = 87/193 (45.08%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H++ V  LL++  N  +   D F   P+  A Q GH NVV  LI+ G                              + ++  K    P+H A    ++ + +LLL    ++  + +NG+ P+H A   GNV +V+LL+     ++ ++     P+H A+  GH  I +ILL     I+ + K
Sbjct:  113 TPLYMAAQENHLEVVKFLLENGANQNVATEDGF--TPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTK 303          

HSP 13 Score: 78.9518 bits (193), Expect = 1.156e-28
Identity = 46/154 (29.87%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI---SNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+   +    +     P+H A + GH  V + L+     +    KD + P+H A +  H  +VKLLL++  N   +   G  P+H A   G+VE V  L+   ++Q C+  +  T   P+H A+ YG   + ++LL
Sbjct:  406 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFT---PLHVAAKYGKVRVAELLL 556          

HSP 14 Score: 68.9366 bits (167), Expect = 1.156e-28
Identity = 38/148 (25.68%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +L+IV++LL +    ++   N   P+H A +    E+ + L+ Y           +TP+H A   G+ +++ +LL       +G+K    P+H     GH+ +  +LI     ++A T+  ++PL +AS  G  ++V+ L
Sbjct:  573 LHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL 720          

HSP 15 Score: 96.2857 bits (238), Expect = 6.308e-28
Identity = 62/196 (31.63%), Postives = 93/196 (47.45%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI----------------------SNQC-----------CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LLL++N            P+H A + GH+  V  L+ +  S     K    P+H A +   V + +LLL+   +  A+ KNGL P+H A  H N++IVKLL+                       NQ              +AES+ G  P+H A+  GH E+V +LLS++ N  L +K
Sbjct:  471 QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNK 666          

HSP 16 Score: 48.9062 bits (115), Expect = 6.308e-28
Identity = 27/84 (32.14%), Postives = 40/84 (47.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLI 811
            +H A   G++ +V+ LL    ++NA  K    P+H A Q GH +IV LL+           +  TP+  A   GY  V  VL +
Sbjct:  705 LHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKV 788          

HSP 17 Score: 107.457 bits (267), Expect = 3.181e-23
Identity = 55/162 (33.95%), Postives = 90/162 (55.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V LLL+++  I+        P+H A   GH  V ++L+ +G        +   P+H AC+ NHV +++LLLK+  +++A  ++GL P+H A F G++ IVK L+      +  ++    P+H A+  GH E+ K LL  +  +  + K
Sbjct:  307 SPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAK 468          

HSP 18 Score: 61.6178 bits (148), Expect = 4.404e-21
Identity = 41/149 (27.52%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++         +N +TP+H A   G   ++ +LL    ++E   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +A+Q      V LL
Sbjct:  176 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          

HSP 19 Score: 60.8474 bits (146), Expect = 4.404e-21
Identity = 35/118 (29.66%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A ++G+L+     +  G  I  C+++    +H A +  HV++V  LL  +  LE + K G   +H A   G  E+V+ L++    ++A+S  G  P++ A+   H E+VK LL    N
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN 136          

HSP 20 Score: 98.2117 bits (243), Expect = 2.333e-20
Identity = 48/151 (31.79%), Postives = 85/151 (56.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   V+    LL++  +  A       P+H A Q GH  +V LL+S+  +  + +K    P+H   Q  HV +  +L+K    ++A+ + G  P+H A  +GN+++VK L+ +Q  ++A++  G  P+H A+  GH +IV +LL
Sbjct:  604 TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL 754          

HSP 21 Score: 96.6709 bits (239), Expect = 7.290e-20
Identity = 51/163 (31.29%), Postives = 83/163 (50.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A  + ++D V LLL    +  +P      P+H A +   + V R L+  G S          P+H A Q  H E+V LLL  + N    +K+GL P+H     G+V +  +LI +   +DA +  G  P+H AS YG+ ++VK LL  + ++  + K+
Sbjct:  571 TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKL 733          

HSP 22 Score: 94.7449 bits (234), Expect = 3.050e-19
Identity = 51/156 (32.69%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H A +  HV  + LLLK   +I+A  +    P+H A   GHL +V+ L+  G S  + +     P+H A +  H E+ K LL++K  + A  K+   P+H A   G+  +VKLL+ N    +  +  G  P+H A+  GH E V  LL +  +
Sbjct:  373 TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 528          

HSP 23 Score: 88.5817 bits (218), Expect = 2.141e-17
Identity = 49/165 (29.70%), Postives = 84/165 (50.91%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGH---DEIVKILLSERCNIELQDK 495
            +P+H AAQ GH + V+LLL         +K    P+H   Q GH+ V  +LI  G  ++   +    P+H A    ++++VK LL+ + ++ A  K G  P+H A   G+ +IV LL+ N    +  S  G+ P+  A   G+    +++K++  E   + + DK
Sbjct:  637 TPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDK 801          

HSP 24 Score: 63.1586 bits (152), Expect = 5.944e-17
Identity = 46/179 (25.70%), Postives = 78/179 (43.58%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L++Y    +VR          D+ +                    TP+H A  Y   +V  +LL     V    ++   P+H A   G++ +V++L+ +   IE  TK+  +PL  A++ G  +I E+L D
Sbjct:  115 LYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLD 293          

HSP 25 Score: 45.0542 bits (105), Expect = 5.944e-17
Identity = 21/78 (26.92%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  262 LKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            L++  ++   ++NGL  +H A   G+V++V  L+  +  L+  +  G+  +H A+  G DE+V+ L++   N+  Q +
Sbjct:   32 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQ 109          

HSP 26 Score: 79.7221 bits (195), Expect = 1.114e-14
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHL IV+ LL +    N ++     P+H A + GH E+ K L+  K     + ++  TP+H A   G+ +++ +LL NN    +       P+H A   GH+  V  L+ +  +    TK+ ++PL +A++ G  ++ ELL
Sbjct:  408 LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELL 555          

HSP 27 Score: 77.7962 bits (190), Expect = 4.775e-14
Identity = 43/157 (27.39%), Postives = 82/157 (52.23%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDT 1012
            Q+    +H A  RG++ +V +LL +  +I    K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL  + +++    D   P+H A   GH  + K+L+ +     +     ++PL +A +K   +++ELL  T
Sbjct:  237 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT 393          

HSP 28 Score: 75.8702 bits (185), Expect = 2.153e-13
Identity = 41/150 (27.33%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +LN+ ++LL +   +N   +N   P+H A + G+  +V+LL+      E + +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+  +  I+  T ++ +PL +A+  G  ++ ++L D
Sbjct:  210 LHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLD 359          

HSP 29 Score: 68.9366 bits (167), Expect = 2.932e-11
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  +V +LL++    N  +K+   P+H   Q GH  +  +L+ +    +       TP+H A  YG   ++  LL +   V    K    P+H A   GH  IV +L+    +    + +  +PL +A + G+  + ++L
Sbjct:  639 LHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 30 Score: 67.781 bits (164), Expect = 5.562e-11
Identity = 43/164 (26.22%), Postives = 75/164 (45.73%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + K  V    +D    +H A   GH N+V++LL  +   N A      P+H A + GH E V  L+  +  +    +   TP+H A  YG   V  +LL  +       K+   P+H A    +L IVK+L+ +  +  +     ++PL +A+++   ++   L
Sbjct:  458 QNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSL 621          

HSP 31 Score: 55.8398 bits (133), Expect = 2.508e-7
Identity = 36/147 (24.49%), Postives = 70/147 (47.62%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA++G++D     L++   I   ++     +H A + GH+ +V  L+ +   +E   K     +H A      E+V+ L+    N+ A  + G  P++ A    ++E+VK L+ N    +  +  G  P+  A   GH+ +V  L++
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN 165          

HSP 32 Score: 51.9878 bits (123), Expect = 3.756e-6
Identity = 38/153 (24.84%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            D+  +   A   G+L+     L    +IN  ++N    +H A + GH ++V  L+  +   E   +   T +H A   G  +V+  L+     V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V  L
Sbjct:   11 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHL 163          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 95.9005 bits (237), Expect = 8.572e-40
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL    ++    +    P+H A + G++ +VRLL+  G  IE   KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+     +D  +L    P+H A+  GH  + K+LL +
Sbjct:  208 TPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK 360          

HSP 2 Score: 88.9669 bits (219), Expect = 8.572e-40
Identity = 49/145 (33.79%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            +H AC + H+ ++E+LL     I+A  ++   P+H A   GH  IVK L+       V +    TP+H A   G+ +V   LL N  KV    KDD  P+H A   GH ++VK+L+  N N    T    +PL +A+++G  + V
Sbjct:  375 LHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETV 519          

HSP 3 Score: 94.7449 bits (234), Expect = 9.363e-38
Identity = 48/154 (31.17%), Postives = 81/154 (52.60%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + ++P+H AA+ GH +    LL++   + A  K D+ P+H A + GH N+V+LL+    +  +       P+H A +  HVE V  LL+ + +     K G  P+H A  +G V + +LL+      +A    G  P+H A  + + +IVK+LL
Sbjct:  436 KVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 589          

HSP 4 Score: 83.5741 bits (205), Expect = 9.363e-38
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + +   LL      NA       P+H A Q GH E+V LL+S + +  + +++ LTP+H     G+  V  VL+ +   V+   +    P+H A  +G++ +VK L+    ++ A TK  +SPL  A+Q+G + IV LL
Sbjct:  606 LHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLL 753          

HSP 5 Score: 107.842 bits (268), Expect = 3.233e-37
Identity = 58/151 (38.41%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + K+LL       +   NG  P+H AC   +V +++LL+     +DA + +G  P+H ASF GH  IVK LL
Sbjct:  274 TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL 424          

HSP 6 Score: 68.5514 bits (166), Expect = 3.233e-37
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL    ++NA  K+ + P+H A + GH  +VKLL+    +  +      TP+H A   G+ + +  LL          K    P+H A  +G + + ++L+ ++ +  A  K   +PL +A       IV+LL
Sbjct:  441 LHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 588          

HSP 7 Score: 82.0333 bits (201), Expect = 4.085e-32
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+N      ++LL+++   +   K    P+H A    +LNV +LL++ G S+    ++   P+H A +  +V +V+LLL     +E   K+ L P+H A  +G+V I ++L+ +   + A++  G  PIH A+   H + V++LL     I+
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID 332          

HSP 8 Score: 77.411 bits (189), Expect = 4.085e-32
Identity = 45/155 (29.03%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLL-------INNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + ++LL +  + N+   N   P+H AC+  H  +++LL+      +   E+ LTP+H A F G+  ++  LL       ++N KVE        P+H A   GH  + K L+     + A  K++ +PL  A++ G + +V+LL
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-------PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 489          

HSP 9 Score: 83.5741 bits (205), Expect = 2.967e-29
Identity = 54/156 (34.62%), Postives = 79/156 (50.64%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRD--ENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y  D E+ D   + LTP+H A   G+  V  VLL    K      +   P+H AC   H+ ++++L+    +I+A T+   +PL +AS  G   IV+ L
Sbjct:  270 KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQY--DAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNL 423          

HSP 10 Score: 66.2402 bits (160), Expect = 2.967e-29
Identity = 46/186 (24.73%), Postives = 79/186 (42.47%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H A++ GHV  V  LL     +E   K     +H A   G   VVR L++ G ++    +    P++ A Q NH+E+VK LL++  N   + ++G  P+  A   G+  +V                              +L+ N    D  S TG  P+H A+ Y +  + ++LL+   ++  
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNF 234          

HSP 11 Score: 77.411 bits (189), Expect = 6.385e-29
Identity = 44/148 (29.73%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    HL+ V +LL    EI+    ++  P+H A   GH  + K+L+        R  N  TP+H AC   +  VM +LL     ++   +    P+H A F GHL IVK L+ +  +      +  +PL +A++ G +++ + L
Sbjct:  309 IHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 456          

HSP 12 Score: 71.2478 bits (173), Expect = 6.385e-29
Identity = 51/193 (26.42%), Postives = 87/193 (45.08%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H++ V  LL++  N  +   D F   P+  A Q GH NVV  LI+ G                              + ++  K    P+H A    ++ + +LLL    ++  + +NG+ P+H A   GNV +V+LL+     ++ ++     P+H A+  GH  I +ILL     I+ + K
Sbjct:  113 TPLYMAAQENHLEVVKFLLENGANQNVATEDGF--TPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTK 303          

HSP 13 Score: 78.5666 bits (192), Expect = 1.432e-28
Identity = 46/154 (29.87%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI---SNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+   +    +     P+H A + GH  V + L+     +    KD + P+H A +  H  +VKLLL++  N   +   G  P+H A   G+VE V  L+   ++Q C+  +  T   P+H A+ YG   + ++LL
Sbjct:  406 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFT---PLHVAAKYGKVRVAELLL 556          

HSP 14 Score: 68.9366 bits (167), Expect = 1.432e-28
Identity = 38/148 (25.68%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +L+IV++LL +    ++   N   P+H A +    E+ + L+ Y           +TP+H A   G+ +++ +LL       +G+K    P+H     GH+ +  +LI     ++A T+  ++PL +AS  G  ++V+ L
Sbjct:  573 LHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL 720          

HSP 15 Score: 95.9005 bits (237), Expect = 8.416e-28
Identity = 62/196 (31.63%), Postives = 93/196 (47.45%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI----------------------SNQC-----------CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LLL++N            P+H A + GH+  V  L+ +  S     K    P+H A +   V + +LLL+   +  A+ KNGL P+H A  H N++IVKLL+                       NQ              +AES+ G  P+H A+  GH E+V +LLS++ N  L +K
Sbjct:  471 QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNK 666          

HSP 16 Score: 48.9062 bits (115), Expect = 8.416e-28
Identity = 27/84 (32.14%), Postives = 40/84 (47.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLI 811
            +H A   G++ +V+ LL    ++NA  K    P+H A Q GH +IV LL+           +  TP+  A   GY  V  VL +
Sbjct:  705 LHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKV 788          

HSP 17 Score: 107.071 bits (266), Expect = 4.093e-23
Identity = 55/162 (33.95%), Postives = 90/162 (55.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V LLL+++  I+        P+H A   GH  V ++L+ +G        +   P+H AC+ NHV +++LLLK+  +++A  ++GL P+H A F G++ IVK L+      +  ++    P+H A+  GH E+ K LL  +  +  + K
Sbjct:  307 SPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAK 468          

HSP 18 Score: 61.6178 bits (148), Expect = 5.063e-21
Identity = 41/149 (27.52%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++         +N +TP+H A   G   ++ +LL    ++E   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +A+Q      V LL
Sbjct:  176 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          

HSP 19 Score: 60.4622 bits (145), Expect = 5.063e-21
Identity = 35/118 (29.66%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A ++G+L+     +  G  I  C+++    +H A +  HV++V  LL  +  LE + K G   +H A   G  E+V+ L++    ++A+S  G  P++ A+   H E+VK LL    N
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN 136          

HSP 20 Score: 97.8265 bits (242), Expect = 2.896e-20
Identity = 48/151 (31.79%), Postives = 85/151 (56.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   V+    LL++  +  A       P+H A Q GH  +V LL+S+  +  + +K    P+H   Q  HV +  +L+K    ++A+ + G  P+H A  +GN+++VK L+ +Q  ++A++  G  P+H A+  GH +IV +LL
Sbjct:  604 TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL 754          

HSP 21 Score: 96.2857 bits (238), Expect = 9.045e-20
Identity = 51/163 (31.29%), Postives = 83/163 (50.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A  + ++D V LLL    +  +P      P+H A +   + V R L+  G S          P+H A Q  H E+V LLL  + N    +K+GL P+H     G+V +  +LI +   +DA +  G  P+H AS YG+ ++VK LL  + ++  + K+
Sbjct:  571 TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKL 733          

HSP 22 Score: 94.3597 bits (233), Expect = 3.850e-19
Identity = 51/156 (32.69%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H A +  HV  + LLLK   +I+A  +    P+H A   GHL +V+ L+  G S  + +     P+H A +  H E+ K LL++K  + A  K+   P+H A   G+  +VKLL+ N    +  +  G  P+H A+  GH E V  LL +  +
Sbjct:  373 TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 528          

HSP 23 Score: 88.1965 bits (217), Expect = 2.632e-17
Identity = 49/165 (29.70%), Postives = 84/165 (50.91%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGH---DEIVKILLSERCNIELQDK 495
            +P+H AAQ GH + V+LLL         +K    P+H   Q GH+ V  +LI  G  ++   +    P+H A    ++++VK LL+ + ++ A  K G  P+H A   G+ +IV LL+ N    +  S  G+ P+  A   G+    +++K++  E   + + DK
Sbjct:  637 TPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDK 801          

HSP 24 Score: 63.1586 bits (152), Expect = 6.611e-17
Identity = 46/179 (25.70%), Postives = 78/179 (43.58%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L++Y    +VR          D+ +                    TP+H A  Y   +V  +LL     V    ++   P+H A   G++ +V++L+ +   IE  TK+  +PL  A++ G  +I E+L D
Sbjct:  115 LYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLD 293          

HSP 25 Score: 45.0542 bits (105), Expect = 6.611e-17
Identity = 21/78 (26.92%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  262 LKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            L++  ++   ++NGL  +H A   G+V++V  L+  +  L+  +  G+  +H A+  G DE+V+ L++   N+  Q +
Sbjct:   32 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQ 109          

HSP 26 Score: 79.7221 bits (195), Expect = 1.114e-14
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHL IV+ LL +    N ++     P+H A + GH E+ K L+  K     + ++  TP+H A   G+ +++ +LL NN    +       P+H A   GH+  V  L+ +  +    TK+ ++PL +A++ G  ++ ELL
Sbjct:  408 LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELL 555          

HSP 27 Score: 77.7962 bits (190), Expect = 4.776e-14
Identity = 43/157 (27.39%), Postives = 82/157 (52.23%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDT 1012
            Q+    +H A  RG++ +V +LL +  +I    K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL  + +++    D   P+H A   GH  + K+L+ +     +     ++PL +A +K   +++ELL  T
Sbjct:  237 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT 393          

HSP 28 Score: 75.8702 bits (185), Expect = 2.153e-13
Identity = 41/150 (27.33%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +LN+ ++LL +   +N   +N   P+H A + G+  +V+LL+      E + +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+  +  I+  T ++ +PL +A+  G  ++ ++L D
Sbjct:  210 LHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLD 359          

HSP 29 Score: 68.9366 bits (167), Expect = 2.932e-11
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  +V +LL++    N  +K+   P+H   Q GH  +  +L+ +    +       TP+H A  YG   ++  LL +   V    K    P+H A   GH  IV +L+    +    + +  +PL +A + G+  + ++L
Sbjct:  639 LHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 30 Score: 67.781 bits (164), Expect = 5.562e-11
Identity = 43/164 (26.22%), Postives = 75/164 (45.73%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + K  V    +D    +H A   GH N+V++LL  +   N A      P+H A + GH E V  L+  +  +    +   TP+H A  YG   V  +LL  +       K+   P+H A    +L IVK+L+ +  +  +     ++PL +A+++   ++   L
Sbjct:  458 QNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSL 621          

HSP 31 Score: 55.8398 bits (133), Expect = 2.850e-7
Identity = 36/147 (24.49%), Postives = 70/147 (47.62%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA++G++D     L++   I   ++     +H A + GH+ +V  L+ +   +E   K     +H A      E+V+ L+    N+ A  + G  P++ A    ++E+VK L+ N    +  +  G  P+  A   GH+ +V  L++
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN 165          

HSP 32 Score: 51.9878 bits (123), Expect = 3.756e-6
Identity = 38/153 (24.84%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            D+  +   A   G+L+     L    +IN  ++N    +H A + GH ++V  L+  +   E   +   T +H A   G  +V+  L+     V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V  L
Sbjct:   11 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHL 163          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 95.9005 bits (237), Expect = 9.233e-40
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL    ++    +    P+H A + G++ +VRLL+  G  IE   KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+     +D  +L    P+H A+  GH  + K+LL +
Sbjct:  241 TPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK 393          

HSP 2 Score: 88.9669 bits (219), Expect = 9.233e-40
Identity = 49/145 (33.79%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            +H AC + H+ ++E+LL     I+A  ++   P+H A   GH  IVK L+       V +    TP+H A   G+ +V   LL N  KV    KDD  P+H A   GH ++VK+L+  N N    T    +PL +A+++G  + V
Sbjct:  408 LHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETV 552          

HSP 3 Score: 94.7449 bits (234), Expect = 9.677e-38
Identity = 48/154 (31.17%), Postives = 81/154 (52.60%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + ++P+H AA+ GH +    LL++   + A  K D+ P+H A + GH N+V+LL+    +  +       P+H A +  HVE V  LL+ + +     K G  P+H A  +G V + +LL+      +A    G  P+H A  + + +IVK+LL
Sbjct:  469 KVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 622          

HSP 4 Score: 83.5741 bits (205), Expect = 9.677e-38
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + +   LL      NA       P+H A Q GH E+V LL+S + +  + +++ LTP+H     G+  V  VL+ +   V+   +    P+H A  +G++ +VK L+    ++ A TK  +SPL  A+Q+G + IV LL
Sbjct:  639 LHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLL 786          

HSP 5 Score: 107.842 bits (268), Expect = 3.482e-37
Identity = 58/151 (38.41%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + K+LL       +   NG  P+H AC   +V +++LL+     +DA + +G  P+H ASF GH  IVK LL
Sbjct:  307 TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL 457          

HSP 6 Score: 68.5514 bits (166), Expect = 3.482e-37
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL    ++NA  K+ + P+H A + GH  +VKLL+    +  +      TP+H A   G+ + +  LL          K    P+H A  +G + + ++L+ ++ +  A  K   +PL +A       IV+LL
Sbjct:  474 LHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 621          

HSP 7 Score: 81.6481 bits (200), Expect = 4.292e-32
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+N      ++LL+++   +   K    P+H A    +LNV +LL++ G S+    ++   P+H A +  +V +V+LLL     +E   K+ L P+H A  +G+V I ++L+ +   + A++  G  PIH A+   H + V++LL     I+
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID 365          

HSP 8 Score: 77.411 bits (189), Expect = 4.292e-32
Identity = 45/155 (29.03%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLL-------INNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + ++LL +  + N+   N   P+H AC+  H  +++LL+      +   E+ LTP+H A F G+  ++  LL       ++N KVE        P+H A   GH  + K L+     + A  K++ +PL  A++ G + +V+LL
Sbjct:  375 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-------PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 522          

HSP 9 Score: 83.5741 bits (205), Expect = 2.991e-29
Identity = 54/156 (34.62%), Postives = 79/156 (50.64%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRD--ENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y  D E+ D   + LTP+H A   G+  V  VLL    K      +   P+H AC   H+ ++++L+    +I+A T+   +PL +AS  G   IV+ L
Sbjct:  303 KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQY--DAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNL 456          

HSP 10 Score: 66.2402 bits (160), Expect = 2.991e-29
Identity = 46/186 (24.73%), Postives = 79/186 (42.47%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H A++ GHV  V  LL     +E   K     +H A   G   VVR L++ G ++    +    P++ A Q NH+E+VK LL++  N   + ++G  P+  A   G+  +V                              +L+ N    D  S TG  P+H A+ Y +  + ++LL+   ++  
Sbjct:   82 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNF 267          

HSP 11 Score: 77.411 bits (189), Expect = 6.764e-29
Identity = 44/148 (29.73%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    HL+ V +LL    EI+    ++  P+H A   GH  + K+L+        R  N  TP+H AC   +  VM +LL     ++   +    P+H A F GHL IVK L+ +  +      +  +PL +A++ G +++ + L
Sbjct:  342 IHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 489          

HSP 12 Score: 70.8626 bits (172), Expect = 6.764e-29
Identity = 51/193 (26.42%), Postives = 87/193 (45.08%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H++ V  LL++  N  +   D F   P+  A Q GH NVV  LI+ G                              + ++  K    P+H A    ++ + +LLL    ++  + +NG+ P+H A   GNV +V+LL+     ++ ++     P+H A+  GH  I +ILL     I+ + K
Sbjct:  146 TPLYMAAQENHLEVVKFLLENGANQNVATEDGF--TPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTK 336          

HSP 13 Score: 78.5666 bits (192), Expect = 1.467e-28
Identity = 46/154 (29.87%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI---SNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+   +    +     P+H A + GH  V + L+     +    KD + P+H A +  H  +VKLLL++  N   +   G  P+H A   G+VE V  L+   ++Q C+  +  T   P+H A+ YG   + ++LL
Sbjct:  439 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFT---PLHVAAKYGKVRVAELLL 589          

HSP 14 Score: 68.9366 bits (167), Expect = 1.467e-28
Identity = 38/148 (25.68%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +L+IV++LL +    ++   N   P+H A +    E+ + L+ Y           +TP+H A   G+ +++ +LL       +G+K    P+H     GH+ +  +LI     ++A T+  ++PL +AS  G  ++V+ L
Sbjct:  606 LHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL 753          

HSP 15 Score: 107.071 bits (266), Expect = 4.322e-23
Identity = 55/162 (33.95%), Postives = 90/162 (55.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V LLL+++  I+        P+H A   GH  V ++L+ +G        +   P+H AC+ NHV +++LLLK+  +++A  ++GL P+H A F G++ IVK L+      +  ++    P+H A+  GH E+ K LL  +  +  + K
Sbjct:  340 SPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAK 501          

HSP 16 Score: 61.6178 bits (148), Expect = 5.318e-21
Identity = 41/149 (27.52%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++         +N +TP+H A   G   ++ +LL    ++E   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +A+Q      V LL
Sbjct:  209 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 357          

HSP 17 Score: 60.4622 bits (145), Expect = 5.318e-21
Identity = 35/118 (29.66%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A ++G+L+     +  G  I  C+++    +H A +  HV++V  LL  +  LE + K G   +H A   G  E+V+ L++    ++A+S  G  P++ A+   H E+VK LL    N
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN 169          

HSP 18 Score: 97.8265 bits (242), Expect = 2.978e-20
Identity = 48/151 (31.79%), Postives = 85/151 (56.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   V+    LL++  +  A       P+H A Q GH  +V LL+S+  +  + +K    P+H   Q  HV +  +L+K    ++A+ + G  P+H A  +GN+++VK L+ +Q  ++A++  G  P+H A+  GH +IV +LL
Sbjct:  637 TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL 787          

HSP 19 Score: 96.2857 bits (238), Expect = 9.465e-20
Identity = 51/163 (31.29%), Postives = 83/163 (50.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A  + ++D V LLL    +  +P      P+H A +   + V R L+  G S          P+H A Q  H E+V LLL  + N    +K+GL P+H     G+V +  +LI +   +DA +  G  P+H AS YG+ ++VK LL  + ++  + K+
Sbjct:  604 TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKL 766          

HSP 20 Score: 95.9005 bits (237), Expect = 1.205e-19
Identity = 62/196 (31.63%), Postives = 93/196 (47.45%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI----------------------SNQC-----------CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LLL++N            P+H A + GH+  V  L+ +  S     K    P+H A +   V + +LLL+   +  A+ KNGL P+H A  H N++IVKLL+                       NQ              +AES+ G  P+H A+  GH E+V +LLS++ N  L +K
Sbjct:  504 QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNK 699          

HSP 21 Score: 94.3597 bits (233), Expect = 3.993e-19
Identity = 51/156 (32.69%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H A +  HV  + LLLK   +I+A  +    P+H A   GHL +V+ L+  G S  + +     P+H A +  H E+ K LL++K  + A  K+   P+H A   G+  +VKLL+ N    +  +  G  P+H A+  GH E V  LL +  +
Sbjct:  406 TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 561          

HSP 22 Score: 88.1965 bits (217), Expect = 2.729e-17
Identity = 49/165 (29.70%), Postives = 84/165 (50.91%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGH---DEIVKILLSERCNIELQDK 495
            +P+H AAQ GH + V+LLL         +K    P+H   Q GH+ V  +LI  G  ++   +    P+H A    ++++VK LL+ + ++ A  K G  P+H A   G+ +IV LL+ N    +  S  G+ P+  A   G+    +++K++  E   + + DK
Sbjct:  670 TPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDK 834          

HSP 23 Score: 63.1586 bits (152), Expect = 6.775e-17
Identity = 46/179 (25.70%), Postives = 78/179 (43.58%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L++Y    +VR          D+ +                    TP+H A  Y   +V  +LL     V    ++   P+H A   G++ +V++L+ +   IE  TK+  +PL  A++ G  +I E+L D
Sbjct:  148 LYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLD 326          

HSP 24 Score: 45.0542 bits (105), Expect = 6.775e-17
Identity = 21/78 (26.92%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  262 LKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            L++  ++   ++NGL  +H A   G+V++V  L+  +  L+  +  G+  +H A+  G DE+V+ L++   N+  Q +
Sbjct:   65 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQ 142          

HSP 25 Score: 79.7221 bits (195), Expect = 1.116e-14
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHL IV+ LL +    N ++     P+H A + GH E+ K L+  K     + ++  TP+H A   G+ +++ +LL NN    +       P+H A   GH+  V  L+ +  +    TK+ ++PL +A++ G  ++ ELL
Sbjct:  441 LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELL 588          

HSP 26 Score: 77.7962 bits (190), Expect = 4.784e-14
Identity = 43/157 (27.39%), Postives = 82/157 (52.23%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDT 1012
            Q+    +H A  RG++ +V +LL +  +I    K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL  + +++    D   P+H A   GH  + K+L+ +     +     ++PL +A +K   +++ELL  T
Sbjct:  270 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT 426          

HSP 27 Score: 75.8702 bits (185), Expect = 2.157e-13
Identity = 41/150 (27.33%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +LN+ ++LL +   +N   +N   P+H A + G+  +V+LL+      E + +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+  +  I+  T ++ +PL +A+  G  ++ ++L D
Sbjct:  243 LHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLD 392          

HSP 28 Score: 69.3218 bits (168), Expect = 2.141e-11
Identity = 45/186 (24.19%), Postives = 81/186 (43.55%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVE------------LLSDTLRRKIIDSLVEELGIQCFDGCSH 1081
            +H A   GH  +V +LL++    N  +K+   P+H   Q GH  +  +L+ +    +       TP+H A  YG   ++  LL +   V    K    P+H A   GH  IV +L+    +    + +  +PL +A + G+  + +            L+SD  R    +++ E L +   +G +H
Sbjct:  672 LHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGTAH 857          

HSP 29 Score: 67.781 bits (164), Expect = 5.570e-11
Identity = 43/164 (26.22%), Postives = 75/164 (45.73%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + K  V    +D    +H A   GH N+V++LL  +   N A      P+H A + GH E V  L+  +  +    +   TP+H A  YG   V  +LL  +       K+   P+H A    +L IVK+L+ +  +  +     ++PL +A+++   ++   L
Sbjct:  491 QNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSL 654          

HSP 30 Score: 55.8398 bits (133), Expect = 3.028e-7
Identity = 36/147 (24.49%), Postives = 70/147 (47.62%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA++G++D     L++   I   ++     +H A + GH+ +V  L+ +   +E   K     +H A      E+V+ L+    N+ A  + G  P++ A    ++E+VK L+ N    +  +  G  P+  A   GH+ +V  L++
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN 198          

HSP 31 Score: 51.9878 bits (123), Expect = 3.760e-6
Identity = 38/153 (24.84%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            D+  +   A   G+L+     L    +IN  ++N    +H A + GH ++V  L+  +   E   +   T +H A   G  +V+  L+     V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V  L
Sbjct:   44 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHL 196          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 97.8265 bits (242), Expect = 3.138e-38
Identity = 54/151 (35.76%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A++ G+ + V LLL     I+A  +    P+H A ++GH  VV LL+  G  +    K+   P+H A Q +HVE VK LL+ K  ++    + L  +H A   G+  + KLL+  +   +A +L+G  PIH A+F GH  IV +LL
Sbjct:  223 TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLL 373          

HSP 2 Score: 82.0333 bits (201), Expect = 3.138e-38
Identity = 43/149 (28.86%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G + +V  LL     ++A  +  + P+H A + G  EIV+LL+ +    +    N  TP+H +   G  DV +VLL       +  K    P+H A  +G L + K+L+ +    ++  K  ++PL +A++K   QI   L
Sbjct:  389 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTL 537          

HSP 3 Score: 90.5077 bits (223), Expect = 2.306e-35
Identity = 51/151 (33.77%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   V LLL+    + A  K    P+H A Q  H+  V+ L+     ++    D    +H A    H  + KLLL  + N  A   +GL PIH A F G++ IV LL+ N    D  ++ G   +H A+  G  E+V+ LL
Sbjct:  256 TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLL 406          

HSP 4 Score: 80.1073 bits (196), Expect = 2.306e-35
Identity = 44/161 (27.33%), Postives = 72/161 (44.72%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    ++    +H A   G   IV++LL      +AA  N   P+H + + G  ++  +L+       +  +   TP+H A  YG  DV  +LL      +   K+   P+H A     + I   L++        TK+  +PL LASQ+G + +V LL D
Sbjct:  412 VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLD 572          

HSP 5 Score: 87.0409 bits (214), Expect = 1.660e-33
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH++ V LLL++  + +  +      +H A + G + VVR L+  G  ++   ++++ P+H A +    EIV+LLL+   + +A+  NG  P+H +   G V++  +L+         +  G  P+H A+ YG  ++ K+LL  R
Sbjct:  355 TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRR 508          

HSP 6 Score: 77.0258 bits (188), Expect = 1.660e-33
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    E N   K    P+H A Q GH ++V LL+    +  +  ++ LT +H A      +V  +L  +    +   K    P+  AC +G++ +V  L+ Q  N+ A TK  ++PL  A+Q+G + I+ +L
Sbjct:  522 LHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 669          

HSP 7 Score: 82.0333 bits (201), Expect = 2.308e-32
Identity = 43/148 (29.05%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H+  V+ LL     ++    +Y   +H A   GH  + KLL+  + +   R  + LTPIH A F G+ +++ +LL N    +V +      +H A   G + +V+ L+     ++A  +E  +PL +AS+ G ++IV+LL
Sbjct:  291 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 438          

HSP 8 Score: 78.1814 bits (191), Expect = 2.308e-32
Identity = 48/164 (29.27%), Postives = 82/164 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H+D V  LL++  N +    D F   P+  A Q GH   V +L+      +   K +   +H A + +  +   LLL++  N +   K+G  P+H A  +GNV +  LL++    +D  +  G  P+H AS  G+  +VK+LL     I+ + +
Sbjct:   95 TPLYMAAQENHIDVVKYLLENGANQSTATEDGF--TPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTR 252          

HSP 9 Score: 85.5001 bits (210), Expect = 7.447e-32
Identity = 46/156 (29.49%), Postives = 85/156 (54.49%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     + +LLL++++  +   K    P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H A   G+ ++V+LL+     L A +  G  P+H A+   H E VK LL  +  ++
Sbjct:  159 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 314          

HSP 10 Score: 73.1738 bits (178), Expect = 7.447e-32
Identity = 42/149 (28.19%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   +   PIH A   GH  IV LL+      +V +    T +H A   G  +V+  LL N   V+   +++  P+H A   G   IV++L+    + +A T   ++PL +++++G   +  +L
Sbjct:  323 ALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 471          

HSP 11 Score: 78.9518 bits (193), Expect = 5.560e-30
Identity = 39/155 (25.16%), Postives = 80/155 (51.61%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            R ++ +H AA+ G V+ V  LL++   ++A  + ++ P+H A + G   +V+LL+      +    +   P+H + +   V++  +LL++      + K G  P+H A  +G++++ KLL+  +   D+    G  P+H A+     +I   LL+
Sbjct:  385 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLN 539          

HSP 12 Score: 73.1738 bits (178), Expect = 5.560e-30
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH ++V +LL +   I+ + K+    +H A Q     +  +L  +  D++   +   TP+  AC YG   ++  LL     V    K+   P+H A   GH HI+ +L+       A T    + L +A + G+  +V+ L
Sbjct:  555 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 702          

HSP 13 Score: 76.6406 bits (187), Expect = 3.299e-29
Identity = 47/186 (25.27%), Postives = 85/186 (45.70%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H AA+ GHV  V  LL   +++++  K     +H A   G   VV++L+ EG +I    ++   P++ A Q NH+++VK LL++  N   + ++G  P+  A   G+ + V                              LL+ N    D +S +G  P+H A+ YG+  +  +LL+    ++ 
Sbjct:   31 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDF 216          

HSP 14 Score: 73.1738 bits (178), Expect = 3.299e-29
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H A ++GH ++V+LL+        R +N L+P+H A    + + +  LL +   V+    D    +H A   GH  + K+L+ +  N  A      +P+ +A+  G   IV LL
Sbjct:  225 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLL 372          

HSP 15 Score: 73.559 bits (179), Expect = 6.664e-26
Identity = 43/146 (29.45%), Postives = 73/146 (50.00%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G++D V   LK    I   ++     +H A + GH+ +V+ L+  G S++   K     +H A      E+VK+L+K   N+ A  +NG  P++ A    ++++VK L+ N       +  G  P+  A   GH++ V ILL
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL 146          

HSP 16 Score: 65.0846 bits (157), Expect = 6.664e-26
Identity = 36/139 (25.90%), Postives = 66/139 (47.48%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +       +LL      +   K+   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    +++   +D   P+H A   GH  +V++L+ +   + A TK   SPL +A+Q
Sbjct:  158 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQ 296          

HSP 17 Score: 87.8113 bits (216), Expect = 7.372e-24
Identity = 46/163 (28.22%), Postives = 85/163 (52.15%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H A++ G  + V LLL+H    +A       P+H + + G ++V  +L+  G +  +  K    P+H A +   +++ KLLL+ +   +++ KNG  P+H A     ++I   L++     +  +  G  P+H AS  GH ++V +LL +  NI +  K
Sbjct:  420 QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK 582          

HSP 18 Score: 43.8986 bits (102), Expect = 7.372e-24
Identity = 26/116 (22.41%), Postives = 52/116 (44.83%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            ++H A     +N+ ++L     + +A  K    P+  AC  G+ ++V  L+    +   + +N  TP+H A   G+  ++ VLL +  K      +    +  A   G++ +V  L
Sbjct:  587 SLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 702          

HSP 19 Score: 98.9821 bits (245), Expect = 1.001e-20
Identity = 54/156 (34.62%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+V+  +LLL    A++   +    P+H A + G+ N+V+LL+  G  I+   +D   P+H A ++ H ++V+LLL+    L A  KNGL P+H A    +VE VK L+ ++  +D  +L     +H A+  GH  + K+LL +R N
Sbjct:  190 TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN 345          

HSP 20 Score: 89.7373 bits (221), Expect = 7.111e-18
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +   S LL +        K    P+H A Q GH ++V LL+ +G +I +  K     +H A Q + V +  +L K   + +A  K G  P+  AC +GNV++V  L+     ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  520 TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 670          

HSP 21 Score: 88.1965 bits (217), Expect = 2.319e-17
Identity = 48/162 (29.63%), Postives = 78/162 (48.15%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA+ G +D   LLL+   A ++  K    P+H A +   + +   L++ G    I  K    P+H A Q  H ++V LLL    N+  S K+GL  +H A     V +  +L  +    DA +  G  P+  A  YG+ ++V  LL +  N+  + K
Sbjct:  487 TPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK 648          

HSP 22 Score: 79.7221 bits (195), Expect = 1.152e-14
Identity = 46/150 (30.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q GH D V+LLL     I    K     +H A Q   +NV  +L   G   +   K    P+  AC   +V++V  LLK   N+ A  KNG  P+H A   G+  I+ +L+ +    +A +  G+  +  A   G+  +V  L
Sbjct:  553 TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 702          

HSP 23 Score: 76.6406 bits (187), Expect = 1.022e-13
Identity = 45/190 (23.68%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDGR---------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    +    A+H A   G   +V++L+ +   INA  +N   P++ A Q  H ++VK L+    ++    E+  TP+  A   G+   + +LL N+ K +V          KDD +                     P+H A  +G++++  +L+++   ++   +   +PL +AS++G + +V+LL D
Sbjct:   53 VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLD 242          

HSP 24 Score: 75.485 bits (184), Expect = 2.452e-13
Identity = 50/193 (25.91%), Postives = 87/193 (45.08%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            KE   +    Q+    ++ A    H+++V+ LL      + A ++   P+  A Q GH + V +L+      +VR          D+ K                    TP+H A  YG  +V T+LL     V+   ++   P+H A   G+ ++VK+L+ +   I+A T++  +PL  A++ G  Q+VELL
Sbjct:   81 KEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 273          

HSP 25 Score: 68.1662 bits (165), Expect = 3.516e-11
Identity = 37/149 (24.83%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H +   G +++  +LL      + A K    P+H A + G  ++ KLL+  +   +   +N  TP+H A       + + LL    +  +  K    P+H A   GH  +V +L+ +  NI   TK   + L LA+Q+    + ++L+
Sbjct:  456 LHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT 604          

HSP 26 Score: 66.6254 bits (161), Expect = 1.338e-10
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H A   G+  V+ +LL     +    K+   P+H A    H+  VK L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  192 LHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD 341          

HSP 27 Score: 65.0846 bits (157), Expect = 3.460e-10
Identity = 42/154 (27.27%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            Q+   A+H A   GH+ +V+ LL +   +++A K     +H A   G  E+VK+LV    +   + +N  TP++ A    + DV+  LL N        +D   P+  A   GH   V IL+  +       K     L +A++K  ++   LL
Sbjct:   25 QNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK----GKVRLPALHIAARKDDTKSAALL 174          

HSP 28 Score: 62.7734 bits (151), Expect = 1.629e-9
Identity = 34/118 (28.81%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A + G+L+ V   +  G  I  C+++    +H A +  HV +V+ LL    +++++ K G   +H A   G  E+VK+L+     ++A+S  G  P++ A+   H ++VK LL    N
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 118          

HSP 29 Score: 62.003 bits (149), Expect = 3.640e-9
Identity = 37/145 (25.52%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  569 ACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A   G+L+ V   L    +IN  ++N    +H A + GH  +V+ L+      +   +   T +H A   G  +V+ VL+     +    ++   P++ A    H+ +VK L+    N    T++ ++PL +A Q+G +Q V +L
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAIL 145          

HSP 30 Score: 50.8322 bits (120), Expect = 8.737e-6
Identity = 27/91 (29.67%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  +++ V   LK   ++   ++NGL  +H A   G+V +V+ L+     +D+ +  G+  +H AS  G  E+VK+L+ E  NI  Q +
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQ 91          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 89.3521 bits (220), Expect = 8.095e-37
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   N   P+H AC+    ++++LLV Y    +   E+ LTPIH A F G+ +++ +LL N    +V +      +H A   G + +V+ L+     ++A  +E  +PL +AS+ G ++IV+LL
Sbjct:  225 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 373          

HSP 2 Score: 85.8853 bits (211), Expect = 8.095e-37
Identity = 46/156 (29.49%), Postives = 85/156 (54.49%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     + +LLL++++  +   K    P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H A   G+ ++V+LL+     L A +  G  P+H A+   H E VK LL  +  ++
Sbjct:   61 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 216          

HSP 3 Score: 99.3673 bits (246), Expect = 3.189e-36
Identity = 54/156 (34.62%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+V+  +LLL    A++   +    P+H A + G+ N+V+LL+  G  I+   +D   P+H A ++ H ++V+LLL+    L A  KNGL P+H A    +VE VK L+ ++  +D  +L     +H A+  GH  + K+LL +R N
Sbjct:   92 TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN 247          

HSP 4 Score: 73.9442 bits (180), Expect = 3.189e-36
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+L+     I A  ++   PIH A   GH  IV LL+      +V +    T +H A   G  +V+  LL N   V+   +++  P+H A   G   IV++L+    + +A T   ++PL +++++G   +  +L
Sbjct:  259 LHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 406          

HSP 5 Score: 92.4337 bits (228), Expect = 1.268e-34
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   V LLL+    + A  K    P+H A Q  H+  V+ L+     ++    D    +H A    H  + KLLL  + N  A   NG  P+H AC    +++++LL+     + A + +G  PIH A+F GH  IV +LL
Sbjct:  158 TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLL 308          

HSP 6 Score: 75.485 bits (184), Expect = 1.268e-34
Identity = 41/149 (27.52%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G + +V  LL     ++A  +  + P+H A + G  EIV+LL+ +    +    N  TP+H +   G  DV +VLL       +  K    P+H A  +G L + K+L+ +    ++  K   +PL +A+     ++  LL
Sbjct:  324 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLL 472          

HSP 7 Score: 82.4185 bits (202), Expect = 4.744e-32
Identity = 39/156 (25.00%), Postives = 83/156 (53.21%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA+ G V+ V  LL++   ++A  + ++ P+H A + G   +V+LL+      +    +   P+H + +   V++  +LL++      + K G  P+H A  +G++++ KLL+  +   D+    G  P+H A+ Y + ++  +LL +
Sbjct:  320 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 475          

HSP 8 Score: 76.6406 bits (187), Expect = 4.744e-32
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    E N   K    P+H A Q GH ++V LL+    +  +  ++ LT +H A      +V  +L  +    +   K    P+  AC +G++ +V  L+ Q  N+ A TK  ++PL  A+Q+G + I+ +L
Sbjct:  490 LHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 637          

HSP 9 Score: 87.4261 bits (215), Expect = 8.939e-31
Identity = 46/151 (30.46%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  + LL+K+  +I+A  +    PIH A   GHLN+V LL+  G S ++ +      +H A +   VE+V+ LL++   ++A  +    P+H A   G  EIV+LL+ +    DA +  G  P+H ++  G  ++  +LL
Sbjct:  257 TPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 407          

HSP 10 Score: 67.3958 bits (163), Expect = 8.939e-31
Identity = 38/149 (25.50%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H A   G L++ ++LL +    ++A KN   P+H A    + ++  LL+          +N  TP+H A       + + LL    +  +  K    P+H A   GH  +V +L+ +  NI   TK   + L LA+Q+    + ++L+
Sbjct:  424 LHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT 572          

HSP 11 Score: 82.0333 bits (201), Expect = 1.099e-30
Identity = 43/153 (28.10%), Postives = 79/153 (51.63%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            Q+P+H A++ G  + V LLL+H    +A       P+H + + G ++V  +L+  G +  +  K    P+H A +   +++ KLLL+ +   +++ KNGL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL+
Sbjct:  355 QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 507          

HSP 12 Score: 72.4034 bits (176), Expect = 1.099e-30
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH ++V +LL +   I+ + K+    +H A Q     +  +L  +  D++   +   TP+  AC YG   ++  LL     V    K+   P+H A   GH HI+ +L+       A T    + L +A + G+  +V+ L
Sbjct:  523 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 670          

HSP 13 Score: 73.9442 bits (180), Expect = 2.200e-28
Identity = 47/159 (29.56%), Postives = 78/159 (49.06%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            AAQ  H+D V  LL++  N +    D F   P+  A Q GH   V +L+      +   K +   +H A + +  +   LLL++  N +   K+G  P+H A  +GNV +  LL++    +D  +  G  P+H AS  G+  +VK+LL     I+ + +
Sbjct:    2 AAQENHIDVVKYLLENGANQSTATEDGF--TPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTR 154          

HSP 14 Score: 72.7886 bits (177), Expect = 2.200e-28
Identity = 45/159 (28.30%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H A   GH  +VE+LL +   + A  KN   P+H A Q  H E VK L+ +K   +    + LT +H A   G++ V  +LL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV LL
Sbjct:  149 IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL 307          

HSP 15 Score: 85.1149 bits (209), Expect = 3.463e-23
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H +A+ G VD  S+LL+   A     K    P+H A + G L+V +LL+    + +   K+   P+H A   ++ ++  LLL+   +  A+ KNG  P+H A     ++I   L++     +  +  G  P+H AS  GH ++V +LL +  NI +  K
Sbjct:  389 TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK 550          

HSP 16 Score: 44.2838 bits (103), Expect = 3.463e-23
Identity = 26/116 (22.41%), Postives = 52/116 (44.83%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            ++H A     +N+ ++L     + +A  K    P+  AC  G+ ++V  L+    +   + +N  TP+H A   G+  ++ VLL +  K      +    +  A   G++ +V  L
Sbjct:  555 SLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 670          

HSP 17 Score: 90.1225 bits (222), Expect = 6.603e-18
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +   S LL +        K    P+H A Q GH ++V LL+ +G +I +  K     +H A Q + V +  +L K   + +A  K G  P+  AC +GNV++V  L+     ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  488 TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 638          

HSP 18 Score: 87.0409 bits (214), Expect = 5.967e-17
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH++ V LLL++  + +  +      +H A + G + VVR L+  G  ++   ++++ P+H A +    EIV+LLL+   + +A+  NG  P+H +   G V++  +L+         +  G  P+H A+ YG  ++ K+LL  R
Sbjct:  290 TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRR 443          

HSP 19 Score: 79.7221 bits (195), Expect = 1.158e-14
Identity = 46/150 (30.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q GH D V+LLL     I    K     +H A Q   +NV  +L   G   +   K    P+  AC   +V++V  LLK   N+ A  KNG  P+H A   G+  I+ +L+ +    +A +  G+  +  A   G+  +V  L
Sbjct:  521 TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 670          

HSP 20 Score: 79.337 bits (194), Expect = 1.689e-14
Identity = 46/162 (28.40%), Postives = 74/162 (45.68%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL+   +  A  K    P+H A +   + +   L++ G    I  K    P+H A Q  H ++V LLL    N+  S K+GL  +H A     V +  +L  +    DA +  G  P+  A  YG+ ++V  LL +  N+  + K
Sbjct:  455 TPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK 616          

HSP 21 Score: 76.6406 bits (187), Expect = 1.170e-13
Identity = 43/148 (29.05%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H A ++GH ++V+LL+        R +N L+P+H A    + + +  LL +   V+    D    +H A   GH  + K+L+ +  N  A     ++PL +A +K   +++ELL
Sbjct:  127 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 274          

HSP 22 Score: 73.559 bits (179), Expect = 8.444e-13
Identity = 39/159 (24.53%), Postives = 71/159 (44.65%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            V    ++    +H A   G   IV++LL      +AA  N   P+H + + G  ++  +L+       +  +   TP+H A  YG  DV  +LL      +   K+   P+H A  + +  +  +L+ +  +  A  K  ++PL +A++K   QI   L
Sbjct:  347 VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTL 505          

HSP 23 Score: 72.7886 bits (177), Expect = 1.472e-12
Identity = 42/150 (28.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H +   G +++  +LL      + A K    P+H A + G  ++ KLL+  +   +   +N LTP+H A  Y    V  +LL          K+   P+H A     + I   L++        TK+  +PL LASQ+G + +V LL D
Sbjct:  391 LHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLD 540          

HSP 24 Score: 71.633 bits (174), Expect = 3.491e-12
Identity = 45/155 (29.03%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRP-IHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +  A  +GH   V +LL      N      R P +H A +    +   LL+    + +V+ ++  TP+H A  YG  +V T+LL     V+   ++   P+H A   G+ ++VK+L+ +   I+A T++  +PL  A++ G  Q+VELL
Sbjct:   26 EDGFTPLAVALQQGHNQAVAILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 175          

HSP 25 Score: 70.8626 bits (172), Expect = 6.034e-12
Identity = 40/148 (27.03%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H+  V+ LL     ++    +Y   +H A   GH  + KLL+  + +   R  N  TP+H AC      VM +L+     ++   +    PIH A F GHL+IV +L+    + +       + L +A++ G  ++V  L
Sbjct:  193 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL 340          

HSP 26 Score: 70.8626 bits (172), Expect = 6.977e-12
Identity = 39/139 (28.06%), Postives = 66/139 (47.48%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFAS 426
            +P+H AA+ G +D   LLL+   A ++  K    P+H A    +  V  LL+ +G S     K+   P+H A + N ++I   LL          K G+ P+H A   G+ ++V LL+     +   + +G   +H A+
Sbjct:  422 TPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAA 560          

HSP 27 Score: 69.3218 bits (168), Expect = 1.979e-11
Identity = 42/175 (24.00%), Postives = 79/175 (45.14%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            IH A   GHLNIV +LL      +  +      +H A + G  E+V+ L+      + R   + TP+H A   G  +++ +LL +    +    +   P+H +   G + +  +L+         TK+ ++PL +A++ G   + +LL   L+R+       + G+      +HY
Sbjct:  292 IHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL---LQRRAAADSAGKNGLTPLHVAAHY 463          

HSP 28 Score: 65.855 bits (159), Expect = 2.334e-10
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H A   G+  V+ +LL     +    K+   P+H A    H+  VK L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:   94 LHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD 243          

HSP 29 Score: 64.3142 bits (155), Expect = 6.283e-10
Identity = 37/147 (25.17%), Postives = 73/147 (49.66%), Query Frame = 2
Query:  569 ACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A    H+++V+ LL      + A ++   P+  A Q GH + V +L+      +VR    L  +H A          +LL N+   +V  K    P+H A  +G++++  +L+++   ++   +   +PL +AS++G + +V+LL D
Sbjct:    2 AAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLD 144          

HSP 30 Score: 64.3142 bits (155), Expect = 6.501e-10
Identity = 36/139 (25.90%), Postives = 66/139 (47.48%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +       +LL      +   K+   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    +++   +D   P+H A   GH  +V++L+ +   + A TK   SPL +A+Q
Sbjct:   60 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQ 198          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 95.5153 bits (236), Expect = 5.200e-36
Identity = 56/192 (29.17%), Postives = 90/192 (46.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H AA++GH   V LL+     I A  K    P+H A Q  H++  R L+     ++    D   P+H A    HV + KLLL    +  +   NG  P+H AC    +++V+LL+  +  ++A + +G  P+H A+F G   IV  LL +  N +++                   +R   PL L +RA
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET------------------VRGETPLHLAARA 468          

HSP 2 Score: 75.485 bits (184), Expect = 5.200e-36
Identity = 40/148 (27.03%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G+ +IV +LL      NA  ++   P+H A + G  E+  +L+ +  DK +  +   TP+H A  YG  +V+ +LL     V++  K+   P+H A  + +  +  +L+    + +A  K  ++PL +A++K   +I   L
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 3 Score: 91.2781 bits (225), Expect = 1.950e-34
Identity = 44/154 (28.57%), Postives = 82/154 (53.25%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D V +L+++   ++A  +  + P+H A + G+ ++V LL+  G +     +D   P+H A +    E+  +LL    +     K G  P+H A  +GN+E+V+LL+     +D E      P+H A+ Y +D++  +LL
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 74.3294 bits (181), Expect = 1.950e-34
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    + NA  +    P+H + Q GH EI  LL+    D   +  N LT +H      +  V  +L  N  ++         P+H AC FG L++VK L+    ++   T+ +++PL  A+Q+G +  V  L
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 5 Score: 83.9593 bits (206), Expect = 1.353e-31
Identity = 51/183 (27.87%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYF---------------------------------DVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH+ + ++LL +S + N+   N   P+H AC+    ++V+LL+ Y+   E   E+ LTP+H A F G                                   DV+ VL+ N  KV+   ++   P+H A   G+  IV +L+    N  A T++N+SPL +A+++G  ++  +L D
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLD 545          

HSP 6 Score: 72.7886 bits (177), Expect = 1.353e-31
Identity = 42/156 (26.92%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     A +LLL++ +  +   K    P+H A   GH NV +LL+ +G ++    +    P+H A +     +  LLL     +++  K+ L P+H A   G+ ++V LL+     + A++  G  P+H A+   H +  + LL  R  ++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 7 Score: 78.5666 bits (192), Expect = 4.806e-30
Identity = 48/189 (25.40%), Postives = 84/189 (44.44%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GH + V  L+K    ++A  +     +H A   G   +V +L+  G ++ +   +   P++ A Q NH E+VK LLK   N   S ++G  P+  A   G+  +V                              LL+ N+   D  S +G  P+H A+ YGH+ + ++LL +  N+  Q +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR 258          

HSP 8 Score: 72.7886 bits (177), Expect = 4.806e-30
Identity = 42/148 (28.38%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  N+  +LL++   I++  K+   P+H A ++GH ++V LLV        + +N L P+H A    + D    LL +   V+    D   P+H A   GH+ + K+L+ ++ +  +     ++PL +A +K   ++VELL
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 74.7146 bits (182), Expect = 8.960e-29
Identity = 43/148 (29.05%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H++    LL     ++    +Y  P+H A   GH  + KLL+    D   R  N  TP+H AC      V+ +LL     +E   +    P+H A F G ++IV  L+ Q  N +  T    +PL LA++   + +V +L
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 10 Score: 72.0182 bits (175), Expect = 8.960e-29
Identity = 46/164 (28.05%), Postives = 81/164 (49.39%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H + V  LLKH  N A+   D F   P+  A Q GH  VV +L+          K +   +H A + +      LLL+++ N + + K+G  P+H A  +G+  + +LL+     ++ ++     P+H A+ +G   +  +LLS    I+ + K
Sbjct:  134 TPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK 291          

HSP 11 Score: 80.4925 bits (197), Expect = 5.166e-23
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLK---------------------------------HNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            Q+P+H A++ G+ D V LLL+                                 HN       K    P+H A + G+L VVRLL+  G  ++I  K++  P+H A   N+ ++  LLL++  + +A+ KNG  P+H A     +EI   L+  +   +A+S  G  P+H ++  GH EI  +L+    ++
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 12 Score: 46.9802 bits (110), Expect = 5.166e-23
Identity = 30/116 (25.86%), Postives = 48/116 (41.38%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            A+H      H+ + ++L     EIN+       P+H AC  G   +VK LV    D   +     TP+H A   G+ + +  LL N             P+  A   G++ +V+ L
Sbjct:  692 AMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 13 Score: 63.929 bits (154), Expect = 2.502e-22
Identity = 35/121 (28.93%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A + G L  V  L+  G  I   + +    +H A +  H E+V+ L+K +  ++A+ + G   +H A   G   IV +L+ N   ++ +S+ G  P++ A+   H+E+VK LL    N  L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL 160          

HSP 14 Score: 61.2326 bits (147), Expect = 2.502e-22
Identity = 42/155 (27.10%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRP-IHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +  A  +GH  +V +LL      N +    R P +H A +        LL+  + + +V  ++  TP+H A  YG+ +V  +LL     V    + +  P+H A  +G  ++  +L+S+   I++ TK+  +PL  A++ G  Q+V+LL
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          

HSP 15 Score: 60.077 bits (144), Expect = 7.934e-21
Identity = 39/146 (26.71%), Postives = 65/146 (44.52%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G ++ V  LL+    I   +      +H A + GH  VVR LI     ++   +     +H A       IV +L+++  N+     NG  P++ A    + E+VK L+ +       +  G  P+  A   GHD +V +LL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL 185          

HSP 16 Score: 60.077 bits (144), Expect = 7.934e-21
Identity = 37/139 (26.62%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +       +LL      +   K+   P+H A   GH  + +LL+    +   +  + ++P+H A  +G  ++  +LL     ++   KD   P+H A   GH  +V +L+ Q   I A TK   +PL +A+Q
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 17 Score: 87.8113 bits (216), Expect = 1.655e-17
Identity = 50/158 (31.65%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            SP+H A + G  +  +LLL     I++  K    P+H A ++GH  VV LL+ +G  I    K+   P+H A Q +HV+  + LL  +  ++    + L P+H A   G+V + KLL+      ++ +L G  P+H A      ++V++LL  R  IE
Sbjct:  262 SPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIE 419          

HSP 18 Score: 85.5001 bits (210), Expect = 8.536e-17
Identity = 47/162 (29.01%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  V LLLK+  AIEA  +    P+H A   G +N+V  L+ +G + ++       P+H A + N  ++V++L+++   ++A  +    P+H A   GN +IV LL+      +A +     P+H A+  G +E+  ILL    +  L  K
Sbjct:  394 TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK 555          

HSP 19 Score: 85.1149 bits (209), Expect = 1.049e-16
Identity = 47/151 (31.13%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA  GH +   LLL+    +    + +  P+H A + G  N+  LL+S G  I+   KD   P+H A ++ H ++V LL+     + A  KNGL P+H A    +V+  + L+ ++  +D  ++    P+H A+  GH  + K+LL
Sbjct:  229 TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL 379          

HSP 20 Score: 82.0333 bits (201), Expect = 9.755e-16
Identity = 45/162 (27.78%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA  G ++ V  LL+     +        P+H A +    +VVR+LI  G  ++   ++ + P+H A +  + +IV LLL++  N  A+ ++   P+H A   G  E+  +L+ +       +  G  P+H AS YG+ E+V++LL     ++++ K
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 21 Score: 78.9518 bits (193), Expect = 7.561e-15
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A++ G+++ V LLL+    ++   K    P+H A    +  V  LL+  G S +   K+   P+H A + N +EI   LL+ K +  A  + G  P+H +   G+ EI  LLI N   + A++  G   +H  +   H  + +IL +    I
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI 715          

HSP 22 Score: 78.5666 bits (192), Expect = 1.020e-14
Identity = 40/151 (26.49%), Postives = 71/151 (47.02%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   ++  S LL+      A  +    P+H + Q GH  +  LLI  G  +     +    +H   Q +HV + ++L  +   + +    G  P+H AC  G + +VK L+ N   +  ++     P+H A+  GH+  V+ LL
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 23 Score: 71.633 bits (174), Expect = 1.349e-12
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDG---------------------RPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEEL 1051
            K +  V    +    A+H A   G   IV +L+     +N    N   P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+  V+ VLL N+ K +V          KDD                       P+H A  +GH ++ ++L+ +  N+    + N SPL +A++ G + +  LL    R  IIDS  ++L
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLS--RGAIIDSRTKDL 293          

HSP 24 Score: 69.3218 bits (168), Expect = 7.320e-12
Identity = 37/150 (24.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H +AQ GH +   LL+++ + + A        +H   Q  H+ V ++L + G  I         P+H AC    + +VK L+++  ++    +    P+H A   G+   V+ L+ N    + ++ TG  P+  A   G+  +V+ L
Sbjct:  658 TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 25 Score: 67.3958 bits (163), Expect = 3.046e-11
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D+   +H A   G   +  +LL  + +     K    P+H A + G+ E+V+LL+      ++  +N++TP+H A  Y    V  +LL N    +   K+   P+H A     + I   L+    +  A ++  ++PL L++Q+G  +I  LL
Sbjct:  522 RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 26 Score: 66.2402 bits (160), Expect = 6.346e-11
Identity = 37/157 (23.57%), Postives = 74/157 (47.13%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H AA   +     LLL++  + +A  K    P+H A +   + +   L+          +    P+H + Q  H EI  LL+++  ++ A   NGL  +H      +V + ++L +N   +++++  G  P+H A  +G   +VK L+    ++
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 27 Score: 65.4698 bits (158), Expect = 1.183e-10
Identity = 38/150 (25.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH N+ ++LL +   +N   ++   P+H A + G   +  LL+S     + R ++ LTP+H A   G+  V+ +L++    +    K+   P+H A    H+   + L+     ++  T +  +PL +A+  G  ++ +LL D
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD 380          

HSP 28 Score: 63.929 bits (154), Expect = 2.998e-10
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            G L  V  LL    +IN ++ N    +H A + GH E+V+ L+  +   +       T +H A   G   ++T+L+ N   V V   +   P++ A    H  +VK L+    N    T++ ++PL +A Q+G  ++V +L
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 29 Score: 61.2326 bits (147), Expect = 2.281e-9
Identity = 35/148 (23.65%), Postives = 65/148 (43.92%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH  I  +L+    ++ A   N    +H   Q  H  + ++L +   +   +     TP+H AC +G  +++  L+ N   V    +    P+H A   GH + V+ L+    +    T    +PL +A + G+  +VE L
Sbjct:  660 LHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 30 Score: 60.8474 bits (146), Expect = 2.997e-9
Identity = 35/148 (23.65%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      ++V +L+    +++A  +  + P+H A + G+ +IV LL+    +      +  +P+H A   G  +V  +LL +N    +  K    P+H A  +G+L +V++L+ +   ++   K   +PL +A+     ++  LL
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 31 Score: 54.6842 bits (130), Expect = 2.102e-7
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            A +   +E V  LL++  ++  S+ NGL  +H A   G+ E+V+ LI  Q  +DA +  G+  +H AS  G   IV IL+    N+ +Q
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQ 128          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 95.5153 bits (236), Expect = 5.200e-36
Identity = 56/192 (29.17%), Postives = 90/192 (46.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H AA++GH   V LL+     I A  K    P+H A Q  H++  R L+     ++    D   P+H A    HV + KLLL    +  +   NG  P+H AC    +++V+LL+  +  ++A + +G  P+H A+F G   IV  LL +  N +++                   +R   PL L +RA
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET------------------VRGETPLHLAARA 468          

HSP 2 Score: 75.485 bits (184), Expect = 5.200e-36
Identity = 40/148 (27.03%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G+ +IV +LL      NA  ++   P+H A + G  E+  +L+ +  DK +  +   TP+H A  YG  +V+ +LL     V++  K+   P+H A  + +  +  +L+    + +A  K  ++PL +A++K   +I   L
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 3 Score: 91.2781 bits (225), Expect = 1.950e-34
Identity = 44/154 (28.57%), Postives = 82/154 (53.25%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D V +L+++   ++A  +  + P+H A + G+ ++V LL+  G +     +D   P+H A +    E+  +LL    +     K G  P+H A  +GN+E+V+LL+     +D E      P+H A+ Y +D++  +LL
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 74.3294 bits (181), Expect = 1.950e-34
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    + NA  +    P+H + Q GH EI  LL+    D   +  N LT +H      +  V  +L  N  ++         P+H AC FG L++VK L+    ++   T+ +++PL  A+Q+G +  V  L
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 5 Score: 83.9593 bits (206), Expect = 1.353e-31
Identity = 51/183 (27.87%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYF---------------------------------DVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH+ + ++LL +S + N+   N   P+H AC+    ++V+LL+ Y+   E   E+ LTP+H A F G                                   DV+ VL+ N  KV+   ++   P+H A   G+  IV +L+    N  A T++N+SPL +A+++G  ++  +L D
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLD 545          

HSP 6 Score: 72.7886 bits (177), Expect = 1.353e-31
Identity = 42/156 (26.92%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     A +LLL++ +  +   K    P+H A   GH NV +LL+ +G ++    +    P+H A +     +  LLL     +++  K+ L P+H A   G+ ++V LL+     + A++  G  P+H A+   H +  + LL  R  ++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 7 Score: 78.5666 bits (192), Expect = 4.806e-30
Identity = 48/189 (25.40%), Postives = 84/189 (44.44%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GH + V  L+K    ++A  +     +H A   G   +V +L+  G ++ +   +   P++ A Q NH E+VK LLK   N   S ++G  P+  A   G+  +V                              LL+ N+   D  S +G  P+H A+ YGH+ + ++LL +  N+  Q +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR 258          

HSP 8 Score: 72.7886 bits (177), Expect = 4.806e-30
Identity = 42/148 (28.38%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  N+  +LL++   I++  K+   P+H A ++GH ++V LLV        + +N L P+H A    + D    LL +   V+    D   P+H A   GH+ + K+L+ ++ +  +     ++PL +A +K   ++VELL
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 74.7146 bits (182), Expect = 8.960e-29
Identity = 43/148 (29.05%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H++    LL     ++    +Y  P+H A   GH  + KLL+    D   R  N  TP+H AC      V+ +LL     +E   +    P+H A F G ++IV  L+ Q  N +  T    +PL LA++   + +V +L
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 10 Score: 72.0182 bits (175), Expect = 8.960e-29
Identity = 46/164 (28.05%), Postives = 81/164 (49.39%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H + V  LLKH  N A+   D F   P+  A Q GH  VV +L+          K +   +H A + +      LLL+++ N + + K+G  P+H A  +G+  + +LL+     ++ ++     P+H A+ +G   +  +LLS    I+ + K
Sbjct:  134 TPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK 291          

HSP 11 Score: 80.4925 bits (197), Expect = 5.166e-23
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLK---------------------------------HNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            Q+P+H A++ G+ D V LLL+                                 HN       K    P+H A + G+L VVRLL+  G  ++I  K++  P+H A   N+ ++  LLL++  + +A+ KNG  P+H A     +EI   L+  +   +A+S  G  P+H ++  GH EI  +L+    ++
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 12 Score: 46.9802 bits (110), Expect = 5.166e-23
Identity = 30/116 (25.86%), Postives = 48/116 (41.38%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            A+H      H+ + ++L     EIN+       P+H AC  G   +VK LV    D   +     TP+H A   G+ + +  LL N             P+  A   G++ +V+ L
Sbjct:  692 AMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 13 Score: 63.929 bits (154), Expect = 2.502e-22
Identity = 35/121 (28.93%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A + G L  V  L+  G  I   + +    +H A +  H E+V+ L+K +  ++A+ + G   +H A   G   IV +L+ N   ++ +S+ G  P++ A+   H+E+VK LL    N  L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL 160          

HSP 14 Score: 61.2326 bits (147), Expect = 2.502e-22
Identity = 42/155 (27.10%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRP-IHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +  A  +GH  +V +LL      N +    R P +H A +        LL+  + + +V  ++  TP+H A  YG+ +V  +LL     V    + +  P+H A  +G  ++  +L+S+   I++ TK+  +PL  A++ G  Q+V+LL
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          

HSP 15 Score: 60.077 bits (144), Expect = 7.934e-21
Identity = 39/146 (26.71%), Postives = 65/146 (44.52%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G ++ V  LL+    I   +      +H A + GH  VVR LI     ++   +     +H A       IV +L+++  N+     NG  P++ A    + E+VK L+ +       +  G  P+  A   GHD +V +LL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL 185          

HSP 16 Score: 60.077 bits (144), Expect = 7.934e-21
Identity = 37/139 (26.62%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +       +LL      +   K+   P+H A   GH  + +LL+    +   +  + ++P+H A  +G  ++  +LL     ++   KD   P+H A   GH  +V +L+ Q   I A TK   +PL +A+Q
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 17 Score: 87.8113 bits (216), Expect = 1.655e-17
Identity = 50/158 (31.65%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            SP+H A + G  +  +LLL     I++  K    P+H A ++GH  VV LL+ +G  I    K+   P+H A Q +HV+  + LL  +  ++    + L P+H A   G+V + KLL+      ++ +L G  P+H A      ++V++LL  R  IE
Sbjct:  262 SPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIE 419          

HSP 18 Score: 85.5001 bits (210), Expect = 8.536e-17
Identity = 47/162 (29.01%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  V LLLK+  AIEA  +    P+H A   G +N+V  L+ +G + ++       P+H A + N  ++V++L+++   ++A  +    P+H A   GN +IV LL+      +A +     P+H A+  G +E+  ILL    +  L  K
Sbjct:  394 TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK 555          

HSP 19 Score: 85.1149 bits (209), Expect = 1.049e-16
Identity = 47/151 (31.13%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA  GH +   LLL+    +    + +  P+H A + G  N+  LL+S G  I+   KD   P+H A ++ H ++V LL+     + A  KNGL P+H A    +V+  + L+ ++  +D  ++    P+H A+  GH  + K+LL
Sbjct:  229 TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL 379          

HSP 20 Score: 82.0333 bits (201), Expect = 9.755e-16
Identity = 45/162 (27.78%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA  G ++ V  LL+     +        P+H A +    +VVR+LI  G  ++   ++ + P+H A +  + +IV LLL++  N  A+ ++   P+H A   G  E+  +L+ +       +  G  P+H AS YG+ E+V++LL     ++++ K
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 21 Score: 78.9518 bits (193), Expect = 7.561e-15
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A++ G+++ V LLL+    ++   K    P+H A    +  V  LL+  G S +   K+   P+H A + N +EI   LL+ K +  A  + G  P+H +   G+ EI  LLI N   + A++  G   +H  +   H  + +IL +    I
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI 715          

HSP 22 Score: 78.5666 bits (192), Expect = 1.020e-14
Identity = 40/151 (26.49%), Postives = 71/151 (47.02%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   ++  S LL+      A  +    P+H + Q GH  +  LLI  G  +     +    +H   Q +HV + ++L  +   + +    G  P+H AC  G + +VK L+ N   +  ++     P+H A+  GH+  V+ LL
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 23 Score: 71.633 bits (174), Expect = 1.349e-12
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDG---------------------RPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEEL 1051
            K +  V    +    A+H A   G   IV +L+     +N    N   P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+  V+ VLL N+ K +V          KDD                       P+H A  +GH ++ ++L+ +  N+    + N SPL +A++ G + +  LL    R  IIDS  ++L
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLS--RGAIIDSRTKDL 293          

HSP 24 Score: 69.3218 bits (168), Expect = 7.320e-12
Identity = 37/150 (24.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H +AQ GH +   LL+++ + + A        +H   Q  H+ V ++L + G  I         P+H AC    + +VK L+++  ++    +    P+H A   G+   V+ L+ N    + ++ TG  P+  A   G+  +V+ L
Sbjct:  658 TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 25 Score: 67.3958 bits (163), Expect = 3.046e-11
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D+   +H A   G   +  +LL  + +     K    P+H A + G+ E+V+LL+      ++  +N++TP+H A  Y    V  +LL N    +   K+   P+H A     + I   L+    +  A ++  ++PL L++Q+G  +I  LL
Sbjct:  522 RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 26 Score: 66.2402 bits (160), Expect = 6.346e-11
Identity = 37/157 (23.57%), Postives = 74/157 (47.13%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H AA   +     LLL++  + +A  K    P+H A +   + +   L+          +    P+H + Q  H EI  LL+++  ++ A   NGL  +H      +V + ++L +N   +++++  G  P+H A  +G   +VK L+    ++
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 27 Score: 65.4698 bits (158), Expect = 1.183e-10
Identity = 38/150 (25.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH N+ ++LL +   +N   ++   P+H A + G   +  LL+S     + R ++ LTP+H A   G+  V+ +L++    +    K+   P+H A    H+   + L+     ++  T +  +PL +A+  G  ++ +LL D
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD 380          

HSP 28 Score: 63.929 bits (154), Expect = 2.998e-10
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            G L  V  LL    +IN ++ N    +H A + GH E+V+ L+  +   +       T +H A   G   ++T+L+ N   V V   +   P++ A    H  +VK L+    N    T++ ++PL +A Q+G  ++V +L
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 29 Score: 61.2326 bits (147), Expect = 2.281e-9
Identity = 35/148 (23.65%), Postives = 65/148 (43.92%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH  I  +L+    ++ A   N    +H   Q  H  + ++L +   +   +     TP+H AC +G  +++  L+ N   V    +    P+H A   GH + V+ L+    +    T    +PL +A + G+  +VE L
Sbjct:  660 LHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 30 Score: 60.8474 bits (146), Expect = 2.997e-9
Identity = 35/148 (23.65%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      ++V +L+    +++A  +  + P+H A + G+ +IV LL+    +      +  +P+H A   G  +V  +LL +N    +  K    P+H A  +G+L +V++L+ +   ++   K   +PL +A+     ++  LL
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 31 Score: 54.6842 bits (130), Expect = 2.102e-7
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            A +   +E V  LL++  ++  S+ NGL  +H A   G+ E+V+ LI  Q  +DA +  G+  +H AS  G   IV IL+    N+ +Q
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQ 128          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 95.5153 bits (236), Expect = 5.836e-36
Identity = 56/192 (29.17%), Postives = 90/192 (46.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H AA++GH   V LL+     I A  K    P+H A Q  H++  R L+     ++    D   P+H A    HV + KLLL    +  +   NG  P+H AC    +++V+LL+  +  ++A + +G  P+H A+F G   IV  LL +  N +++                   +R   PL L +RA
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET------------------VRGETPLHLAARA 468          

HSP 2 Score: 75.485 bits (184), Expect = 5.836e-36
Identity = 40/148 (27.03%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G+ +IV +LL      NA  ++   P+H A + G  E+  +L+ +  DK +  +   TP+H A  YG  +V+ +LL     V++  K+   P+H A  + +  +  +L+    + +A  K  ++PL +A++K   +I   L
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 3 Score: 91.2781 bits (225), Expect = 2.225e-34
Identity = 44/154 (28.57%), Postives = 82/154 (53.25%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D V +L+++   ++A  +  + P+H A + G+ ++V LL+  G +     +D   P+H A +    E+  +LL    +     K G  P+H A  +GN+E+V+LL+     +D E      P+H A+ Y +D++  +LL
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 74.3294 bits (181), Expect = 2.225e-34
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    + NA  +    P+H + Q GH EI  LL+    D   +  N LT +H      +  V  +L  N  ++         P+H AC FG L++VK L+    ++   T+ +++PL  A+Q+G +  V  L
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 5 Score: 83.9593 bits (206), Expect = 1.398e-31
Identity = 51/183 (27.87%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYF---------------------------------DVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH+ + ++LL +S + N+   N   P+H AC+    ++V+LL+ Y+   E   E+ LTP+H A F G                                   DV+ VL+ N  KV+   ++   P+H A   G+  IV +L+    N  A T++N+SPL +A+++G  ++  +L D
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLD 545          

HSP 6 Score: 72.4034 bits (176), Expect = 1.398e-31
Identity = 42/156 (26.92%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     A +LLL++ +  +   K    P+H A   GH NV +LL+ +G ++    +    P+H A +     +  LLL     +++  K+ L P+H A   G+ ++V LL+     + A++  G  P+H A+   H +  + LL  R  ++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 7 Score: 78.1814 bits (191), Expect = 5.482e-30
Identity = 48/189 (25.40%), Postives = 84/189 (44.44%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GH + V  L+K    ++A  +     +H A   G   +V +L+  G ++ +   +   P++ A Q NH E+VK LLK   N   S ++G  P+  A   G+  +V                              LL+ N+   D  S +G  P+H A+ YGH+ + ++LL +  N+  Q +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR 258          

HSP 8 Score: 72.7886 bits (177), Expect = 5.482e-30
Identity = 42/148 (28.38%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  N+  +LL++   I++  K+   P+H A ++GH ++V LLV        + +N L P+H A    + D    LL +   V+    D   P+H A   GH+ + K+L+ ++ +  +     ++PL +A +K   ++VELL
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 74.7146 bits (182), Expect = 9.727e-29
Identity = 43/148 (29.05%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H++    LL     ++    +Y  P+H A   GH  + KLL+    D   R  N  TP+H AC      V+ +LL     +E   +    P+H A F G ++IV  L+ Q  N +  T    +PL LA++   + +V +L
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 10 Score: 72.0182 bits (175), Expect = 9.727e-29
Identity = 46/164 (28.05%), Postives = 81/164 (49.39%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H + V  LLKH  N A+   D F   P+  A Q GH  VV +L+          K +   +H A + +      LLL+++ N + + K+G  P+H A  +G+  + +LL+     ++ ++     P+H A+ +G   +  +LLS    I+ + K
Sbjct:  134 TPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK 291          

HSP 11 Score: 80.4925 bits (197), Expect = 5.471e-23
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLK---------------------------------HNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            Q+P+H A++ G+ D V LLL+                                 HN       K    P+H A + G+L VVRLL+  G  ++I  K++  P+H A   N+ ++  LLL++  + +A+ KNG  P+H A     +EI   L+  +   +A+S  G  P+H ++  GH EI  +L+    ++
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 12 Score: 46.9802 bits (110), Expect = 5.471e-23
Identity = 30/116 (25.86%), Postives = 48/116 (41.38%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            A+H      H+ + ++L     EIN+       P+H AC  G   +VK LV    D   +     TP+H A   G+ + +  LL N             P+  A   G++ +V+ L
Sbjct:  692 AMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 13 Score: 63.929 bits (154), Expect = 2.738e-22
Identity = 35/121 (28.93%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A + G L  V  L+  G  I   + +    +H A +  H E+V+ L+K +  ++A+ + G   +H A   G   IV +L+ N   ++ +S+ G  P++ A+   H+E+VK LL    N  L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL 160          

HSP 14 Score: 61.2326 bits (147), Expect = 2.738e-22
Identity = 42/155 (27.10%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRP-IHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +  A  +GH  +V +LL      N +    R P +H A +        LL+  + + +V  ++  TP+H A  YG+ +V  +LL     V    + +  P+H A  +G  ++  +L+S+   I++ TK+  +PL  A++ G  Q+V+LL
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          

HSP 15 Score: 60.077 bits (144), Expect = 8.825e-21
Identity = 37/139 (26.62%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +       +LL      +   K+   P+H A   GH  + +LL+    +   +  + ++P+H A  +G  ++  +LL     ++   KD   P+H A   GH  +V +L+ Q   I A TK   +PL +A+Q
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 16 Score: 59.6918 bits (143), Expect = 8.825e-21
Identity = 39/146 (26.71%), Postives = 65/146 (44.52%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G ++ V  LL+    I   +      +H A + GH  VVR LI     ++   +     +H A       IV +L+++  N+     NG  P++ A    + E+VK L+ +       +  G  P+  A   GHD +V +LL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL 185          

HSP 17 Score: 87.4261 bits (215), Expect = 1.764e-17
Identity = 50/158 (31.65%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            SP+H A + G  +  +LLL     I++  K    P+H A ++GH  VV LL+ +G  I    K+   P+H A Q +HV+  + LL  +  ++    + L P+H A   G+V + KLL+      ++ +L G  P+H A      ++V++LL  R  IE
Sbjct:  262 SPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIE 419          

HSP 18 Score: 85.1149 bits (209), Expect = 9.574e-17
Identity = 47/162 (29.01%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  V LLLK+  AIEA  +    P+H A   G +N+V  L+ +G + ++       P+H A + N  ++V++L+++   ++A  +    P+H A   GN +IV LL+      +A +     P+H A+  G +E+  ILL    +  L  K
Sbjct:  394 TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK 555          

HSP 19 Score: 85.1149 bits (209), Expect = 1.127e-16
Identity = 47/151 (31.13%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA  GH +   LLL+    +    + +  P+H A + G  N+  LL+S G  I+   KD   P+H A ++ H ++V LL+     + A  KNGL P+H A    +V+  + L+ ++  +D  ++    P+H A+  GH  + K+LL
Sbjct:  229 TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL 379          

HSP 20 Score: 81.6481 bits (200), Expect = 1.122e-15
Identity = 45/162 (27.78%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA  G ++ V  LL+     +        P+H A +    +VVR+LI  G  ++   ++ + P+H A +  + +IV LLL++  N  A+ ++   P+H A   G  E+  +L+ +       +  G  P+H AS YG+ E+V++LL     ++++ K
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 21 Score: 78.9518 bits (193), Expect = 7.914e-15
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A++ G+++ V LLL+    ++   K    P+H A    +  V  LL+  G S +   K+   P+H A + N +EI   LL+ K +  A  + G  P+H +   G+ EI  LLI N   + A++  G   +H  +   H  + +IL +    I
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI 715          

HSP 22 Score: 78.5666 bits (192), Expect = 1.096e-14
Identity = 40/151 (26.49%), Postives = 71/151 (47.02%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   ++  S LL+      A  +    P+H + Q GH  +  LLI  G  +     +    +H   Q +HV + ++L  +   + +    G  P+H AC  G + +VK L+ N   +  ++     P+H A+  GH+  V+ LL
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 23 Score: 71.633 bits (174), Expect = 1.352e-12
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDG---------------------RPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEEL 1051
            K +  V    +    A+H A   G   IV +L+     +N    N   P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+  V+ VLL N+ K +V          KDD                       P+H A  +GH ++ ++L+ +  N+    + N SPL +A++ G + +  LL    R  IIDS  ++L
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLS--RGAIIDSRTKDL 293          

HSP 24 Score: 69.3218 bits (168), Expect = 7.593e-12
Identity = 37/150 (24.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H +AQ GH +   LL+++ + + A        +H   Q  H+ V ++L + G  I         P+H AC    + +VK L+++  ++    +    P+H A   G+   V+ L+ N    + ++ TG  P+  A   G+  +V+ L
Sbjct:  658 TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 25 Score: 67.3958 bits (163), Expect = 3.053e-11
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D+   +H A   G   +  +LL  + +     K    P+H A + G+ E+V+LL+      ++  +N++TP+H A  Y    V  +LL N    +   K+   P+H A     + I   L+    +  A ++  ++PL L++Q+G  +I  LL
Sbjct:  522 RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 26 Score: 66.2402 bits (160), Expect = 6.525e-11
Identity = 37/157 (23.57%), Postives = 74/157 (47.13%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H AA   +     LLL++  + +A  K    P+H A +   + +   L+          +    P+H + Q  H EI  LL+++  ++ A   NGL  +H      +V + ++L +N   +++++  G  P+H A  +G   +VK L+    ++
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 27 Score: 65.4698 bits (158), Expect = 1.186e-10
Identity = 38/150 (25.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH N+ ++LL +   +N   ++   P+H A + G   +  LL+S     + R ++ LTP+H A   G+  V+ +L++    +    K+   P+H A    H+   + L+     ++  T +  +PL +A+  G  ++ +LL D
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD 380          

HSP 28 Score: 63.929 bits (154), Expect = 3.005e-10
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            G L  V  LL    +IN ++ N    +H A + GH E+V+ L+  +   +       T +H A   G   ++T+L+ N   V V   +   P++ A    H  +VK L+    N    T++ ++PL +A Q+G  ++V +L
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 29 Score: 61.2326 bits (147), Expect = 2.286e-9
Identity = 35/148 (23.65%), Postives = 65/148 (43.92%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH  I  +L+    ++ A   N    +H   Q  H  + ++L +   +   +     TP+H AC +G  +++  L+ N   V    +    P+H A   GH + V+ L+    +    T    +PL +A + G+  +VE L
Sbjct:  660 LHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 30 Score: 60.8474 bits (146), Expect = 3.003e-9
Identity = 35/148 (23.65%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      ++V +L+    +++A  +  + P+H A + G+ +IV LL+    +      +  +P+H A   G  +V  +LL +N    +  K    P+H A  +G+L +V++L+ +   ++   K   +PL +A+     ++  LL
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 31 Score: 54.6842 bits (130), Expect = 2.392e-7
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            A +   +E V  LL++  ++  S+ NGL  +H A   G+ E+V+ LI  Q  +DA +  G+  +H AS  G   IV IL+    N+ +Q
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQ 128          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 95.5153 bits (236), Expect = 5.836e-36
Identity = 56/192 (29.17%), Postives = 90/192 (46.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H AA++GH   V LL+     I A  K    P+H A Q  H++  R L+     ++    D   P+H A    HV + KLLL    +  +   NG  P+H AC    +++V+LL+  +  ++A + +G  P+H A+F G   IV  LL +  N +++                   +R   PL L +RA
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET------------------VRGETPLHLAARA 468          

HSP 2 Score: 75.485 bits (184), Expect = 5.836e-36
Identity = 40/148 (27.03%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G+ +IV +LL      NA  ++   P+H A + G  E+  +L+ +  DK +  +   TP+H A  YG  +V+ +LL     V++  K+   P+H A  + +  +  +L+    + +A  K  ++PL +A++K   +I   L
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 3 Score: 91.2781 bits (225), Expect = 2.225e-34
Identity = 44/154 (28.57%), Postives = 82/154 (53.25%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D V +L+++   ++A  +  + P+H A + G+ ++V LL+  G +     +D   P+H A +    E+  +LL    +     K G  P+H A  +GN+E+V+LL+     +D E      P+H A+ Y +D++  +LL
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 74.3294 bits (181), Expect = 2.225e-34
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    + NA  +    P+H + Q GH EI  LL+    D   +  N LT +H      +  V  +L  N  ++         P+H AC FG L++VK L+    ++   T+ +++PL  A+Q+G +  V  L
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 5 Score: 83.9593 bits (206), Expect = 1.398e-31
Identity = 51/183 (27.87%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYF---------------------------------DVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH+ + ++LL +S + N+   N   P+H AC+    ++V+LL+ Y+   E   E+ LTP+H A F G                                   DV+ VL+ N  KV+   ++   P+H A   G+  IV +L+    N  A T++N+SPL +A+++G  ++  +L D
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLD 545          

HSP 6 Score: 72.4034 bits (176), Expect = 1.398e-31
Identity = 42/156 (26.92%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     A +LLL++ +  +   K    P+H A   GH NV +LL+ +G ++    +    P+H A +     +  LLL     +++  K+ L P+H A   G+ ++V LL+     + A++  G  P+H A+   H +  + LL  R  ++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 7 Score: 78.1814 bits (191), Expect = 5.482e-30
Identity = 48/189 (25.40%), Postives = 84/189 (44.44%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GH + V  L+K    ++A  +     +H A   G   +V +L+  G ++ +   +   P++ A Q NH E+VK LLK   N   S ++G  P+  A   G+  +V                              LL+ N+   D  S +G  P+H A+ YGH+ + ++LL +  N+  Q +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR 258          

HSP 8 Score: 72.7886 bits (177), Expect = 5.482e-30
Identity = 42/148 (28.38%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  N+  +LL++   I++  K+   P+H A ++GH ++V LLV        + +N L P+H A    + D    LL +   V+    D   P+H A   GH+ + K+L+ ++ +  +     ++PL +A +K   ++VELL
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 74.7146 bits (182), Expect = 9.727e-29
Identity = 43/148 (29.05%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H++    LL     ++    +Y  P+H A   GH  + KLL+    D   R  N  TP+H AC      V+ +LL     +E   +    P+H A F G ++IV  L+ Q  N +  T    +PL LA++   + +V +L
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 10 Score: 72.0182 bits (175), Expect = 9.727e-29
Identity = 46/164 (28.05%), Postives = 81/164 (49.39%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H + V  LLKH  N A+   D F   P+  A Q GH  VV +L+          K +   +H A + +      LLL+++ N + + K+G  P+H A  +G+  + +LL+     ++ ++     P+H A+ +G   +  +LLS    I+ + K
Sbjct:  134 TPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK 291          

HSP 11 Score: 80.4925 bits (197), Expect = 5.471e-23
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLK---------------------------------HNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            Q+P+H A++ G+ D V LLL+                                 HN       K    P+H A + G+L VVRLL+  G  ++I  K++  P+H A   N+ ++  LLL++  + +A+ KNG  P+H A     +EI   L+  +   +A+S  G  P+H ++  GH EI  +L+    ++
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 12 Score: 46.9802 bits (110), Expect = 5.471e-23
Identity = 30/116 (25.86%), Postives = 48/116 (41.38%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            A+H      H+ + ++L     EIN+       P+H AC  G   +VK LV    D   +     TP+H A   G+ + +  LL N             P+  A   G++ +V+ L
Sbjct:  692 AMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 13 Score: 63.929 bits (154), Expect = 2.738e-22
Identity = 35/121 (28.93%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A + G L  V  L+  G  I   + +    +H A +  H E+V+ L+K +  ++A+ + G   +H A   G   IV +L+ N   ++ +S+ G  P++ A+   H+E+VK LL    N  L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL 160          

HSP 14 Score: 61.2326 bits (147), Expect = 2.738e-22
Identity = 42/155 (27.10%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRP-IHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +  A  +GH  +V +LL      N +    R P +H A +        LL+  + + +V  ++  TP+H A  YG+ +V  +LL     V    + +  P+H A  +G  ++  +L+S+   I++ TK+  +PL  A++ G  Q+V+LL
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          

HSP 15 Score: 60.077 bits (144), Expect = 8.825e-21
Identity = 37/139 (26.62%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +       +LL      +   K+   P+H A   GH  + +LL+    +   +  + ++P+H A  +G  ++  +LL     ++   KD   P+H A   GH  +V +L+ Q   I A TK   +PL +A+Q
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 16 Score: 59.6918 bits (143), Expect = 8.825e-21
Identity = 39/146 (26.71%), Postives = 65/146 (44.52%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G ++ V  LL+    I   +      +H A + GH  VVR LI     ++   +     +H A       IV +L+++  N+     NG  P++ A    + E+VK L+ +       +  G  P+  A   GHD +V +LL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL 185          

HSP 17 Score: 87.4261 bits (215), Expect = 1.764e-17
Identity = 50/158 (31.65%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            SP+H A + G  +  +LLL     I++  K    P+H A ++GH  VV LL+ +G  I    K+   P+H A Q +HV+  + LL  +  ++    + L P+H A   G+V + KLL+      ++ +L G  P+H A      ++V++LL  R  IE
Sbjct:  262 SPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIE 419          

HSP 18 Score: 85.1149 bits (209), Expect = 9.574e-17
Identity = 47/162 (29.01%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  V LLLK+  AIEA  +    P+H A   G +N+V  L+ +G + ++       P+H A + N  ++V++L+++   ++A  +    P+H A   GN +IV LL+      +A +     P+H A+  G +E+  ILL    +  L  K
Sbjct:  394 TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK 555          

HSP 19 Score: 85.1149 bits (209), Expect = 1.127e-16
Identity = 47/151 (31.13%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA  GH +   LLL+    +    + +  P+H A + G  N+  LL+S G  I+   KD   P+H A ++ H ++V LL+     + A  KNGL P+H A    +V+  + L+ ++  +D  ++    P+H A+  GH  + K+LL
Sbjct:  229 TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL 379          

HSP 20 Score: 81.6481 bits (200), Expect = 1.122e-15
Identity = 45/162 (27.78%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA  G ++ V  LL+     +        P+H A +    +VVR+LI  G  ++   ++ + P+H A +  + +IV LLL++  N  A+ ++   P+H A   G  E+  +L+ +       +  G  P+H AS YG+ E+V++LL     ++++ K
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 21 Score: 78.9518 bits (193), Expect = 7.914e-15
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A++ G+++ V LLL+    ++   K    P+H A    +  V  LL+  G S +   K+   P+H A + N +EI   LL+ K +  A  + G  P+H +   G+ EI  LLI N   + A++  G   +H  +   H  + +IL +    I
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI 715          

HSP 22 Score: 78.5666 bits (192), Expect = 1.096e-14
Identity = 40/151 (26.49%), Postives = 71/151 (47.02%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   ++  S LL+      A  +    P+H + Q GH  +  LLI  G  +     +    +H   Q +HV + ++L  +   + +    G  P+H AC  G + +VK L+ N   +  ++     P+H A+  GH+  V+ LL
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 23 Score: 71.633 bits (174), Expect = 1.352e-12
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDG---------------------RPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEEL 1051
            K +  V    +    A+H A   G   IV +L+     +N    N   P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+  V+ VLL N+ K +V          KDD                       P+H A  +GH ++ ++L+ +  N+    + N SPL +A++ G + +  LL    R  IIDS  ++L
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLS--RGAIIDSRTKDL 293          

HSP 24 Score: 69.3218 bits (168), Expect = 7.593e-12
Identity = 37/150 (24.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H +AQ GH +   LL+++ + + A        +H   Q  H+ V ++L + G  I         P+H AC    + +VK L+++  ++    +    P+H A   G+   V+ L+ N    + ++ TG  P+  A   G+  +V+ L
Sbjct:  658 TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 25 Score: 67.3958 bits (163), Expect = 3.053e-11
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D+   +H A   G   +  +LL  + +     K    P+H A + G+ E+V+LL+      ++  +N++TP+H A  Y    V  +LL N    +   K+   P+H A     + I   L+    +  A ++  ++PL L++Q+G  +I  LL
Sbjct:  522 RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 26 Score: 66.2402 bits (160), Expect = 6.525e-11
Identity = 37/157 (23.57%), Postives = 74/157 (47.13%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H AA   +     LLL++  + +A  K    P+H A +   + +   L+          +    P+H + Q  H EI  LL+++  ++ A   NGL  +H      +V + ++L +N   +++++  G  P+H A  +G   +VK L+    ++
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 27 Score: 65.4698 bits (158), Expect = 1.186e-10
Identity = 38/150 (25.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH N+ ++LL +   +N   ++   P+H A + G   +  LL+S     + R ++ LTP+H A   G+  V+ +L++    +    K+   P+H A    H+   + L+     ++  T +  +PL +A+  G  ++ +LL D
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD 380          

HSP 28 Score: 63.929 bits (154), Expect = 3.005e-10
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            G L  V  LL    +IN ++ N    +H A + GH E+V+ L+  +   +       T +H A   G   ++T+L+ N   V V   +   P++ A    H  +VK L+    N    T++ ++PL +A Q+G  ++V +L
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 29 Score: 61.2326 bits (147), Expect = 2.286e-9
Identity = 35/148 (23.65%), Postives = 65/148 (43.92%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH  I  +L+    ++ A   N    +H   Q  H  + ++L +   +   +     TP+H AC +G  +++  L+ N   V    +    P+H A   GH + V+ L+    +    T    +PL +A + G+  +VE L
Sbjct:  660 LHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 30 Score: 60.8474 bits (146), Expect = 3.003e-9
Identity = 35/148 (23.65%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      ++V +L+    +++A  +  + P+H A + G+ +IV LL+    +      +  +P+H A   G  +V  +LL +N    +  K    P+H A  +G+L +V++L+ +   ++   K   +PL +A+     ++  LL
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 31 Score: 54.6842 bits (130), Expect = 2.392e-7
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            A +   +E V  LL++  ++  S+ NGL  +H A   G+ E+V+ LI  Q  +DA +  G+  +H AS  G   IV IL+    N+ +Q
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQ 128          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 95.5153 bits (236), Expect = 5.935e-36
Identity = 56/192 (29.17%), Postives = 90/192 (46.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H AA++GH   V LL+     I A  K    P+H A Q  H++  R L+     ++    D   P+H A    HV + KLLL    +  +   NG  P+H AC    +++V+LL+  +  ++A + +G  P+H A+F G   IV  LL +  N +++                   +R   PL L +RA
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET------------------VRGETPLHLAARA 468          

HSP 2 Score: 75.485 bits (184), Expect = 5.935e-36
Identity = 40/148 (27.03%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G+ +IV +LL      NA  ++   P+H A + G  E+  +L+ +  DK +  +   TP+H A  YG  +V+ +LL     V++  K+   P+H A  + +  +  +L+    + +A  K  ++PL +A++K   +I   L
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 3 Score: 91.2781 bits (225), Expect = 2.171e-34
Identity = 44/154 (28.57%), Postives = 82/154 (53.25%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D V +L+++   ++A  +  + P+H A + G+ ++V LL+  G +     +D   P+H A +    E+  +LL    +     K G  P+H A  +GN+E+V+LL+     +D E      P+H A+ Y +D++  +LL
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 74.3294 bits (181), Expect = 2.171e-34
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    + NA  +    P+H + Q GH EI  LL+    D   +  N LT +H      +  V  +L  N  ++         P+H AC FG L++VK L+    ++   T+ +++PL  A+Q+G +  V  L
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 5 Score: 83.9593 bits (206), Expect = 1.387e-31
Identity = 51/183 (27.87%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYF---------------------------------DVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH+ + ++LL +S + N+   N   P+H AC+    ++V+LL+ Y+   E   E+ LTP+H A F G                                   DV+ VL+ N  KV+   ++   P+H A   G+  IV +L+    N  A T++N+SPL +A+++G  ++  +L D
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLD 545          

HSP 6 Score: 72.4034 bits (176), Expect = 1.387e-31
Identity = 42/156 (26.92%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     A +LLL++ +  +   K    P+H A   GH NV +LL+ +G ++    +    P+H A +     +  LLL     +++  K+ L P+H A   G+ ++V LL+     + A++  G  P+H A+   H +  + LL  R  ++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 7 Score: 78.1814 bits (191), Expect = 5.439e-30
Identity = 48/189 (25.40%), Postives = 84/189 (44.44%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GH + V  L+K    ++A  +     +H A   G   +V +L+  G ++ +   +   P++ A Q NH E+VK LLK   N   S ++G  P+  A   G+  +V                              LL+ N+   D  S +G  P+H A+ YGH+ + ++LL +  N+  Q +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR 258          

HSP 8 Score: 72.7886 bits (177), Expect = 5.439e-30
Identity = 42/148 (28.38%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  N+  +LL++   I++  K+   P+H A ++GH ++V LLV        + +N L P+H A    + D    LL +   V+    D   P+H A   GH+ + K+L+ ++ +  +     ++PL +A +K   ++VELL
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 74.7146 bits (182), Expect = 9.893e-29
Identity = 43/148 (29.05%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H++    LL     ++    +Y  P+H A   GH  + KLL+    D   R  N  TP+H AC      V+ +LL     +E   +    P+H A F G ++IV  L+ Q  N +  T    +PL LA++   + +V +L
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 10 Score: 72.0182 bits (175), Expect = 9.893e-29
Identity = 46/164 (28.05%), Postives = 81/164 (49.39%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H + V  LLKH  N A+   D F   P+  A Q GH  VV +L+          K +   +H A + +      LLL+++ N + + K+G  P+H A  +G+  + +LL+     ++ ++     P+H A+ +G   +  +LLS    I+ + K
Sbjct:  134 TPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK 291          

HSP 11 Score: 80.4925 bits (197), Expect = 5.656e-23
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLK---------------------------------HNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            Q+P+H A++ G+ D V LLL+                                 HN       K    P+H A + G+L VVRLL+  G  ++I  K++  P+H A   N+ ++  LLL++  + +A+ KNG  P+H A     +EI   L+  +   +A+S  G  P+H ++  GH EI  +L+    ++
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 12 Score: 46.9802 bits (110), Expect = 5.656e-23
Identity = 30/116 (25.86%), Postives = 48/116 (41.38%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            A+H      H+ + ++L     EIN+       P+H AC  G   +VK LV    D   +     TP+H A   G+ + +  LL N             P+  A   G++ +V+ L
Sbjct:  692 AMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 13 Score: 63.929 bits (154), Expect = 2.717e-22
Identity = 35/121 (28.93%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A + G L  V  L+  G  I   + +    +H A +  H E+V+ L+K +  ++A+ + G   +H A   G   IV +L+ N   ++ +S+ G  P++ A+   H+E+VK LL    N  L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL 160          

HSP 14 Score: 61.2326 bits (147), Expect = 2.717e-22
Identity = 42/155 (27.10%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRP-IHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +  A  +GH  +V +LL      N +    R P +H A +        LL+  + + +V  ++  TP+H A  YG+ +V  +LL     V    + +  P+H A  +G  ++  +L+S+   I++ TK+  +PL  A++ G  Q+V+LL
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          

HSP 15 Score: 60.077 bits (144), Expect = 8.614e-21
Identity = 37/139 (26.62%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +       +LL      +   K+   P+H A   GH  + +LL+    +   +  + ++P+H A  +G  ++  +LL     ++   KD   P+H A   GH  +V +L+ Q   I A TK   +PL +A+Q
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ 335          

HSP 16 Score: 59.6918 bits (143), Expect = 8.614e-21
Identity = 39/146 (26.71%), Postives = 65/146 (44.52%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G ++ V  LL+    I   +      +H A + GH  VVR LI     ++   +     +H A       IV +L+++  N+     NG  P++ A    + E+VK L+ +       +  G  P+  A   GHD +V +LL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL 185          

HSP 17 Score: 87.4261 bits (215), Expect = 1.767e-17
Identity = 50/158 (31.65%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            SP+H A + G  +  +LLL     I++  K    P+H A ++GH  VV LL+ +G  I    K+   P+H A Q +HV+  + LL  +  ++    + L P+H A   G+V + KLL+      ++ +L G  P+H A      ++V++LL  R  IE
Sbjct:  262 SPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIE 419          

HSP 18 Score: 85.1149 bits (209), Expect = 9.113e-17
Identity = 47/162 (29.01%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  V LLLK+  AIEA  +    P+H A   G +N+V  L+ +G + ++       P+H A + N  ++V++L+++   ++A  +    P+H A   GN +IV LL+      +A +     P+H A+  G +E+  ILL    +  L  K
Sbjct:  394 TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK 555          

HSP 19 Score: 85.1149 bits (209), Expect = 1.101e-16
Identity = 47/151 (31.13%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA  GH +   LLL+    +    + +  P+H A + G  N+  LL+S G  I+   KD   P+H A ++ H ++V LL+     + A  KNGL P+H A    +V+  + L+ ++  +D  ++    P+H A+  GH  + K+LL
Sbjct:  229 TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL 379          

HSP 20 Score: 81.6481 bits (200), Expect = 1.050e-15
Identity = 45/162 (27.78%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA  G ++ V  LL+     +        P+H A +    +VVR+LI  G  ++   ++ + P+H A +  + +IV LLL++  N  A+ ++   P+H A   G  E+  +L+ +       +  G  P+H AS YG+ E+V++LL     ++++ K
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 21 Score: 78.9518 bits (193), Expect = 7.936e-15
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A++ G+++ V LLL+    ++   K    P+H A    +  V  LL+  G S +   K+   P+H A + N +EI   LL+ K +  A  + G  P+H +   G+ EI  LLI N   + A++  G   +H  +   H  + +IL +    I
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI 715          

HSP 22 Score: 78.5666 bits (192), Expect = 1.108e-14
Identity = 40/151 (26.49%), Postives = 71/151 (47.02%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   ++  S LL+      A  +    P+H + Q GH  +  LLI  G  +     +    +H   Q +HV + ++L  +   + +    G  P+H AC  G + +VK L+ N   +  ++     P+H A+  GH+  V+ LL
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 23 Score: 71.633 bits (174), Expect = 1.345e-12
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDG---------------------RPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEEL 1051
            K +  V    +    A+H A   G   IV +L+     +N    N   P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+  V+ VLL N+ K +V          KDD                       P+H A  +GH ++ ++L+ +  N+    + N SPL +A++ G + +  LL    R  IIDS  ++L
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLS--RGAIIDSRTKDL 293          

HSP 24 Score: 69.3218 bits (168), Expect = 7.620e-12
Identity = 37/150 (24.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H +AQ GH +   LL+++ + + A        +H   Q  H+ V ++L + G  I         P+H AC    + +VK L+++  ++    +    P+H A   G+   V+ L+ N    + ++ TG  P+  A   G+  +V+ L
Sbjct:  658 TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 25 Score: 67.3958 bits (163), Expect = 3.039e-11
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D+   +H A   G   +  +LL  + +     K    P+H A + G+ E+V+LL+      ++  +N++TP+H A  Y    V  +LL N    +   K+   P+H A     + I   L+    +  A ++  ++PL L++Q+G  +I  LL
Sbjct:  522 RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 26 Score: 66.2402 bits (160), Expect = 6.277e-11
Identity = 37/157 (23.57%), Postives = 74/157 (47.13%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H AA   +     LLL++  + +A  K    P+H A +   + +   L+          +    P+H + Q  H EI  LL+++  ++ A   NGL  +H      +V + ++L +N   +++++  G  P+H A  +G   +VK L+    ++
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 27 Score: 65.4698 bits (158), Expect = 1.180e-10
Identity = 38/150 (25.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH N+ ++LL +   +N   ++   P+H A + G   +  LL+S     + R ++ LTP+H A   G+  V+ +L++    +    K+   P+H A    H+   + L+     ++  T +  +PL +A+  G  ++ +LL D
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD 380          

HSP 28 Score: 63.929 bits (154), Expect = 2.991e-10
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            G L  V  LL    +IN ++ N    +H A + GH E+V+ L+  +   +       T +H A   G   ++T+L+ N   V V   +   P++ A    H  +VK L+    N    T++ ++PL +A Q+G  ++V +L
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 29 Score: 61.2326 bits (147), Expect = 2.276e-9
Identity = 35/148 (23.65%), Postives = 65/148 (43.92%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH  I  +L+    ++ A   N    +H   Q  H  + ++L +   +   +     TP+H AC +G  +++  L+ N   V    +    P+H A   GH + V+ L+    +    T    +PL +A + G+  +VE L
Sbjct:  660 LHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 30 Score: 60.8474 bits (146), Expect = 2.990e-9
Identity = 35/148 (23.65%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      ++V +L+    +++A  +  + P+H A + G+ +IV LL+    +      +  +P+H A   G  +V  +LL +N    +  K    P+H A  +G+L +V++L+ +   ++   K   +PL +A+     ++  LL
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 31 Score: 54.6842 bits (130), Expect = 2.284e-7
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            A +   +E V  LL++  ++  S+ NGL  +H A   G+ E+V+ LI  Q  +DA +  G+  +H AS  G   IV IL+    N+ +Q
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQ 128          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 92.8189 bits (229), Expect = 5.247e-39
Identity = 46/154 (29.87%), Postives = 84/154 (54.55%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D + +LL+ +  ++A  +  + P+H A + G++N++ LL+  G  I     DK   +H A +     IV++LL++     A  K G  P+H AC +G   +V++L+ N   +D +      P+H A+ Y +  IV++LL
Sbjct:  464 RGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLL 616          

HSP 2 Score: 88.9669 bits (219), Expect = 5.247e-39
Identity = 67/238 (28.15%), Postives = 114/238 (47.90%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHYLCKSSLES-KQFQEGEFIGS--GSFGRAFKYKLPQNNKEIVIKYTEIDSESKYIERNINKYV 1261
            AIH AC + +L I   LL    ++N   K+   P+H A Q G+ ++V+LL+ Y        +N LTP+H A   G+  V  +LL +   +    ++   P+H A  +GHL +VK  I  + +IE  +   ++PL  A+Q+G   I+ LL   LR K   + + + G       S+    + +ES K       I S  G+     K   P+  +E ++  ++ +S    ++ N  KY+
Sbjct:  632 AIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL---LRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYM 865          

HSP 3 Score: 86.6557 bits (213), Expect = 6.498e-35
Identity = 47/151 (31.13%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AAQ  H +A  LLL +   ++         +H A   GH+ V +LL+    +      +   P+H AC+ N +++V+LL+K   N+ A+ ++GL P+H A F G + IV  L+ ++   D  ++ G  P+H A+     +I++ILL
Sbjct:  335 SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL 485          

HSP 4 Score: 81.2629 bits (199), Expect = 6.498e-35
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +     D   A+H A   G  NIV++LL    E NA  K    P+H AC+ G   +V++L+      + + +N +TP+H A  Y    ++ +LL N     +  ++    IH AC   +L I   L+    ++   +K  +SPL LA+Q G   +V+LL
Sbjct:  523 INAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 5 Score: 88.1965 bits (217), Expect = 1.398e-31
Identity = 58/192 (30.21%), Postives = 87/192 (45.31%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H A+++GHV+ +  LL+ N  I    K     +H A Q  H     LL+     ++    D    +H A    HV++ KLLL  K N  A   NG  P+H AC    +++V+LLI +   + A + +G  P+H ASF G   IV  LL    + +L                    +R   PL L +RA
Sbjct:  302 TPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPT------------------IRGETPLHLAARA 475          

HSP 6 Score: 68.5514 bits (166), Expect = 1.398e-31
Identity = 41/148 (27.70%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      +I+ +LL +S +++A  +  + P+H A + G+  I+ LL+ +  +   +  +K + +H A   G  +++ VLL N  +     K    P+H AC +G  ++V+IL+    +I+   K + +PL +A+      IVELL
Sbjct:  469 LHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 7 Score: 78.1814 bits (191), Expect = 5.574e-30
Identity = 48/162 (29.63%), Postives = 81/162 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+  A Q GH   V++LL++    +   K     +H A +   +N  +LL+    + +I  K    P+H A    +V+I  LLL +K ++    K+ + P+H AC  G + +  LL+     +DA +  G  P+H AS  GH E++K LL +   I  + K
Sbjct:  174 TPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTK 331          

HSP 8 Score: 73.1738 bits (178), Expect = 5.574e-30
Identity = 43/164 (26.22%), Postives = 76/164 (46.34%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            A+H A    H     +LL     ++    +Y   +H A   GH ++ KLL+ YK +   R  N  TP+H AC      ++ +L+ +   +    +    P+H A F G ++IV  L+    + +  T    +PL LA++   + I+ +L   LR   +D++  E
Sbjct:  336 ALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL---LRSAKVDAIARE 496          

HSP 9 Score: 79.7221 bits (195), Expect = 1.256e-28
Identity = 45/151 (29.80%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  V LL+KH   I A  +    P+H A   G +N+V  L+    S ++       P+H A + N  +I+++LL+S   ++A  + G  P+H A   GN+ I+ LL+ +   ++A+S      +H A+  G + IV++LL
Sbjct:  401 TPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLL 550          

HSP 10 Score: 67.0106 bits (162), Expect = 1.256e-28
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G  N+V++LL     I+   KN   P+H A    +  IV+LL+       +   N    IH AC   Y ++   LL +   V +  K    P+H A   G++ +V++L+     I A  K   +PL +A+Q+G   + ++L
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 11 Score: 83.5741 bits (205), Expect = 2.219e-23
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A  +  +N  ++LL      +   K+   P+H A   G+ +I  LL++ K D     ++ +TP+H AC +G   + T+LL    K++   +D   P+H A   GH+ ++K L+ QN  I   TK   S L +A+Q    +   LL D
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD 354          

HSP 12 Score: 45.4394 bits (106), Expect = 2.219e-23
Identity = 27/116 (23.28%), Postives = 52/116 (44.83%), Query Frame = 1
Query:  115 IHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +H A ++G++++   L+  G  I+   K     +H A      +++  L+    N+     NG  P++ A    +    + L++N       +  G  P+  A   GHD+IV +LL
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL 192          

HSP 13 Score: 95.5153 bits (236), Expect = 7.176e-20
Identity = 49/163 (30.06%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A    +   V LLLK+ ++     +  +C IH AC+  +L +   L+  G  + I  K    P+H A Q  +V++V+LLL+    + A+ KNGL P+H A   G+V + ++L+ +   +   +  G  P+H A+ YGH ++VK  +    +IE+   +
Sbjct:  598 TPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNI 759          

HSP 14 Score: 92.8189 bits (229), Expect = 5.493e-19
Identity = 49/150 (32.67%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            SP+H AAQ G+VD V LLL++   I A  K    P+H A Q GH+ V ++L+  G +I    ++   P+H A    H+++VK  +++  ++E S   G  P+H A   G++ I+ LL+ ++   +A +  G+  +H AS  G+  +++ L
Sbjct:  664 SPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 15 Score: 91.6633 bits (226), Expect = 9.785e-19
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
             Q  IH A +  +++    LL+H   +    K    P+H A Q G++++V+LL+  G  I    K+   P+H A Q  HV + ++LL+   N+    +NG  P+H A  +G++++VK  I N   ++  S  G  P+H A+  GH  I+ +LL  + N
Sbjct:  629 GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKAN 785          

HSP 16 Score: 90.1225 bits (222), Expect = 3.050e-18
Identity = 50/156 (32.05%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+VD  +LLL +   +    K +  P+H AC+ G L++  LL+  G  I+   +D   P+H A ++ HVE++K LL+    +    KNGL  +H A    + E   LL+ N+  +D  ++     +H A+  GH ++ K+LL  + N
Sbjct:  236 TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKAN 391          

HSP 17 Score: 82.8037 bits (203), Expect = 5.924e-16
Identity = 51/151 (33.77%), Postives = 83/151 (54.97%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AA+ G  + V +LL++     A  K    P+H AC+ G  NVV++L+  G SI+   K+   P+H A   N+  IV+LLLK+  +     +NG   IH AC    +EI   L+ +   ++  S +G  P+H A+  G+ ++V++LL
Sbjct:  532 SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL 682          

HSP 18 Score: 80.1073 bits (196), Expect = 4.888e-15
Identity = 46/164 (28.05%), Postives = 82/164 (50.00%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             Q+P+H A++ G+++ + LLL+H   I A        +H A + G  N+V++L+  G       K    P+H AC+     +V++LL++  +++   KN + P+H A  + N  IV+LL+ N    +  +  G   IH A    + EI   LL    ++ +  K
Sbjct:  497 GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISK 660          

HSP 19 Score: 79.337 bits (194), Expect = 7.504e-15
Identity = 43/162 (26.54%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A+  G ++ V  LL+H  + + P      P+H A +    +++R+L+     ++   ++ + P+H A +  ++ I+ LLL+    + A   +    +H A   G   IV++L+ N    +A +  G  P+H A  YG   +V+ILL    +I+ Q K
Sbjct:  434 TPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 20 Score: 78.9518 bits (193), Expect = 9.622e-15
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+   V+A  LLL+H+   +   K    P+H A   G++++  LL++    +    K    P+H AC+   + +  LLL     ++A+ ++GL P+H A   G+VE++K L+     +  ++  G   +H A+   HDE   +LL  +  ++
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360          

HSP 21 Score: 76.2554 bits (186), Expect = 6.614e-14
Identity = 41/156 (26.28%), Postives = 76/156 (48.72%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            V    ++    +H A   G++NI+ +LL    EINA   +    +H A + G   IV++L+    +     +   TP+H AC YG  +V+ +LL N   ++   K+D  P+H A  + +  IV++L+    +   C +     + +A +K + +I 
Sbjct:  490 VDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIA 645          

HSP 22 Score: 73.1738 bits (178), Expect = 5.527e-13
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G L++  +LL +  +I+AA ++   P+H A ++GH E++K L+        + +N L+ +H A    + +   +LL N   V+    D    +H A   GH+ + K+L+    N  A     ++PL +A +K   ++VELL
Sbjct:  271 LHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 23 Score: 59.3066 bits (142), Expect = 1.111e-8
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLV--SYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G+++I  +LL    ++N   K+   P+H AC+ G   +  LL+    K D   RD   LTP+H A   G+ +V+  LL  N  +    K+    +H A    H     +L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  238 LHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLD 387          

HSP 24 Score: 58.151 bits (139), Expect = 2.434e-8
Identity = 48/211 (22.75%), Postives = 80/211 (37.91%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHAC---------------------------------QNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G  +++  L+  +  +N    N   P++ A                                  Q GH +IV +L+      +VR                      D N         TP+H A  YG  D+ T+LL N   V    K +  P+H AC +G L +  +L+ +   I+A T++  +PL  AS+ G  ++++ L
Sbjct:  109 ALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHL 319          

HSP 25 Score: 53.9138 bits (128), Expect = 5.748e-7
Identity = 38/140 (27.14%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  623 EINAADKNYRRPIHHACQNGH----CEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVE-LLSDTLRRKI 1027
            +IN+ + N    +H A ++G+    CE+++     K D   +  N  T +H A   G  DV+  L++ N  V V   +   P++ A    H +  + L++   N    T++ ++PL +A Q+G  +IV  LL + +R K+
Sbjct:   65 DINSCNANGLNALHLAAKDGYVDICCELLRR--GIKIDNATKKGN--TALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKV 200          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 92.8189 bits (229), Expect = 5.247e-39
Identity = 46/154 (29.87%), Postives = 84/154 (54.55%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D + +LL+ +  ++A  +  + P+H A + G++N++ LL+  G  I     DK   +H A +     IV++LL++     A  K G  P+H AC +G   +V++L+ N   +D +      P+H A+ Y +  IV++LL
Sbjct:  464 RGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLL 616          

HSP 2 Score: 88.9669 bits (219), Expect = 5.247e-39
Identity = 67/238 (28.15%), Postives = 114/238 (47.90%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHYLCKSSLES-KQFQEGEFIGS--GSFGRAFKYKLPQNNKEIVIKYTEIDSESKYIERNINKYV 1261
            AIH AC + +L I   LL    ++N   K+   P+H A Q G+ ++V+LL+ Y        +N LTP+H A   G+  V  +LL +   +    ++   P+H A  +GHL +VK  I  + +IE  +   ++PL  A+Q+G   I+ LL   LR K   + + + G       S+    + +ES K       I S  G+     K   P+  +E ++  ++ +S    ++ N  KY+
Sbjct:  632 AIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL---LRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYM 865          

HSP 3 Score: 86.6557 bits (213), Expect = 6.498e-35
Identity = 47/151 (31.13%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AAQ  H +A  LLL +   ++         +H A   GH+ V +LL+    +      +   P+H AC+ N +++V+LL+K   N+ A+ ++GL P+H A F G + IV  L+ ++   D  ++ G  P+H A+     +I++ILL
Sbjct:  335 SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL 485          

HSP 4 Score: 81.2629 bits (199), Expect = 6.498e-35
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +     D   A+H A   G  NIV++LL    E NA  K    P+H AC+ G   +V++L+      + + +N +TP+H A  Y    ++ +LL N     +  ++    IH AC   +L I   L+    ++   +K  +SPL LA+Q G   +V+LL
Sbjct:  523 INAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 5 Score: 88.1965 bits (217), Expect = 1.398e-31
Identity = 58/192 (30.21%), Postives = 87/192 (45.31%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H A+++GHV+ +  LL+ N  I    K     +H A Q  H     LL+     ++    D    +H A    HV++ KLLL  K N  A   NG  P+H AC    +++V+LLI +   + A + +G  P+H ASF G   IV  LL    + +L                    +R   PL L +RA
Sbjct:  302 TPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPT------------------IRGETPLHLAARA 475          

HSP 6 Score: 68.5514 bits (166), Expect = 1.398e-31
Identity = 41/148 (27.70%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      +I+ +LL +S +++A  +  + P+H A + G+  I+ LL+ +  +   +  +K + +H A   G  +++ VLL N  +     K    P+H AC +G  ++V+IL+    +I+   K + +PL +A+      IVELL
Sbjct:  469 LHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 7 Score: 78.1814 bits (191), Expect = 5.574e-30
Identity = 48/162 (29.63%), Postives = 81/162 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+  A Q GH   V++LL++    +   K     +H A +   +N  +LL+    + +I  K    P+H A    +V+I  LLL +K ++    K+ + P+H AC  G + +  LL+     +DA +  G  P+H AS  GH E++K LL +   I  + K
Sbjct:  174 TPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTK 331          

HSP 8 Score: 73.1738 bits (178), Expect = 5.574e-30
Identity = 43/164 (26.22%), Postives = 76/164 (46.34%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            A+H A    H     +LL     ++    +Y   +H A   GH ++ KLL+ YK +   R  N  TP+H AC      ++ +L+ +   +    +    P+H A F G ++IV  L+    + +  T    +PL LA++   + I+ +L   LR   +D++  E
Sbjct:  336 ALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL---LRSAKVDAIARE 496          

HSP 9 Score: 79.7221 bits (195), Expect = 1.256e-28
Identity = 45/151 (29.80%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  V LL+KH   I A  +    P+H A   G +N+V  L+    S ++       P+H A + N  +I+++LL+S   ++A  + G  P+H A   GN+ I+ LL+ +   ++A+S      +H A+  G + IV++LL
Sbjct:  401 TPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLL 550          

HSP 10 Score: 67.0106 bits (162), Expect = 1.256e-28
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G  N+V++LL     I+   KN   P+H A    +  IV+LL+       +   N    IH AC   Y ++   LL +   V +  K    P+H A   G++ +V++L+     I A  K   +PL +A+Q+G   + ++L
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 11 Score: 83.5741 bits (205), Expect = 2.219e-23
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A  +  +N  ++LL      +   K+   P+H A   G+ +I  LL++ K D     ++ +TP+H AC +G   + T+LL    K++   +D   P+H A   GH+ ++K L+ QN  I   TK   S L +A+Q    +   LL D
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD 354          

HSP 12 Score: 45.4394 bits (106), Expect = 2.219e-23
Identity = 27/116 (23.28%), Postives = 52/116 (44.83%), Query Frame = 1
Query:  115 IHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +H A ++G++++   L+  G  I+   K     +H A      +++  L+    N+     NG  P++ A    +    + L++N       +  G  P+  A   GHD+IV +LL
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL 192          

HSP 13 Score: 95.5153 bits (236), Expect = 7.176e-20
Identity = 49/163 (30.06%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A    +   V LLLK+ ++     +  +C IH AC+  +L +   L+  G  + I  K    P+H A Q  +V++V+LLL+    + A+ KNGL P+H A   G+V + ++L+ +   +   +  G  P+H A+ YGH ++VK  +    +IE+   +
Sbjct:  598 TPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNI 759          

HSP 14 Score: 92.8189 bits (229), Expect = 5.493e-19
Identity = 49/150 (32.67%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            SP+H AAQ G+VD V LLL++   I A  K    P+H A Q GH+ V ++L+  G +I    ++   P+H A    H+++VK  +++  ++E S   G  P+H A   G++ I+ LL+ ++   +A +  G+  +H AS  G+  +++ L
Sbjct:  664 SPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 15 Score: 91.6633 bits (226), Expect = 9.785e-19
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
             Q  IH A +  +++    LL+H   +    K    P+H A Q G++++V+LL+  G  I    K+   P+H A Q  HV + ++LL+   N+    +NG  P+H A  +G++++VK  I N   ++  S  G  P+H A+  GH  I+ +LL  + N
Sbjct:  629 GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKAN 785          

HSP 16 Score: 90.1225 bits (222), Expect = 3.050e-18
Identity = 50/156 (32.05%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+VD  +LLL +   +    K +  P+H AC+ G L++  LL+  G  I+   +D   P+H A ++ HVE++K LL+    +    KNGL  +H A    + E   LL+ N+  +D  ++     +H A+  GH ++ K+LL  + N
Sbjct:  236 TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKAN 391          

HSP 17 Score: 82.8037 bits (203), Expect = 5.924e-16
Identity = 51/151 (33.77%), Postives = 83/151 (54.97%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AA+ G  + V +LL++     A  K    P+H AC+ G  NVV++L+  G SI+   K+   P+H A   N+  IV+LLLK+  +     +NG   IH AC    +EI   L+ +   ++  S +G  P+H A+  G+ ++V++LL
Sbjct:  532 SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL 682          

HSP 18 Score: 80.1073 bits (196), Expect = 4.888e-15
Identity = 46/164 (28.05%), Postives = 82/164 (50.00%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             Q+P+H A++ G+++ + LLL+H   I A        +H A + G  N+V++L+  G       K    P+H AC+     +V++LL++  +++   KN + P+H A  + N  IV+LL+ N    +  +  G   IH A    + EI   LL    ++ +  K
Sbjct:  497 GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISK 660          

HSP 19 Score: 79.337 bits (194), Expect = 7.504e-15
Identity = 43/162 (26.54%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A+  G ++ V  LL+H  + + P      P+H A +    +++R+L+     ++   ++ + P+H A +  ++ I+ LLL+    + A   +    +H A   G   IV++L+ N    +A +  G  P+H A  YG   +V+ILL    +I+ Q K
Sbjct:  434 TPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 20 Score: 78.9518 bits (193), Expect = 9.622e-15
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+   V+A  LLL+H+   +   K    P+H A   G++++  LL++    +    K    P+H AC+   + +  LLL     ++A+ ++GL P+H A   G+VE++K L+     +  ++  G   +H A+   HDE   +LL  +  ++
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360          

HSP 21 Score: 76.2554 bits (186), Expect = 6.614e-14
Identity = 41/156 (26.28%), Postives = 76/156 (48.72%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            V    ++    +H A   G++NI+ +LL    EINA   +    +H A + G   IV++L+    +     +   TP+H AC YG  +V+ +LL N   ++   K+D  P+H A  + +  IV++L+    +   C +     + +A +K + +I 
Sbjct:  490 VDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIA 645          

HSP 22 Score: 73.1738 bits (178), Expect = 5.527e-13
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G L++  +LL +  +I+AA ++   P+H A ++GH E++K L+        + +N L+ +H A    + +   +LL N   V+    D    +H A   GH+ + K+L+    N  A     ++PL +A +K   ++VELL
Sbjct:  271 LHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 23 Score: 59.3066 bits (142), Expect = 1.111e-8
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLV--SYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G+++I  +LL    ++N   K+   P+H AC+ G   +  LL+    K D   RD   LTP+H A   G+ +V+  LL  N  +    K+    +H A    H     +L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  238 LHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLD 387          

HSP 24 Score: 58.151 bits (139), Expect = 2.434e-8
Identity = 48/211 (22.75%), Postives = 80/211 (37.91%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHAC---------------------------------QNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G  +++  L+  +  +N    N   P++ A                                  Q GH +IV +L+      +VR                      D N         TP+H A  YG  D+ T+LL N   V    K +  P+H AC +G L +  +L+ +   I+A T++  +PL  AS+ G  ++++ L
Sbjct:  109 ALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHL 319          

HSP 25 Score: 53.9138 bits (128), Expect = 5.748e-7
Identity = 38/140 (27.14%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  623 EINAADKNYRRPIHHACQNGH----CEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVE-LLSDTLRRKI 1027
            +IN+ + N    +H A ++G+    CE+++     K D   +  N  T +H A   G  DV+  L++ N  V V   +   P++ A    H +  + L++   N    T++ ++PL +A Q+G  +IV  LL + +R K+
Sbjct:   65 DINSCNANGLNALHLAAKDGYVDICCELLRR--GIKIDNATKKGN--TALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKV 200          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 92.8189 bits (229), Expect = 5.247e-39
Identity = 46/154 (29.87%), Postives = 84/154 (54.55%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D + +LL+ +  ++A  +  + P+H A + G++N++ LL+  G  I     DK   +H A +     IV++LL++     A  K G  P+H AC +G   +V++L+ N   +D +      P+H A+ Y +  IV++LL
Sbjct:  464 RGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLL 616          

HSP 2 Score: 88.9669 bits (219), Expect = 5.247e-39
Identity = 67/238 (28.15%), Postives = 114/238 (47.90%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHYLCKSSLES-KQFQEGEFIGS--GSFGRAFKYKLPQNNKEIVIKYTEIDSESKYIERNINKYV 1261
            AIH AC + +L I   LL    ++N   K+   P+H A Q G+ ++V+LL+ Y        +N LTP+H A   G+  V  +LL +   +    ++   P+H A  +GHL +VK  I  + +IE  +   ++PL  A+Q+G   I+ LL   LR K   + + + G       S+    + +ES K       I S  G+     K   P+  +E ++  ++ +S    ++ N  KY+
Sbjct:  632 AIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL---LRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYM 865          

HSP 3 Score: 86.6557 bits (213), Expect = 6.498e-35
Identity = 47/151 (31.13%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AAQ  H +A  LLL +   ++         +H A   GH+ V +LL+    +      +   P+H AC+ N +++V+LL+K   N+ A+ ++GL P+H A F G + IV  L+ ++   D  ++ G  P+H A+     +I++ILL
Sbjct:  335 SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL 485          

HSP 4 Score: 81.2629 bits (199), Expect = 6.498e-35
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +     D   A+H A   G  NIV++LL    E NA  K    P+H AC+ G   +V++L+      + + +N +TP+H A  Y    ++ +LL N     +  ++    IH AC   +L I   L+    ++   +K  +SPL LA+Q G   +V+LL
Sbjct:  523 INAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 5 Score: 88.1965 bits (217), Expect = 1.398e-31
Identity = 58/192 (30.21%), Postives = 87/192 (45.31%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H A+++GHV+ +  LL+ N  I    K     +H A Q  H     LL+     ++    D    +H A    HV++ KLLL  K N  A   NG  P+H AC    +++V+LLI +   + A + +G  P+H ASF G   IV  LL    + +L                    +R   PL L +RA
Sbjct:  302 TPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPT------------------IRGETPLHLAARA 475          

HSP 6 Score: 68.5514 bits (166), Expect = 1.398e-31
Identity = 41/148 (27.70%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      +I+ +LL +S +++A  +  + P+H A + G+  I+ LL+ +  +   +  +K + +H A   G  +++ VLL N  +     K    P+H AC +G  ++V+IL+    +I+   K + +PL +A+      IVELL
Sbjct:  469 LHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 7 Score: 78.1814 bits (191), Expect = 5.574e-30
Identity = 48/162 (29.63%), Postives = 81/162 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+  A Q GH   V++LL++    +   K     +H A +   +N  +LL+    + +I  K    P+H A    +V+I  LLL +K ++    K+ + P+H AC  G + +  LL+     +DA +  G  P+H AS  GH E++K LL +   I  + K
Sbjct:  174 TPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTK 331          

HSP 8 Score: 73.1738 bits (178), Expect = 5.574e-30
Identity = 43/164 (26.22%), Postives = 76/164 (46.34%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            A+H A    H     +LL     ++    +Y   +H A   GH ++ KLL+ YK +   R  N  TP+H AC      ++ +L+ +   +    +    P+H A F G ++IV  L+    + +  T    +PL LA++   + I+ +L   LR   +D++  E
Sbjct:  336 ALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL---LRSAKVDAIARE 496          

HSP 9 Score: 79.7221 bits (195), Expect = 1.256e-28
Identity = 45/151 (29.80%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  V LL+KH   I A  +    P+H A   G +N+V  L+    S ++       P+H A + N  +I+++LL+S   ++A  + G  P+H A   GN+ I+ LL+ +   ++A+S      +H A+  G + IV++LL
Sbjct:  401 TPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLL 550          

HSP 10 Score: 67.0106 bits (162), Expect = 1.256e-28
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G  N+V++LL     I+   KN   P+H A    +  IV+LL+       +   N    IH AC   Y ++   LL +   V +  K    P+H A   G++ +V++L+     I A  K   +PL +A+Q+G   + ++L
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 11 Score: 83.5741 bits (205), Expect = 2.219e-23
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A  +  +N  ++LL      +   K+   P+H A   G+ +I  LL++ K D     ++ +TP+H AC +G   + T+LL    K++   +D   P+H A   GH+ ++K L+ QN  I   TK   S L +A+Q    +   LL D
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD 354          

HSP 12 Score: 45.4394 bits (106), Expect = 2.219e-23
Identity = 27/116 (23.28%), Postives = 52/116 (44.83%), Query Frame = 1
Query:  115 IHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +H A ++G++++   L+  G  I+   K     +H A      +++  L+    N+     NG  P++ A    +    + L++N       +  G  P+  A   GHD+IV +LL
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL 192          

HSP 13 Score: 95.5153 bits (236), Expect = 7.176e-20
Identity = 49/163 (30.06%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A    +   V LLLK+ ++     +  +C IH AC+  +L +   L+  G  + I  K    P+H A Q  +V++V+LLL+    + A+ KNGL P+H A   G+V + ++L+ +   +   +  G  P+H A+ YGH ++VK  +    +IE+   +
Sbjct:  598 TPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNI 759          

HSP 14 Score: 92.8189 bits (229), Expect = 5.493e-19
Identity = 49/150 (32.67%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            SP+H AAQ G+VD V LLL++   I A  K    P+H A Q GH+ V ++L+  G +I    ++   P+H A    H+++VK  +++  ++E S   G  P+H A   G++ I+ LL+ ++   +A +  G+  +H AS  G+  +++ L
Sbjct:  664 SPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 15 Score: 91.6633 bits (226), Expect = 9.785e-19
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
             Q  IH A +  +++    LL+H   +    K    P+H A Q G++++V+LL+  G  I    K+   P+H A Q  HV + ++LL+   N+    +NG  P+H A  +G++++VK  I N   ++  S  G  P+H A+  GH  I+ +LL  + N
Sbjct:  629 GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKAN 785          

HSP 16 Score: 90.1225 bits (222), Expect = 3.050e-18
Identity = 50/156 (32.05%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+VD  +LLL +   +    K +  P+H AC+ G L++  LL+  G  I+   +D   P+H A ++ HVE++K LL+    +    KNGL  +H A    + E   LL+ N+  +D  ++     +H A+  GH ++ K+LL  + N
Sbjct:  236 TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKAN 391          

HSP 17 Score: 82.8037 bits (203), Expect = 5.924e-16
Identity = 51/151 (33.77%), Postives = 83/151 (54.97%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AA+ G  + V +LL++     A  K    P+H AC+ G  NVV++L+  G SI+   K+   P+H A   N+  IV+LLLK+  +     +NG   IH AC    +EI   L+ +   ++  S +G  P+H A+  G+ ++V++LL
Sbjct:  532 SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL 682          

HSP 18 Score: 80.1073 bits (196), Expect = 4.888e-15
Identity = 46/164 (28.05%), Postives = 82/164 (50.00%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             Q+P+H A++ G+++ + LLL+H   I A        +H A + G  N+V++L+  G       K    P+H AC+     +V++LL++  +++   KN + P+H A  + N  IV+LL+ N    +  +  G   IH A    + EI   LL    ++ +  K
Sbjct:  497 GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISK 660          

HSP 19 Score: 79.337 bits (194), Expect = 7.504e-15
Identity = 43/162 (26.54%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A+  G ++ V  LL+H  + + P      P+H A +    +++R+L+     ++   ++ + P+H A +  ++ I+ LLL+    + A   +    +H A   G   IV++L+ N    +A +  G  P+H A  YG   +V+ILL    +I+ Q K
Sbjct:  434 TPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 20 Score: 78.9518 bits (193), Expect = 9.622e-15
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+   V+A  LLL+H+   +   K    P+H A   G++++  LL++    +    K    P+H AC+   + +  LLL     ++A+ ++GL P+H A   G+VE++K L+     +  ++  G   +H A+   HDE   +LL  +  ++
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360          

HSP 21 Score: 76.2554 bits (186), Expect = 6.614e-14
Identity = 41/156 (26.28%), Postives = 76/156 (48.72%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            V    ++    +H A   G++NI+ +LL    EINA   +    +H A + G   IV++L+    +     +   TP+H AC YG  +V+ +LL N   ++   K+D  P+H A  + +  IV++L+    +   C +     + +A +K + +I 
Sbjct:  490 VDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIA 645          

HSP 22 Score: 73.1738 bits (178), Expect = 5.527e-13
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G L++  +LL +  +I+AA ++   P+H A ++GH E++K L+        + +N L+ +H A    + +   +LL N   V+    D    +H A   GH+ + K+L+    N  A     ++PL +A +K   ++VELL
Sbjct:  271 LHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 23 Score: 59.3066 bits (142), Expect = 1.111e-8
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLV--SYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G+++I  +LL    ++N   K+   P+H AC+ G   +  LL+    K D   RD   LTP+H A   G+ +V+  LL  N  +    K+    +H A    H     +L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  238 LHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLD 387          

HSP 24 Score: 58.151 bits (139), Expect = 2.434e-8
Identity = 48/211 (22.75%), Postives = 80/211 (37.91%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHAC---------------------------------QNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G  +++  L+  +  +N    N   P++ A                                  Q GH +IV +L+      +VR                      D N         TP+H A  YG  D+ T+LL N   V    K +  P+H AC +G L +  +L+ +   I+A T++  +PL  AS+ G  ++++ L
Sbjct:  109 ALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHL 319          

HSP 25 Score: 53.9138 bits (128), Expect = 5.748e-7
Identity = 38/140 (27.14%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  623 EINAADKNYRRPIHHACQNGH----CEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVE-LLSDTLRRKI 1027
            +IN+ + N    +H A ++G+    CE+++     K D   +  N  T +H A   G  DV+  L++ N  V V   +   P++ A    H +  + L++   N    T++ ++PL +A Q+G  +IV  LL + +R K+
Sbjct:   65 DINSCNANGLNALHLAAKDGYVDICCELLRR--GIKIDNATKKGN--TALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKV 200          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 92.8189 bits (229), Expect = 5.247e-39
Identity = 46/154 (29.87%), Postives = 84/154 (54.55%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++P+H AA+    D + +LL+ +  ++A  +  + P+H A + G++N++ LL+  G  I     DK   +H A +     IV++LL++     A  K G  P+H AC +G   +V++L+ N   +D +      P+H A+ Y +  IV++LL
Sbjct:  464 RGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLL 616          

HSP 2 Score: 88.9669 bits (219), Expect = 5.247e-39
Identity = 67/238 (28.15%), Postives = 114/238 (47.90%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHYLCKSSLES-KQFQEGEFIGS--GSFGRAFKYKLPQNNKEIVIKYTEIDSESKYIERNINKYV 1261
            AIH AC + +L I   LL    ++N   K+   P+H A Q G+ ++V+LL+ Y        +N LTP+H A   G+  V  +LL +   +    ++   P+H A  +GHL +VK  I  + +IE  +   ++PL  A+Q+G   I+ LL   LR K   + + + G       S+    + +ES K       I S  G+     K   P+  +E ++  ++ +S    ++ N  KY+
Sbjct:  632 AIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL---LRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYM 865          

HSP 3 Score: 86.6557 bits (213), Expect = 6.498e-35
Identity = 47/151 (31.13%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AAQ  H +A  LLL +   ++         +H A   GH+ V +LL+    +      +   P+H AC+ N +++V+LL+K   N+ A+ ++GL P+H A F G + IV  L+ ++   D  ++ G  P+H A+     +I++ILL
Sbjct:  335 SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL 485          

HSP 4 Score: 81.2629 bits (199), Expect = 6.498e-35
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +     D   A+H A   G  NIV++LL    E NA  K    P+H AC+ G   +V++L+      + + +N +TP+H A  Y    ++ +LL N     +  ++    IH AC   +L I   L+    ++   +K  +SPL LA+Q G   +V+LL
Sbjct:  523 INAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 5 Score: 88.1965 bits (217), Expect = 1.398e-31
Identity = 58/192 (30.21%), Postives = 87/192 (45.31%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLRKSNPLRLLSRA 585
            +P+H A+++GHV+ +  LL+ N  I    K     +H A Q  H     LL+     ++    D    +H A    HV++ KLLL  K N  A   NG  P+H AC    +++V+LLI +   + A + +G  P+H ASF G   IV  LL    + +L                    +R   PL L +RA
Sbjct:  302 TPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPT------------------IRGETPLHLAARA 475          

HSP 6 Score: 68.5514 bits (166), Expect = 1.398e-31
Identity = 41/148 (27.70%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      +I+ +LL +S +++A  +  + P+H A + G+  I+ LL+ +  +   +  +K + +H A   G  +++ VLL N  +     K    P+H AC +G  ++V+IL+    +I+   K + +PL +A+      IVELL
Sbjct:  469 LHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 7 Score: 78.1814 bits (191), Expect = 5.574e-30
Identity = 48/162 (29.63%), Postives = 81/162 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+  A Q GH   V++LL++    +   K     +H A +   +N  +LL+    + +I  K    P+H A    +V+I  LLL +K ++    K+ + P+H AC  G + +  LL+     +DA +  G  P+H AS  GH E++K LL +   I  + K
Sbjct:  174 TPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTK 331          

HSP 8 Score: 73.1738 bits (178), Expect = 5.574e-30
Identity = 43/164 (26.22%), Postives = 76/164 (46.34%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            A+H A    H     +LL     ++    +Y   +H A   GH ++ KLL+ YK +   R  N  TP+H AC      ++ +L+ +   +    +    P+H A F G ++IV  L+    + +  T    +PL LA++   + I+ +L   LR   +D++  E
Sbjct:  336 ALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL---LRSAKVDAIARE 496          

HSP 9 Score: 79.7221 bits (195), Expect = 1.256e-28
Identity = 45/151 (29.80%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  V LL+KH   I A  +    P+H A   G +N+V  L+    S ++       P+H A + N  +I+++LL+S   ++A  + G  P+H A   GN+ I+ LL+ +   ++A+S      +H A+  G + IV++LL
Sbjct:  401 TPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLL 550          

HSP 10 Score: 67.0106 bits (162), Expect = 1.256e-28
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G  N+V++LL     I+   KN   P+H A    +  IV+LL+       +   N    IH AC   Y ++   LL +   V +  K    P+H A   G++ +V++L+     I A  K   +PL +A+Q+G   + ++L
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 11 Score: 83.5741 bits (205), Expect = 2.219e-23
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A  +  +N  ++LL      +   K+   P+H A   G+ +I  LL++ K D     ++ +TP+H AC +G   + T+LL    K++   +D   P+H A   GH+ ++K L+ QN  I   TK   S L +A+Q    +   LL D
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD 354          

HSP 12 Score: 45.4394 bits (106), Expect = 2.219e-23
Identity = 27/116 (23.28%), Postives = 52/116 (44.83%), Query Frame = 1
Query:  115 IHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +H A ++G++++   L+  G  I+   K     +H A      +++  L+    N+     NG  P++ A    +    + L++N       +  G  P+  A   GHD+IV +LL
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL 192          

HSP 13 Score: 95.5153 bits (236), Expect = 7.176e-20
Identity = 49/163 (30.06%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A    +   V LLLK+ ++     +  +C IH AC+  +L +   L+  G  + I  K    P+H A Q  +V++V+LLL+    + A+ KNGL P+H A   G+V + ++L+ +   +   +  G  P+H A+ YGH ++VK  +    +IE+   +
Sbjct:  598 TPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNI 759          

HSP 14 Score: 92.8189 bits (229), Expect = 5.493e-19
Identity = 49/150 (32.67%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            SP+H AAQ G+VD V LLL++   I A  K    P+H A Q GH+ V ++L+  G +I    ++   P+H A    H+++VK  +++  ++E S   G  P+H A   G++ I+ LL+ ++   +A +  G+  +H AS  G+  +++ L
Sbjct:  664 SPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 15 Score: 91.6633 bits (226), Expect = 9.785e-19
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
             Q  IH A +  +++    LL+H   +    K    P+H A Q G++++V+LL+  G  I    K+   P+H A Q  HV + ++LL+   N+    +NG  P+H A  +G++++VK  I N   ++  S  G  P+H A+  GH  I+ +LL  + N
Sbjct:  629 GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKAN 785          

HSP 16 Score: 90.1225 bits (222), Expect = 3.050e-18
Identity = 50/156 (32.05%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+VD  +LLL +   +    K +  P+H AC+ G L++  LL+  G  I+   +D   P+H A ++ HVE++K LL+    +    KNGL  +H A    + E   LL+ N+  +D  ++     +H A+  GH ++ K+LL  + N
Sbjct:  236 TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKAN 391          

HSP 17 Score: 82.8037 bits (203), Expect = 5.924e-16
Identity = 51/151 (33.77%), Postives = 83/151 (54.97%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            S +H AA+ G  + V +LL++     A  K    P+H AC+ G  NVV++L+  G SI+   K+   P+H A   N+  IV+LLLK+  +     +NG   IH AC    +EI   L+ +   ++  S +G  P+H A+  G+ ++V++LL
Sbjct:  532 SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL 682          

HSP 18 Score: 80.1073 bits (196), Expect = 4.888e-15
Identity = 46/164 (28.05%), Postives = 82/164 (50.00%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             Q+P+H A++ G+++ + LLL+H   I A        +H A + G  N+V++L+  G       K    P+H AC+     +V++LL++  +++   KN + P+H A  + N  IV+LL+ N    +  +  G   IH A    + EI   LL    ++ +  K
Sbjct:  497 GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISK 660          

HSP 19 Score: 79.337 bits (194), Expect = 7.504e-15
Identity = 43/162 (26.54%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A+  G ++ V  LL+H  + + P      P+H A +    +++R+L+     ++   ++ + P+H A +  ++ I+ LLL+    + A   +    +H A   G   IV++L+ N    +A +  G  P+H A  YG   +V+ILL    +I+ Q K
Sbjct:  434 TPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 20 Score: 78.9518 bits (193), Expect = 9.622e-15
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+   V+A  LLL+H+   +   K    P+H A   G++++  LL++    +    K    P+H AC+   + +  LLL     ++A+ ++GL P+H A   G+VE++K L+     +  ++  G   +H A+   HDE   +LL  +  ++
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360          

HSP 21 Score: 76.2554 bits (186), Expect = 6.614e-14
Identity = 41/156 (26.28%), Postives = 76/156 (48.72%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            V    ++    +H A   G++NI+ +LL    EINA   +    +H A + G   IV++L+    +     +   TP+H AC YG  +V+ +LL N   ++   K+D  P+H A  + +  IV++L+    +   C +     + +A +K + +I 
Sbjct:  490 VDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIA 645          

HSP 22 Score: 73.1738 bits (178), Expect = 5.527e-13
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G L++  +LL +  +I+AA ++   P+H A ++GH E++K L+        + +N L+ +H A    + +   +LL N   V+    D    +H A   GH+ + K+L+    N  A     ++PL +A +K   ++VELL
Sbjct:  271 LHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 23 Score: 59.3066 bits (142), Expect = 1.111e-8
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLV--SYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G+++I  +LL    ++N   K+   P+H AC+ G   +  LL+    K D   RD   LTP+H A   G+ +V+  LL  N  +    K+    +H A    H     +L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  238 LHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLD 387          

HSP 24 Score: 58.151 bits (139), Expect = 2.434e-8
Identity = 48/211 (22.75%), Postives = 80/211 (37.91%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHAC---------------------------------QNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G  +++  L+  +  +N    N   P++ A                                  Q GH +IV +L+      +VR                      D N         TP+H A  YG  D+ T+LL N   V    K +  P+H AC +G L +  +L+ +   I+A T++  +PL  AS+ G  ++++ L
Sbjct:  109 ALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHL 319          

HSP 25 Score: 53.9138 bits (128), Expect = 5.748e-7
Identity = 38/140 (27.14%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  623 EINAADKNYRRPIHHACQNGH----CEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVE-LLSDTLRRKI 1027
            +IN+ + N    +H A ++G+    CE+++     K D   +  N  T +H A   G  DV+  L++ N  V V   +   P++ A    H +  + L++   N    T++ ++PL +A Q+G  +IV  LL + +R K+
Sbjct:   65 DINSCNANGLNALHLAAKDGYVDICCELLRR--GIKIDNATKKGN--TALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKV 200          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303112)

HSP 1 Score: 98.2117 bits (243), Expect = 3.251e-38
Identity = 47/162 (29.01%), Postives = 91/162 (56.17%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA  G ++ V  LL+H+ + + P      P+H A +    +++R+L+  G  ++   ++++ P+H A +  +V+IV LLL+    ++A+ K+    +H A   G  E+  +LI N   LDA +  G  P+H  + YGH ++ ++LL +  +++ Q K
Sbjct:  412 TPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGK 573          

HSP 2 Score: 80.8777 bits (198), Expect = 3.251e-38
Identity = 45/148 (30.41%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  ++I   LL      NA  K    P+H + Q GH EI  LL+ +K       +N LTP+H        +V  +L  N   +++  K    P+H A  FG  ++V+ L+    N++A T   ++PL   +Q+G   IV LL
Sbjct:  612 LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLL 759          

HSP 3 Score: 86.6557 bits (213), Expect = 1.203e-34
Identity = 47/156 (30.13%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+   V A +LLL +++  +   K    P+H A   G+ N+  LLI +G  +    K    P+H A +     +V LLL+   N+EA  ++GL P+H A   G+ ++V +L+     + A++  G  P+H A+   H +  +ILL  R  ++
Sbjct:  183 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 338          

HSP 4 Score: 80.4925 bits (197), Expect = 1.203e-34
Identity = 45/149 (30.20%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH+ + ++LL ++ + NA   N   P+H AC+    ++V+LL+ +        E+ LTP+H A F G  +++  LL ++   +V       P+H A       I++IL+     ++A  +E  +PL +AS+ G   IV LL
Sbjct:  347 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 495          

HSP 5 Score: 95.5153 bits (236), Expect = 2.655e-33
Identity = 47/152 (30.92%), Postives = 82/152 (53.95%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            Q+P+H A++ G+VD V LLL+H   ++A  K     +H A + G   V  +LI  G +++   K    P+H   +  H+++ +LLL+ + +++A  KNG+ P+H AC + N ++  LL+       A +  G  P+H A+     +I   LL
Sbjct:  477 QTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL 628          

HSP 6 Score: 67.0106 bits (162), Expect = 2.655e-33
Identity = 37/148 (25.00%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH  I  +L+     +N   KN   P+H   Q  +  + ++L     + ++  +   TP+H A  +G  +++  LL N   V+        P+H     GH HIV +L+    N  A T    +PL +A + G+  +++ L
Sbjct:  645 LHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 792          

HSP 7 Score: 84.7297 bits (208), Expect = 1.134e-32
Identity = 44/156 (28.21%), Postives = 85/156 (54.49%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H A+  G+ +  +LL++    +    K +  P+H A + G  N+V LL+ +G +IE   +D   P+H A ++ H ++V +LL+    + A  KNGL P+H A    +V+  ++L+ ++  +D  ++     +H A+  GH  + K+LL    +
Sbjct:  214 TPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNAD 369          

HSP 8 Score: 75.8702 bits (185), Expect = 1.134e-32
Identity = 41/148 (27.70%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  L +VE+LL     I+A  ++   P+H A   G   IV  L+ +    +V      TP+H A      D++ +LL N  +V+   ++   P+H A   G++ IV +L+     ++A TK+ ++ L +A+++G  ++  +L
Sbjct:  381 LHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 528          

HSP 9 Score: 92.0485 bits (227), Expect = 2.697e-32
Identity = 49/151 (32.45%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   V +LL+    I A  K    P+H A Q  H++  R+L+     ++    D    +H A    HV + KLLL    +  A   NG  P+H AC    +++V+LL+ +   + A + +G  P+H A+F G   IV  LL
Sbjct:  280 TPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLL 430          

HSP 10 Score: 67.0106 bits (162), Expect = 2.697e-32
Identity = 36/148 (24.32%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A      +I+ +LL    +++A  +  + P+H A + G+ +IV LL+ +    +   ++  T +H A   G  +V  VL+ N   ++   K    P+H    +GH+ + ++L+ +  +++A  K   +PL +A      Q+  LL
Sbjct:  447 LHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLL 594          

HSP 11 Score: 90.5077 bits (223), Expect = 6.052e-32
Identity = 51/157 (32.48%), Postives = 82/157 (52.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            SP+H AA+ G  + VSLLL+    IEA  +    P+H A ++GH  VV +L+  G  I    K+   P+H A Q  HV+  ++LL  +  ++    + L  +H A   G+V + KLL+      +A +L G  P+H A      ++V++LL    +I
Sbjct:  247 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI 403          

HSP 12 Score: 67.781 bits (164), Expect = 6.052e-32
Identity = 39/148 (26.35%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G +NIV  LL      +        P+H A +    +I+++L+      + R   + TP+H A   G  D++ +LL +  +V+   KD    +H A   G   +  +LI     ++A TK+ ++PL L ++ G  ++ +LL
Sbjct:  414 LHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 561          

HSP 13 Score: 82.4185 bits (202), Expect = 2.648e-31
Identity = 49/165 (29.70%), Postives = 82/165 (49.70%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +  + +H A+  G  + V LLL+HN ++    +    P++ A Q  H  VVRLL+S G +  +  +D   P+  A Q  H ++V +LL+S    +   K  L  +H A    +V+   LL+ N    D  S +G  P+H AS YG+  I  +L+ +  ++    K
Sbjct:   83 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK 243          

HSP 14 Score: 73.559 bits (179), Expect = 2.648e-31
Identity = 50/177 (28.25%), Postives = 84/177 (47.46%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELG-----IQCFDGC 1075
            +H A   G  N+V +LL +   I A  ++   P+H A ++GH ++V +L+        + +N L P+H A    + D   +LL +   V+    D    +H A   GH+ + K+L+ +N +  A     ++PL +A +K   ++VELL   LR     S   E G     +  F GC
Sbjct:  249 LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELL---LRHGASISATTESGLTPLHVAAFMGC 422          

HSP 15 Score: 79.7221 bits (195), Expect = 6.613e-31
Identity = 49/162 (30.25%), Postives = 74/162 (45.68%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            + +H AA  GHV    LLL  N    A       P+H AC+   L VV LL+  G SI    +    P+H A     + IV  LL+   + +     G  P+H A      +I+++L+ N   +DA +     P+H AS  G+ +IV +LL     ++   K
Sbjct:  346 TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK 507          

HSP 16 Score: 75.0998 bits (183), Expect = 6.613e-31
Identity = 43/154 (27.92%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D   A+H A   G   +  +L+     ++AA K    P+H   + GH ++ +LL+  + D + + +N +TP+H AC Y    V  +LL          K+   P+H A     + I   L+       A +K  ++PL L+SQ+G ++I  LL
Sbjct:  507 KDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLL 660          

HSP 17 Score: 72.0182 bits (175), Expect = 2.411e-25
Identity = 43/146 (29.45%), Postives = 74/146 (50.68%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G+++ V   LK+N  I   +      +H A ++GH++VV  L+  G  ++   K     +H A      E+VKLLL+   ++    +NG  P++ A    +  +V+LL+SN       +  G  P+  A   GHD++V +LL
Sbjct:   25 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL 170          

HSP 18 Score: 63.929 bits (154), Expect = 2.411e-25
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A  +  +    +LL      +   K+   P+H A   G+  I  LL+    D     ++ ++P+H A  +G  +++++LL     +E   +D   P+H A   GH  +V +L+ +   I A TK   +PL +A+Q
Sbjct:  182 ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ 320          

HSP 19 Score: 64.3142 bits (155), Expect = 2.404e-22
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +  A  +GH  +V +LL    E +   K     +H A +    +   LL+    + +V  ++  TP+H A  YG  ++  +L+     V    K +  P+H A  +G  ++V +L+ +  NIEA T++  +PL  A++ G  Q+V++L
Sbjct:  148 EDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML 297          

HSP 20 Score: 61.2326 bits (147), Expect = 2.404e-22
Identity = 33/121 (27.27%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A + G+L  V   +     I   + +    +H A ++ H+ +V  LL+    ++++ K G   +H A   G  E+VKLL+ +   ++ +S  G  P++ A+   HD +V++LLS   N  L
Sbjct:   25 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSL 145          

HSP 21 Score: 95.9005 bits (237), Expect = 6.160e-20
Identity = 41/156 (26.28%), Postives = 88/156 (56.41%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++P+H AA+    D + +LL++   ++A  +  + P+H A + G++++V LL+  G  ++   KD    +H A +    E+  +L+++   L+A+ K G  P+H    +G++++ +LL+  +  +DA+   G  P+H A  Y + ++  +LL +
Sbjct:  442 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEK 597          

HSP 22 Score: 93.5893 bits (231), Expect = 2.972e-19
Identity = 47/161 (29.19%), Postives = 80/161 (49.69%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
             +P+H AA+   +D  + LL++     A  K    P+H + Q GH  +  LLI    ++    K+   P+H   Q ++V + ++L K+  N++ + K G  P+H A   G   +V+ L+ N   +DA +  G  P+H  +  GH  IV +LL  + N   Q
Sbjct:  609 HTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQ 769          

HSP 23 Score: 91.6633 bits (226), Expect = 1.175e-18
Identity = 43/150 (28.67%), Postives = 80/150 (53.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H ++Q GH +  +LL++H  A+  P K    P+H   Q  ++NV  +L   G +I++  K    P+H A       +V+ LL++  N++A+   G  P+H     G+  IV LL+ ++   +A+++ G  P+H A   G+  ++  L
Sbjct:  643 TPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 792          

HSP 24 Score: 89.3521 bits (220), Expect = 7.005e-18
Identity = 45/157 (28.66%), Postives = 83/157 (52.87%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            + +H AA+ G  +  ++L+++  A++A  K    P+H   + GH+ V +LL+ +   ++   K+   P+H AC  N+ ++  LLL+   +  A+ KNG  P+H A     ++I   L+      +AES  G  P+H +S  GH EI  +L+  +  +
Sbjct:  511 TALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV 667          

HSP 25 Score: 85.5001 bits (210), Expect = 1.078e-16
Identity = 51/191 (26.70%), Postives = 80/191 (41.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNN---------------------------------HVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H  A+ GH+    LLL+    ++A  K    P+H AC   +  V  LL+ +G S     K+   P+H A + N                                 H EI  LL++ K  +    KNGL P+H      NV + ++L  N   +D  +  G  P+H AS +G   +V+ LL    N++
Sbjct:  544 TPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD 734          

HSP 26 Score: 72.4034 bits (176), Expect = 1.184e-12
Identity = 44/151 (29.14%), Postives = 73/151 (48.34%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            +D    +H A   GH  +V+MLL +   I+A  KN   P+H A Q  H +  ++L+ ++   +    + LT +H A   G+  V  +LL  N        +   P+H AC    L +V++L+    +I A T+   +PL +A+  G   IV
Sbjct:  276 RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIV 426          

HSP 27 Score: 68.1662 bits (165), Expect = 2.679e-11
Identity = 37/148 (25.00%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G+++IV +LL    +++A  K+    +H A + G  E+  +L+      +   +   TP+H    YG+  V  +LL     V+   K+   P+H AC + +  +  +L+ +  +  A  K   +PL +A++K    I   L
Sbjct:  480 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL 627          

HSP 28 Score: 65.4698 bits (158), Expect = 1.773e-10
Identity = 37/148 (25.00%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H     GH+ + ++LL +  +++A  KN   P+H AC   + ++  LL+          +N  TP+H A      D+ T LL          K    P+H +   GH  I  +LI     +    K   +P+ L +Q+    + E+L
Sbjct:  546 LHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 693          

HSP 29 Score: 63.929 bits (154), Expect = 4.483e-10
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G+ NI  +L+ +  ++N + K+   P+H A + G   +V LL+    + E +  + LTP+H A   G+  V+ +LL     +    K+   P+H A    H+   +IL+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  216 LHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD 365          

HSP 30 Score: 62.003 bits (149), Expect = 1.936e-9
Identity = 41/146 (28.08%), Postives = 75/146 (51.37%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL--SDT 1012
            G+L  V   L  + +IN ++ N    +H A ++GH  +V  L+      +   +   T +H A   G  +V+ +LL +N  V V  ++   P++ A    H  +V++L+S   N    T++ ++PL +A Q+G  ++V +L  SDT
Sbjct:   29 GNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDT 174          

HSP 31 Score: 61.6178 bits (148), Expect = 2.257e-9
Identity = 40/166 (24.10%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  506 IEKEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            ++KE D V    ++    +H AC   +  +  +LL +    +A  KN   P+H A +    +I   L+ Y        +   TP+H +   G+ ++  +L+ +   V    K+   P+H      ++++ +IL     NI+  TK  ++PL +AS  G + +V  L
Sbjct:  562 LQKEAD-VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL 726          

HSP 32 Score: 59.3066 bits (142), Expect = 1.116e-8
Identity = 46/178 (25.84%), Postives = 76/178 (42.70%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGH--------------------LHI---------VKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH+++V  LL +   +++A K     +H A   G  E+VKLL+ +     V+ +N  TP++ A    +  V+ +LL N     +  +D   P+  A   GH                    LHI           +L+  + N +  +K  ++PL +AS  G   I  LL
Sbjct:   54 ALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLL 231          

HSP 33 Score: 52.7582 bits (125), Expect = 1.414e-6
Identity = 26/91 (28.57%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  ++E V   LK+  ++  S+ NGL  +H A   G++ +V  L+     +D+ +  G+  +H AS  G +E+VK+LL    ++ +Q +
Sbjct:   25 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQ 115          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 95.5153 bits (236), Expect = 1.241e-41
Identity = 52/153 (33.99%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   ++    LLL     +    K    P+H A + G++ +VRLL+  G  I+   KD+  P+H A +N HV +V++LL     L+A  KNGL PIH A    +++ V+ L+     +D  +L    P+H A+  GH  +VK+LL +
Sbjct:  241 TPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDK 393          

HSP 2 Score: 95.5153 bits (236), Expect = 1.241e-41
Identity = 48/151 (31.79%), Postives = 78/151 (51.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H AC + H+  +++LL  S  + A  ++   P+H A   GH  IVK L+         +    TP+H A   G+ +V   LL NN +V+   KDD  P+H A   GH  +VK+L+    N ++ T    +PL +A+++G +Q   +L D
Sbjct:  407 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD 557          

HSP 3 Score: 102.064 bits (253), Expect = 1.692e-40
Identity = 55/151 (36.42%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV  V +LL     ++A  K    PIH A Q  H++ VR L+     I+    D   P+H A    H  +VK+LL       A   NG  P+H AC   ++  + LL+ +   L+A + +G  P+H A+F GH  IVK LL
Sbjct:  307 TPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL 457          

HSP 4 Score: 85.1149 bits (209), Expect = 1.692e-40
Identity = 44/149 (29.53%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GH  + + LL  + +++A  K+ + P+H A + GH E+VKLL+ +K + +       TP+H A   G+     +LL  N +     K    P+H AC +G + +V++L+ +  N  A  K   +PL +A       +V+LL
Sbjct:  473 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 621          

HSP 5 Score: 93.9745 bits (232), Expect = 1.643e-39
Identity = 50/158 (31.65%), Postives = 86/158 (54.43%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A++ G+V  V LLL     I+A  K +  P+H A +NGH+ VV +L+ +G  ++   K+   PIH A Q +H++ V+ LL+    ++    + L P+H A   G+  +VK+L+      +A +L G  P+H A    H   + +LL    ++E
Sbjct:  274 TPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLE 431          

HSP 6 Score: 89.7373 bits (221), Expect = 1.643e-39
Identity = 44/149 (29.53%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GHLNIV+ LL +    NA++     P+H A + GHCE+ + L+      + + ++  TP+H A   G+ +++ +L+ +    +        P+H A   GH    +IL+ +N      TK+ ++PL +A + G   +VELL
Sbjct:  440 PLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 588          

HSP 7 Score: 105.916 bits (263), Expect = 4.285e-39
Identity = 56/162 (34.57%), Postives = 88/162 (54.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V  LL++N  I+        P+H A   GH  +V++L+ +G        +   P+H AC+ NH+  + LLLK   +LEA  ++GL P+H A F G++ IVK L+      +A ++    P+H A+  GH E+ + LL     ++ + K
Sbjct:  340 SPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAK 501          

HSP 8 Score: 76.2554 bits (186), Expect = 4.285e-39
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            V    +D    +H A   GH  +V++L+      ++A      P+H A + GH +  ++L+     +    +   TP+H AC YG  DV+ +LL          K+   P+H A    +L +VK+L+S+  +  +  +  ++ L +A+++
Sbjct:  496 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQ 645          

HSP 9 Score: 104.375 bits (259), Expect = 8.096e-39
Identity = 51/153 (33.33%), Postives = 87/153 (56.86%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +  H+ ++ LLLKH+ ++EA  +    P+H A   GHLN+V+ L+  G S    +     P+H A +  H E+ + LL++   ++A  K+   P+H A   G+ E+VKLL+ ++   D+ +  G  P+H A+  GH +  +ILL E
Sbjct:  406 TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDE 558          

HSP 10 Score: 77.0258 bits (188), Expect = 8.096e-39
Identity = 46/149 (30.87%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H AC  G +++VE+LL +    NAA KN   P+H A  + + ++VKLLVS          N  T +H A      +V + LL               P+H A   G   +V +LIS+  N+    K   +PL L +Q+G   I ++L
Sbjct:  572 PLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADML 720          

HSP 11 Score: 85.8853 bits (211), Expect = 9.005e-35
Identity = 57/193 (29.53%), Postives = 92/193 (47.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SP++ AAQ  H++ V  LL+H  N ++   D F   P+  A Q GH NVV LLI+ G                              + ++  K    P+H A    ++ + +LLL    N+  + KNG+ P+H A   GNV +V+LL+     +DA++     P+H A+  GH  +V+ILL +   ++ + K
Sbjct:  146 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGF--TPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTK 336          

HSP 12 Score: 82.0333 bits (201), Expect = 9.005e-35
Identity = 45/149 (30.20%), Postives = 75/149 (50.34%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             IH A    H++ V  LL  + EI+    ++  P+H A   GH  +VK+L+        R  N  TP+H AC   +   M +LL ++  +E   +    P+H A F GHL+IVK L+ +  +  A   +  +PL +A++ G  ++ + L
Sbjct:  341 PIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFL 489          

HSP 13 Score: 96.6709 bits (239), Expect = 6.475e-34
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+ GH +    LL++N  ++A  K D+ P+H A + GH  +V+LL+    + +        P+H A +  H +  ++LL          K G  P+H AC +G V++V+LL+      +A    G  P+H A  + + ++VK+L+S+
Sbjct:  469 KVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 624          

HSP 14 Score: 68.1662 bits (165), Expect = 6.475e-34
Identity = 48/204 (23.53%), Postives = 85/204 (41.67%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKEN-----------------------------------WSPLDLASQKGFSQIVELL--SDTLRRKIIDSLVEELGI 1057
            A+H A  +  L +   LL      N+       P+H A Q G  ++V LL+S + +  + ++N LTP+H     G+  +  +L+     V    +    P+H AC +G++ +VK L+ Q  ++ + T+ +                                   ++PL  A+Q+G + IV LL     L  +I  +    LGI
Sbjct:  638 ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGI 841          

HSP 15 Score: 84.3445 bits (207), Expect = 4.095e-30
Identity = 48/159 (30.19%), Postives = 79/159 (49.69%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H A   GH+ +VE+LL Q   + A  KN   PIH A Q  H + V+ L+ Y  + +    + LTP+H A   G+  ++ VLL    K      +   P+H AC   H+  + +L+  + ++EA T+   +PL +A+  G   IV+ L
Sbjct:  298 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSL 456          

HSP 16 Score: 67.781 bits (164), Expect = 4.095e-30
Identity = 50/189 (26.46%), Postives = 79/189 (41.80%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GHV  V  LL +   +E   K     +H A   G   VV  LI+ G ++    +    P++ A Q NH+E+VK LL+   N     ++G  P+  A   G+  +V LLI+                             N    D  S TG  P+H A+ Y +  + ++LL+   N+    K
Sbjct:   82 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK 270          

HSP 17 Score: 105.916 bits (263), Expect = 5.079e-23
Identity = 62/196 (31.63%), Postives = 98/196 (50.00%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS----------------------NQCCL-----------DAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LL++H    ++       P+H A + GH    R+L+ E        K    P+H AC+   V++V+LLL+   N  A+ KNGL P+H A  H N+++VKLL+S                      NQ  +           ++ESL G  P+H AS  G  ++V +L+S++ N+ L +K
Sbjct:  504 QTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK 699          

HSP 18 Score: 67.3958 bits (163), Expect = 2.972e-22
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N +TP+H A   G   ++ +LL    +++   KD+  P+H A   GH+ +V+IL+ Q   ++A TK   SP+ +A+Q
Sbjct:  209 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ 347          

HSP 19 Score: 58.5362 bits (140), Expect = 2.972e-22
Identity = 37/121 (30.58%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A ++G+L      I  G  I I +++    +H A +  HV++V  LL +  +LE + K G   +H A   G  ++V  LI+    ++A+S  G  P++ A+   H E+VK LL    N  L
Sbjct:   52 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSL 172          

HSP 20 Score: 87.8113 bits (216), Expect = 2.114e-17
Identity = 46/156 (29.49%), Postives = 80/156 (51.28%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  GH++ V  LL+   +  A +     P+H A + GH  V + L+     ++   KD + P+H A +  H E+VKLL++ K N +++   G  P+H A   G+ +  ++L+         +  G  P+H A  YG  ++V++LL    N
Sbjct:  439 TPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGAN 594          

HSP 21 Score: 87.8113 bits (216), Expect = 2.226e-17
Identity = 56/196 (28.57%), Postives = 91/196 (46.43%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCS-----------IEICDKDKR----------------------KPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A + G VD V LLL+      A  K    P+H A  + +L+VV+LL+S+G S           + I  K  +                       P+H A Q    ++V LL+  + N+   +KNGL P+H     G+V I  +L+     + A S  G  P+H A  YG+ ++VK LL ++ ++  + +V
Sbjct:  571 TPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRV 766          

HSP 22 Score: 81.2629 bits (199), Expect = 2.178e-15
Identity = 48/159 (30.19%), Postives = 87/159 (54.72%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+N      ++LL+++   +   K    P+H A    +L+V +LL++ G ++    K+   P+H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V +V++L+     L A++  G  PIH A+   H + V+ LL  + N E+ D
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDD 366          

HSP 23 Score: 81.2629 bits (199), Expect = 2.197e-15
Identity = 44/149 (29.53%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  +V++L+      + + +N L+PIH A    + D +  LL  N +++    D   P+H A   GH  +VK+L+ +     A     ++PL +A +K   + ++LL
Sbjct:  275 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 423          

HSP 24 Score: 79.337 bits (194), Expect = 1.004e-14
Identity = 47/186 (25.27%), Postives = 86/186 (46.24%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLT-----------------------------------GSRPIHFASFYGHDEIVKILL 462
            + +H AA+   ++  S LL++     +       P+H A Q G  ++V LLIS+  ++ + +K+   P+H   Q  HV I  +L+K   ++ A+ + G  P+H AC +GN+++VK L+  Q  +++++                                     G  P+H A+  GH +IV +LL
Sbjct:  637 TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLL 822          

HSP 25 Score: 75.8702 bits (185), Expect = 1.036e-13
Identity = 42/151 (27.81%), Postives = 81/151 (53.64%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H A    +L++ ++LL +   +N   KN   P+H A + G+  +V+LL+      + + +++LTP+H A   G+  V+ +LL     ++   K+   PIH A    H+  V+ L+  N  I+  T ++ +PL +A+  G  ++V++L D
Sbjct:  242 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 392          

HSP 26 Score: 67.781 bits (164), Expect = 1.254e-11
Identity = 49/190 (25.79%), Postives = 80/190 (42.11%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q     ++ A    HL +V+ LL      +   ++   P+  A Q GH  +V LL++Y    +VR                      D N         TP+H A  Y    V  +LL     V    K+   P+H A   G++ +V++L+ +   I+A TK+  +PL  A++ G  ++VE+L D
Sbjct:  137 VNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLD 326          

HSP 27 Score: 21.9422 bits (45), Expect = 1.254e-11
Identity = 16/54 (29.63%), Postives = 25/54 (46.30%), Query Frame = 1
Query:  334 GNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            GN+E     I N   ++  +  G   +H AS  GH ++V  LL    ++E   K
Sbjct:   56 GNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTK 109          

HSP 28 Score: 66.6254 bits (161), Expect = 8.672e-11
Identity = 44/180 (24.44%), Postives = 79/180 (43.89%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+     +NA  +    P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L + ++L+++  N+    K   +PL +AS++G   +V LL D
Sbjct:  114 ALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLD 293          

HSP 29 Score: 58.9214 bits (141), Expect = 1.904e-8
Identity = 44/184 (23.91%), Postives = 71/184 (38.59%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLL-----INN-FKVEVGDKDDG-----------------------------RPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   G  ++V +L+++   +N  +KN   P+H   Q GH  I  +LV              TP+H AC YG   ++  LL     +N+  +V V   D                                P+H A   GH  IV +L+         T    SPL +A + G+  ++++L
Sbjct:  671 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 854          

HSP 30 Score: 56.225 bits (134), Expect = 1.367e-7
Identity = 36/127 (28.35%), Postives = 60/127 (47.24%), Query Frame = 2
Query:  623 EINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +IN A++N    +H A + GH ++V  L+    D E   +   T +H A   G   V+  L+     V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V LL
Sbjct:   70 DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALL 196          

HSP 31 Score: 53.9138 bits (128), Expect = 7.402e-7
Identity = 34/147 (23.13%), Postives = 69/147 (46.94%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA++G+++     +K+   I   ++     +H A + GH+ +V  L+  G  +E   K     +H A      ++V  L+    N+ A  + G  P++ A    ++E+VK L+ +       +  G  P+  A   GH+ +V +L++
Sbjct:   52 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN 198          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 95.5153 bits (236), Expect = 1.632e-41
Identity = 52/153 (33.99%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   ++    LLL     +    K    P+H A + G++ +VRLL+  G  I+   KD+  P+H A +N HV +V++LL     L+A  KNGL PIH A    +++ V+ L+     +D  +L    P+H A+  GH  +VK+LL +
Sbjct:  149 TPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDK 301          

HSP 2 Score: 95.1301 bits (235), Expect = 1.632e-41
Identity = 48/151 (31.79%), Postives = 78/151 (51.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H AC + H+  +++LL  S  + A  ++   P+H A   GH  IVK L+         +    TP+H A   G+ +V   LL NN +V+   KDD  P+H A   GH  +VK+L+    N ++ T    +PL +A+++G +Q   +L D
Sbjct:  315 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD 465          

HSP 3 Score: 102.064 bits (253), Expect = 2.244e-40
Identity = 55/151 (36.42%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV  V +LL     ++A  K    PIH A Q  H++ VR L+     I+    D   P+H A    H  +VK+LL       A   NG  P+H AC   ++  + LL+ +   L+A + +G  P+H A+F GH  IVK LL
Sbjct:  215 TPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL 365          

HSP 4 Score: 84.7297 bits (208), Expect = 2.244e-40
Identity = 44/149 (29.53%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GH  + + LL  + +++A  K+ + P+H A + GH E+VKLL+ +K + +       TP+H A   G+     +LL  N +     K    P+H AC +G + +V++L+ +  N  A  K   +PL +A       +V+LL
Sbjct:  381 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 529          

HSP 5 Score: 93.9745 bits (232), Expect = 2.039e-39
Identity = 50/158 (31.65%), Postives = 86/158 (54.43%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A++ G+V  V LLL     I+A  K +  P+H A +NGH+ VV +L+ +G  ++   K+   PIH A Q +H++ V+ LL+    ++    + L P+H A   G+  +VK+L+      +A +L G  P+H A    H   + +LL    ++E
Sbjct:  182 TPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLE 339          

HSP 6 Score: 89.7373 bits (221), Expect = 2.039e-39
Identity = 44/149 (29.53%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GHLNIV+ LL +    NA++     P+H A + GHCE+ + L+      + + ++  TP+H A   G+ +++ +L+ +    +        P+H A   GH    +IL+ +N      TK+ ++PL +A + G   +VELL
Sbjct:  348 PLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 496          

HSP 7 Score: 105.916 bits (263), Expect = 5.970e-39
Identity = 56/162 (34.57%), Postives = 88/162 (54.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V  LL++N  I+        P+H A   GH  +V++L+ +G        +   P+H AC+ NH+  + LLLK   +LEA  ++GL P+H A F G++ IVK L+      +A ++    P+H A+  GH E+ + LL     ++ + K
Sbjct:  248 SPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAK 409          

HSP 8 Score: 75.8702 bits (185), Expect = 5.970e-39
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            V    +D    +H A   GH  +V++L+      ++A      P+H A + GH +  ++L+     +    +   TP+H AC YG  DV+ +LL          K+   P+H A    +L +VK+L+S+  +  +  +  ++ L +A+++
Sbjct:  404 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQ 553          

HSP 9 Score: 96.6709 bits (239), Expect = 6.702e-39
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+ GH +    LL++N  ++A  K D+ P+H A + GH  +V+LL+    + +        P+H A +  H +  ++LL          K G  P+H AC +G V++V+LL+      +A    G  P+H A  + + ++VK+L+S+
Sbjct:  377 KVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 532          

HSP 10 Score: 85.1149 bits (209), Expect = 6.702e-39
Identity = 48/169 (28.40%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL--SDTLRRKIIDSLVEELGI 1057
            A+H A  +  L +   LL      N+       P+H A Q G  ++V LL+S + +  + ++N LTP+H     G+  +  +L+     V    +    P+H AC +G++ +VK L+ Q  ++ + T+  ++PL  A+Q+G + IV LL     L  +I  +    LGI
Sbjct:  546 ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGI 714          

HSP 11 Score: 104.375 bits (259), Expect = 1.091e-38
Identity = 51/153 (33.33%), Postives = 87/153 (56.86%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +  H+ ++ LLLKH+ ++EA  +    P+H A   GHLN+V+ L+  G S    +     P+H A +  H E+ + LL++   ++A  K+   P+H A   G+ E+VKLL+ ++   D+ +  G  P+H A+  GH +  +ILL E
Sbjct:  314 TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDE 466          

HSP 12 Score: 76.6406 bits (187), Expect = 1.091e-38
Identity = 46/149 (30.87%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H AC  G +++VE+LL +    NAA KN   P+H A  + + ++VKLLVS          N  T +H A      +V + LL               P+H A   G   +V +LIS+  N+    K   +PL L +Q+G   I ++L
Sbjct:  480 PLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADML 628          

HSP 13 Score: 85.5001 bits (210), Expect = 1.254e-34
Identity = 57/193 (29.53%), Postives = 92/193 (47.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SP++ AAQ  H++ V  LL+H  N ++   D F   P+  A Q GH NVV LLI+ G                              + ++  K    P+H A    ++ + +LLL    N+  + KNG+ P+H A   GNV +V+LL+     +DA++     P+H A+  GH  +V+ILL +   ++ + K
Sbjct:   54 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGF--TPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTK 244          

HSP 14 Score: 81.6481 bits (200), Expect = 1.254e-34
Identity = 45/149 (30.20%), Postives = 75/149 (50.34%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             IH A    H++ V  LL  + EI+    ++  P+H A   GH  +VK+L+        R  N  TP+H AC   +   M +LL ++  +E   +    P+H A F GHL+IVK L+ +  +  A   +  +PL +A++ G  ++ + L
Sbjct:  249 PIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFL 397          

HSP 15 Score: 84.3445 bits (207), Expect = 1.222e-26
Identity = 48/159 (30.19%), Postives = 79/159 (49.69%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H A   GH+ +VE+LL Q   + A  KN   PIH A Q  H + V+ L+ Y  + +    + LTP+H A   G+  ++ VLL    K      +   P+H AC   H+  + +L+  + ++EA T+   +PL +A+  G   IV+ L
Sbjct:  206 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSL 364          

HSP 16 Score: 56.225 bits (134), Expect = 1.222e-26
Identity = 46/176 (26.14%), Postives = 71/176 (40.34%), Query Frame = 1
Query:   58 LLLKHNNA-IEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            L L HN   +E   K     +H A   G   VV  LI+ G ++    +    P++ A Q NH+E+VK LL+   N     ++G  P+  A   G+  +V LLI+                             N    D  S TG  P+H A+ Y +  + ++LL+   N+    K
Sbjct:    3 LELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK 178          

HSP 17 Score: 105.916 bits (263), Expect = 5.345e-23
Identity = 62/196 (31.63%), Postives = 98/196 (50.00%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS----------------------NQCCL-----------DAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LL++H    ++       P+H A + GH    R+L+ E        K    P+H AC+   V++V+LLL+   N  A+ KNGL P+H A  H N+++VKLL+S                      NQ  +           ++ESL G  P+H AS  G  ++V +L+S++ N+ L +K
Sbjct:  412 QTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK 607          

HSP 18 Score: 96.2857 bits (238), Expect = 4.446e-20
Identity = 47/151 (31.13%), Postives = 86/151 (56.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + +H AA+   ++  S LL++     +       P+H A Q G  ++V LLIS+  ++ + +K+   P+H   Q  HV I  +L+K   ++ A+ + G  P+H AC +GN+++VK L+  Q  +++++  G  P+H A+  GH +IV +LL
Sbjct:  545 TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 695          

HSP 19 Score: 87.8113 bits (216), Expect = 2.191e-17
Identity = 46/156 (29.49%), Postives = 80/156 (51.28%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  GH++ V  LL+   +  A +     P+H A + GH  V + L+     ++   KD + P+H A +  H E+VKLL++ K N +++   G  P+H A   G+ +  ++L+         +  G  P+H A  YG  ++V++LL    N
Sbjct:  347 TPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGAN 502          

HSP 20 Score: 87.0409 bits (214), Expect = 3.342e-17
Identity = 40/150 (26.67%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q G  D V+LL+     +   +K    P+H   Q GH+ +  +L+ +G S+    +    P+H AC   ++++VK LL+ + ++ +  + G  P+H A   G+ +IV LL+ +    +  +  G+ P+  A   G+  ++ +L
Sbjct:  578 TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 21 Score: 86.6557 bits (213), Expect = 5.141e-17
Identity = 48/157 (30.57%), Postives = 81/157 (51.59%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A + G VD V LLL+      A  K    P+H A  + +L+VV+LL+S+G S     ++    +H A + N +E+   LL+   N  +    G+ P+H A   G  ++V LLIS Q  ++  +  G  P+H  +  GH  I  +L+ +  ++
Sbjct:  479 TPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 635          

HSP 22 Score: 81.2629 bits (199), Expect = 2.287e-15
Identity = 48/159 (30.19%), Postives = 87/159 (54.72%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+N      ++LL+++   +   K    P+H A    +L+V +LL++ G ++    K+   P+H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V +V++L+     L A++  G  PIH A+   H + V+ LL  + N E+ D
Sbjct:  118 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDD 274          

HSP 23 Score: 81.2629 bits (199), Expect = 2.513e-15
Identity = 44/149 (29.53%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  +V++L+      + + +N L+PIH A    + D +  LL  N +++    D   P+H A   GH  +VK+L+ +     A     ++PL +A +K   + ++LL
Sbjct:  183 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 331          

HSP 24 Score: 75.485 bits (184), Expect = 1.230e-13
Identity = 42/151 (27.81%), Postives = 81/151 (53.64%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H A    +L++ ++LL +   +N   KN   P+H A + G+  +V+LL+      + + +++LTP+H A   G+  V+ +LL     ++   K+   PIH A    H+  V+ L+  N  I+  T ++ +PL +A+  G  ++V++L D
Sbjct:  150 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 300          

HSP 25 Score: 74.3294 bits (181), Expect = 2.926e-13
Identity = 41/149 (27.52%), Postives = 66/149 (44.30%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   G  ++V +L+++   +N  +KN   P+H   Q GH  I  +LV              TP+H AC YG   ++  LL     V    +    P+H A   GH  IV +L+         T    SPL +A + G+  ++++L
Sbjct:  579 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 26 Score: 67.3958 bits (163), Expect = 4.752e-11
Identity = 49/190 (25.79%), Postives = 80/190 (42.11%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q     ++ A    HL +V+ LL      +   ++   P+  A Q GH  +V LL++Y    +VR                      D N         TP+H A  Y    V  +LL     V    K+   P+H A   G++ +V++L+ +   I+A TK+  +PL  A++ G  ++VE+L D
Sbjct:   45 VNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLD 234          

HSP 27 Score: 67.0106 bits (162), Expect = 6.143e-11
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N +TP+H A   G   ++ +LL    +++   KD+  P+H A   GH+ +V+IL+ Q   ++A TK   SP+ +A+Q
Sbjct:  117 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ 255          

HSP 28 Score: 66.2402 bits (160), Expect = 1.109e-10
Identity = 44/180 (24.44%), Postives = 79/180 (43.89%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+     +NA  +    P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L + ++L+++  N+    K   +PL +AS++G   +V LL D
Sbjct:   22 ALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLD 201          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 95.5153 bits (236), Expect = 2.092e-40
Identity = 52/153 (33.99%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   ++    LLL     +    K    P+H A + G++ +VRLL+  G  I+   KD+  P+H A +N HV +V++LL     L+A  KNGL PIH A    +++ V+ L+     +D  +L    P+H A+  GH  +VK+LL +
Sbjct:  211 TPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDK 363          

HSP 2 Score: 91.2781 bits (225), Expect = 2.092e-40
Identity = 48/150 (32.00%), Postives = 78/150 (52.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC + H+  +++LL  S  + A  ++   P+H A   GH  IVK L+         +    TP+H A   G+ +V   LL NN +V+   KDD  P+H A   GH  +VK+L+    N ++ T    +PL +A+++G +Q   +L D
Sbjct:  378 LHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD 527          

HSP 3 Score: 102.064 bits (253), Expect = 2.134e-39
Identity = 55/151 (36.42%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV  V +LL     ++A  K    PIH A Q  H++ VR L+     I+    D   P+H A    H  +VK+LL       A   NG  P+H AC   ++  + LL+ +   L+A + +G  P+H A+F GH  IVK LL
Sbjct:  277 TPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL 427          

HSP 4 Score: 81.2629 bits (199), Expect = 2.134e-39
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL  + +++A  K+ + P+H A + GH E+VKLL+ +K + +       TP+H A   G+     +LL  N +     K    P+H AC +G + +V++L+ +  N  A  K   +PL +A       +V+LL
Sbjct:  444 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 591          

HSP 5 Score: 93.9745 bits (232), Expect = 1.970e-38
Identity = 50/158 (31.65%), Postives = 86/158 (54.43%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A++ G+V  V LLL     I+A  K +  P+H A +NGH+ VV +L+ +G  ++   K+   PIH A Q +H++ V+ LL+    ++    + L P+H A   G+  +VK+L+      +A +L G  P+H A    H   + +LL    ++E
Sbjct:  244 TPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLE 401          

HSP 6 Score: 86.2705 bits (212), Expect = 1.970e-38
Identity = 44/148 (29.73%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHLNIV+ LL +    NA++     P+H A + GHCE+ + L+      + + ++  TP+H A   G+ +++ +L+ +    +        P+H A   GH    +IL+ +N      TK+ ++PL +A + G   +VELL
Sbjct:  411 LHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 558          

HSP 7 Score: 97.0561 bits (240), Expect = 3.156e-38
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+ GH +    LL++N  ++A  K D+ P+H A + GH  +V+LL+    + +        P+H A +  H +  ++LL          K G  P+H AC +G V++V+LL+      +A    G  P+H A  + + ++VK+L+S+
Sbjct:  439 KVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 594          

HSP 8 Score: 82.4185 bits (202), Expect = 3.156e-38
Identity = 43/149 (28.86%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A  +  L +   LL      N+       P+H A Q G  ++V LL+S + +  + ++N LTP+H     G+  +  +L+     V    +    P+H AC +G++ +VK L+ Q  ++ + T+  ++PL  A+Q+G + IV LL
Sbjct:  608 ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLL 756          

HSP 9 Score: 104.76 bits (260), Expect = 5.355e-38
Identity = 51/153 (33.33%), Postives = 87/153 (56.86%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +  H+ ++ LLLKH+ ++EA  +    P+H A   GHLN+V+ L+  G S    +     P+H A +  H E+ + LL++   ++A  K+   P+H A   G+ E+VKLL+ ++   D+ +  G  P+H A+  GH +  +ILL E
Sbjct:  376 TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDE 528          

HSP 10 Score: 73.9442 bits (180), Expect = 5.355e-38
Identity = 47/181 (25.97%), Postives = 82/181 (45.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVS---------------------------------YKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G +++VE+LL +    NAA KN   P+H A  + + ++VKLLVS                                 Y  +        +TP+H A   G  D++ +L+     V +G+K+   P+H     GH+ I  +L+ Q  ++ A ++  ++PL +A   G  ++V+ L
Sbjct:  543 LHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFL 723          

HSP 11 Score: 85.8853 bits (211), Expect = 1.736e-35
Identity = 57/193 (29.53%), Postives = 92/193 (47.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SP++ AAQ  H++ V  LL+H  N ++   D F   P+  A Q GH NVV LLI+ G                              + ++  K    P+H A    ++ + +LLL    N+  + KNG+ P+H A   GNV +V+LL+     +DA++     P+H A+  GH  +V+ILL +   ++ + K
Sbjct:  116 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGF--TPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTK 306          

HSP 12 Score: 84.3445 bits (207), Expect = 1.736e-35
Identity = 48/157 (30.57%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLL-------INNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   GH  +V++LL +  + NA   N   P+H AC+  H   + LL+ +    E   E+ LTP+H A F G+ +++  LL        +N KVE        P+H A   GH  + + L+  N  ++A  K++ +PL  A++ G  ++V+LL +
Sbjct:  345 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET-------PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLME 494          

HSP 13 Score: 83.1889 bits (204), Expect = 9.776e-30
Identity = 48/154 (31.17%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ +VE+LL Q   + A  KN   PIH A Q  H + V+ L+ Y  + +    + LTP+H A   G+  ++ VLL    K      +   P+H AC   H+  + +L+  + ++EA T+   +PL +A+  G   IV+ L
Sbjct:  273 KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSL 426          

HSP 14 Score: 67.781 bits (164), Expect = 9.776e-30
Identity = 50/189 (26.46%), Postives = 79/189 (41.80%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GHV  V  LL +   +E   K     +H A   G   VV  LI+ G ++    +    P++ A Q NH+E+VK LL+   N     ++G  P+  A   G+  +V LLI+                             N    D  S TG  P+H A+ Y +  + ++LL+   N+    K
Sbjct:   52 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK 240          

HSP 15 Score: 105.916 bits (263), Expect = 4.801e-23
Identity = 56/162 (34.57%), Postives = 88/162 (54.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V  LL++N  I+        P+H A   GH  +V++L+ +G        +   P+H AC+ NH+  + LLLK   +LEA  ++GL P+H A F G++ IVK L+      +A ++    P+H A+  GH E+ + LL     ++ + K
Sbjct:  310 SPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAK 471          

HSP 16 Score: 105.916 bits (263), Expect = 5.421e-23
Identity = 62/196 (31.63%), Postives = 98/196 (50.00%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS----------------------NQCCL-----------DAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LL++H    ++       P+H A + GH    R+L+ E        K    P+H AC+   V++V+LLL+   N  A+ KNGL P+H A  H N+++VKLL+S                      NQ  +           ++ESL G  P+H AS  G  ++V +L+S++ N+ L +K
Sbjct:  474 QTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK 669          

HSP 17 Score: 61.6178 bits (148), Expect = 1.486e-20
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N +TP+H A   G   ++ +LL    +++   KD+  P+H A   GH+ +V+IL+ Q   ++A TK   SP+ +A+Q
Sbjct:  179 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ 317          

HSP 18 Score: 58.5362 bits (140), Expect = 1.486e-20
Identity = 37/121 (30.58%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            A ++G+L      I  G  I I +++    +H A +  HV++V  LL +  +LE + K G   +H A   G  ++V  LI+    ++A+S  G  P++ A+   H E+VK LL    N  L
Sbjct:   22 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSL 142          

HSP 19 Score: 96.6709 bits (239), Expect = 4.631e-20
Identity = 47/151 (31.13%), Postives = 86/151 (56.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + +H AA+   ++  S LL++     +       P+H A Q G  ++V LLIS+  ++ + +K+   P+H   Q  HV I  +L+K   ++ A+ + G  P+H AC +GN+++VK L+  Q  +++++  G  P+H A+  GH +IV +LL
Sbjct:  607 TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 757          

HSP 20 Score: 87.8113 bits (216), Expect = 2.169e-17
Identity = 46/156 (29.49%), Postives = 80/156 (51.28%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  GH++ V  LL+   +  A +     P+H A + GH  V + L+     ++   KD + P+H A +  H E+VKLL++ K N +++   G  P+H A   G+ +  ++L+         +  G  P+H A  YG  ++V++LL    N
Sbjct:  409 TPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGAN 564          

HSP 21 Score: 87.4261 bits (215), Expect = 3.451e-17
Identity = 40/150 (26.67%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q G  D V+LL+     +   +K    P+H   Q GH+ +  +L+ +G S+    +    P+H AC   ++++VK LL+ + ++ +  + G  P+H A   G+ +IV LL+ +    +  +  G+ P+  A   G+  ++ +L
Sbjct:  640 TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 22 Score: 86.6557 bits (213), Expect = 5.212e-17
Identity = 48/157 (30.57%), Postives = 81/157 (51.59%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A + G VD V LLL+      A  K    P+H A  + +L+VV+LL+S+G S     ++    +H A + N +E+   LL+   N  +    G+ P+H A   G  ++V LLIS Q  ++  +  G  P+H  +  GH  I  +L+ +  ++
Sbjct:  541 TPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 697          

HSP 23 Score: 81.2629 bits (199), Expect = 2.315e-15
Identity = 48/159 (30.19%), Postives = 87/159 (54.72%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+N      ++LL+++   +   K    P+H A    +L+V +LL++ G ++    K+   P+H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V +V++L+     L A++  G  PIH A+   H + V+ LL  + N E+ D
Sbjct:  180 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDD 336          

HSP 24 Score: 80.8777 bits (198), Expect = 3.434e-15
Identity = 45/148 (30.41%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    H++ V  LL  + EI+    ++  P+H A   GH  +VK+L+        R  N  TP+H AC   +   M +LL ++  +E   +    P+H A F GHL+IVK L+ +  +  A   +  +PL +A++ G  ++ + L
Sbjct:  312 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFL 459          

HSP 25 Score: 79.7221 bits (195), Expect = 8.592e-15
Identity = 44/148 (29.73%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  +V++L+      + + +N L+PIH A    + D +  LL  N +++    D   P+H A   GH  +VK+L+ +     A     ++PL +A +K   + ++LL
Sbjct:  246 LHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 393          

HSP 26 Score: 74.3294 bits (181), Expect = 3.879e-13
Identity = 42/150 (28.00%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +L++ ++LL +   +N   KN   P+H A + G+  +V+LL+      + + +++LTP+H A   G+  V+ +LL     ++   K+   PIH A    H+  V+ L+  N  I+  T ++ +PL +A+  G  ++V++L D
Sbjct:  213 LHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 362          

HSP 27 Score: 72.4034 bits (176), Expect = 1.364e-12
Identity = 41/148 (27.70%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  ++V +L+++   +N  +KN   P+H   Q GH  I  +LV              TP+H AC YG   ++  LL     V    +    P+H A   GH  IV +L+         T    SPL +A + G+  ++++L
Sbjct:  642 LHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 28 Score: 63.5438 bits (153), Expect = 1.790e-10
Identity = 46/179 (25.70%), Postives = 79/179 (44.13%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      +   ++   P+  A Q GH  +V LL++Y    +VR          D+ +                    TP+H A  Y    V  +LL     V    K+   P+H A   G++ +V++L+ +   I+A TK+  +PL  A++ G  ++VE+L D
Sbjct:  118 LYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLD 296          

HSP 29 Score: 21.9422 bits (45), Expect = 1.790e-10
Identity = 16/54 (29.63%), Postives = 25/54 (46.30%), Query Frame = 1
Query:  334 GNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            GN+E     I N   ++  +  G   +H AS  GH ++V  LL    ++E   K
Sbjct:   26 GNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTK 79          

HSP 30 Score: 63.1586 bits (152), Expect = 9.139e-10
Identity = 44/180 (24.44%), Postives = 79/180 (43.89%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+     +NA  +    P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L + ++L+++  N+    K   +PL +AS++G   +V LL D
Sbjct:   84 ALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLD 263          

HSP 31 Score: 55.8398 bits (133), Expect = 1.628e-7
Identity = 36/127 (28.35%), Postives = 60/127 (47.24%), Query Frame = 2
Query:  623 EINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +IN A++N    +H A + GH ++V  L+    D E   +   T +H A   G   V+  L+     V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V LL
Sbjct:   40 DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALL 166          

HSP 32 Score: 53.9138 bits (128), Expect = 7.352e-7
Identity = 34/147 (23.13%), Postives = 69/147 (46.94%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA++G+++     +K+   I   ++     +H A + GH+ +V  L+  G  +E   K     +H A      ++V  L+    N+ A  + G  P++ A    ++E+VK L+ +       +  G  P+  A   GH+ +V +L++
Sbjct:   22 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN 168          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 102.064 bits (253), Expect = 2.064e-39
Identity = 55/151 (36.42%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV  V +LL     ++A  K    PIH A Q  H++ VR L+     I+    D   P+H A    H  +VK+LL       A   NG  P+H AC   ++  + LL+ +   L+A + +G  P+H A+F GH  IVK LL
Sbjct:  304 TPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL 454          

HSP 2 Score: 81.2629 bits (199), Expect = 2.064e-39
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL  + +++A  K+ + P+H A + GH E+VKLL+ +K + +       TP+H A   G+     +LL  N +     K    P+H AC +G + +V++L+ +  N  A  K   +PL +A       +V+LL
Sbjct:  474 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 621          

HSP 3 Score: 95.5153 bits (236), Expect = 8.481e-39
Identity = 52/153 (33.99%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   ++    LLL     +    K    P+H A + G++ +VRLL+  G  I+   KD+  P+H A +N HV +V++LL     L+A  KNGL PIH A    +++ V+ L+     +D  +L    P+H A+  GH  +VK+LL +
Sbjct:  238 TPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDK 390          

HSP 4 Score: 85.8853 bits (211), Expect = 8.481e-39
Identity = 48/153 (31.37%), Postives = 78/153 (50.98%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKE---VRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC + H+  +++LL  S  + A  ++   P+H A   GH  IVK L+             +   TP+H A   G+ +V   LL NN +V+   KDD  P+H A   GH  +VK+L+    N ++ T    +PL +A+++G +Q   +L D
Sbjct:  405 LHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD 557          

HSP 5 Score: 96.6709 bits (239), Expect = 3.513e-38
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            ++P+H AA+ GH +    LL++N  ++A  K D+ P+H A + GH  +V+LL+    + +        P+H A +  H +  ++LL          K G  P+H AC +G V++V+LL+      +A    G  P+H A  + + ++VK+L+S+
Sbjct:  471 ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 624          

HSP 6 Score: 82.4185 bits (202), Expect = 3.513e-38
Identity = 43/149 (28.86%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A  +  L +   LL      N+       P+H A Q G  ++V LL+S + +  + ++N LTP+H     G+  +  +L+     V    +    P+H AC +G++ +VK L+ Q  ++ + T+  ++PL  A+Q+G + IV LL
Sbjct:  638 ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLL 786          

HSP 7 Score: 99.7525 bits (247), Expect = 1.422e-36
Identity = 53/156 (33.97%), Postives = 88/156 (56.41%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCS--IEICDKDK-RKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +  H+ ++ LLLKH+ ++EA  +    P+H A   GHLN+V+ L+  G S    I   D    P+H A +  H E+ + LL++   ++A  K+   P+H A   G+ E+VKLL+ ++   D+ +  G  P+H A+  GH +  +ILL E
Sbjct:  403 TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDE 558          

HSP 8 Score: 73.9442 bits (180), Expect = 1.422e-36
Identity = 47/181 (25.97%), Postives = 82/181 (45.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVS---------------------------------YKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G +++VE+LL +    NAA KN   P+H A  + + ++VKLLVS                                 Y  +        +TP+H A   G  D++ +L+     V +G+K+   P+H     GH+ I  +L+ Q  ++ A ++  ++PL +A   G  ++V+ L
Sbjct:  573 LHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFL 753          

HSP 9 Score: 93.9745 bits (232), Expect = 2.990e-36
Identity = 50/158 (31.65%), Postives = 86/158 (54.43%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A++ G+V  V LLL     I+A  K +  P+H A +NGH+ VV +L+ +G  ++   K+   PIH A Q +H++ V+ LL+    ++    + L P+H A   G+  +VK+L+      +A +L G  P+H A    H   + +LL    ++E
Sbjct:  271 TPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLE 428          

HSP 10 Score: 78.9518 bits (193), Expect = 2.990e-36
Identity = 43/151 (28.48%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINA---ADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHLNIV+ LL +    N+   +      P+H A + GHCE+ + L+      + + ++  TP+H A   G+ +++ +L+ +    +        P+H A   GH    +IL+ +N      TK+ ++PL +A + G   +VELL
Sbjct:  438 LHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 588          

HSP 11 Score: 85.8853 bits (211), Expect = 3.095e-33
Identity = 57/193 (29.53%), Postives = 92/193 (47.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SP++ AAQ  H++ V  LL+H  N ++   D F   P+  A Q GH NVV LLI+ G                              + ++  K    P+H A    ++ + +LLL    N+  + KNG+ P+H A   GNV +V+LL+     +DA++     P+H A+  GH  +V+ILL +   ++ + K
Sbjct:  143 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGF--TPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTK 333          

HSP 12 Score: 76.6406 bits (187), Expect = 3.095e-33
Identity = 48/152 (31.58%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILI----SQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    H++ V  LL  + EI+    ++  P+H A   GH  +VK+L+        R  N  TP+H AC   +   M +LL ++  +E   +    P+H A F GHL+IVK L+    S N NI +      +PL +A++ G  ++ + L
Sbjct:  339 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVE-TPLHMAARAGHCEVAQFL 489          

HSP 13 Score: 83.1889 bits (204), Expect = 9.936e-30
Identity = 48/154 (31.17%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ +VE+LL Q   + A  KN   PIH A Q  H + V+ L+ Y  + +    + LTP+H A   G+  ++ VLL    K      +   P+H AC   H+  + +L+  + ++EA T+   +PL +A+  G   IV+ L
Sbjct:  300 KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSL 453          

HSP 14 Score: 67.781 bits (164), Expect = 9.936e-30
Identity = 50/189 (26.46%), Postives = 79/189 (41.80%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GHV  V  LL +   +E   K     +H A   G   VV  LI+ G ++    +    P++ A Q NH+E+VK LL+   N     ++G  P+  A   G+  +V LLI+                             N    D  S TG  P+H A+ Y +  + ++LL+   N+    K
Sbjct:   79 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK 267          

HSP 15 Score: 105.916 bits (263), Expect = 5.269e-23
Identity = 62/196 (31.63%), Postives = 98/196 (50.00%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS----------------------NQCCL-----------DAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LL++H    ++       P+H A + GH    R+L+ E        K    P+H AC+   V++V+LLL+   N  A+ KNGL P+H A  H N+++VKLL+S                      NQ  +           ++ESL G  P+H AS  G  ++V +L+S++ N+ L +K
Sbjct:  504 QTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK 699          

HSP 16 Score: 96.6709 bits (239), Expect = 4.422e-20
Identity = 47/151 (31.13%), Postives = 86/151 (56.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + +H AA+   ++  S LL++     +       P+H A Q G  ++V LLIS+  ++ + +K+   P+H   Q  HV I  +L+K   ++ A+ + G  P+H AC +GN+++VK L+  Q  +++++  G  P+H A+  GH +IV +LL
Sbjct:  637 TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 787          

HSP 17 Score: 87.4261 bits (215), Expect = 3.409e-17
Identity = 40/150 (26.67%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q G  D V+LL+     +   +K    P+H   Q GH+ +  +L+ +G S+    +    P+H AC   ++++VK LL+ + ++ +  + G  P+H A   G+ +IV LL+ +    +  +  G+ P+  A   G+  ++ +L
Sbjct:  670 TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 18 Score: 86.6557 bits (213), Expect = 5.149e-17
Identity = 48/157 (30.57%), Postives = 81/157 (51.59%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A + G VD V LLL+      A  K    P+H A  + +L+VV+LL+S+G S     ++    +H A + N +E+   LL+   N  +    G+ P+H A   G  ++V LLIS Q  ++  +  G  P+H  +  GH  I  +L+ +  ++
Sbjct:  571 TPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 727          

HSP 19 Score: 85.5001 bits (210), Expect = 1.205e-16
Identity = 48/160 (30.00%), Postives = 83/160 (51.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH----NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  GH++ V  LL+     N+ I + D +   P+H A + GH  V + L+     ++   KD + P+H A +  H E+VKLL++ K N +++   G  P+H A   G+ +  ++L+         +  G  P+H A  YG  ++V++LL    N
Sbjct:  436 TPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSD-YVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGAN 594          

HSP 20 Score: 81.2629 bits (199), Expect = 2.345e-15
Identity = 48/159 (30.19%), Postives = 87/159 (54.72%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+N      ++LL+++   +   K    P+H A    +L+V +LL++ G ++    K+   P+H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V +V++L+     L A++  G  PIH A+   H + V+ LL  + N E+ D
Sbjct:  207 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDD 363          

HSP 21 Score: 79.7221 bits (195), Expect = 8.629e-15
Identity = 44/148 (29.73%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  +V++L+      + + +N L+PIH A    + D +  LL  N +++    D   P+H A   GH  +VK+L+ +     A     ++PL +A +K   + ++LL
Sbjct:  273 LHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 420          

HSP 22 Score: 74.3294 bits (181), Expect = 3.894e-13
Identity = 42/150 (28.00%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +L++ ++LL +   +N   KN   P+H A + G+  +V+LL+      + + +++LTP+H A   G+  V+ +LL     ++   K+   PIH A    H+  V+ L+  N  I+  T ++ +PL +A+  G  ++V++L D
Sbjct:  240 LHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 389          

HSP 23 Score: 72.4034 bits (176), Expect = 1.369e-12
Identity = 41/148 (27.70%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  ++V +L+++   +N  +KN   P+H   Q GH  I  +LV              TP+H AC YG   ++  LL     V    +    P+H A   GH  IV +L+         T    SPL +A + G+  ++++L
Sbjct:  672 LHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 24 Score: 63.5438 bits (153), Expect = 4.817e-10
Identity = 46/179 (25.70%), Postives = 79/179 (44.13%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      +   ++   P+  A Q GH  +V LL++Y    +VR          D+ +                    TP+H A  Y    V  +LL     V    K+   P+H A   G++ +V++L+ +   I+A TK+  +PL  A++ G  ++VE+L D
Sbjct:  145 LYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLD 323          

HSP 25 Score: 20.7866 bits (42), Expect = 4.817e-10
Identity = 13/40 (32.50%), Postives = 18/40 (45.00%), Query Frame = 1
Query:  376 CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            C    S  G   +H AS  GH ++V  LL    ++E   K
Sbjct:   67 CFFLYSQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTK 106          

HSP 26 Score: 63.1586 bits (152), Expect = 9.169e-10
Identity = 44/180 (24.44%), Postives = 79/180 (43.89%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+     +NA  +    P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L + ++L+++  N+    K   +PL +AS++G   +V LL D
Sbjct:  111 ALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLD 290          

HSP 27 Score: 61.6178 bits (148), Expect = 3.078e-9
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N +TP+H A   G   ++ +LL    +++   KD+  P+H A   GH+ +V+IL+ Q   ++A TK   SP+ +A+Q
Sbjct:  206 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 102.064 bits (253), Expect = 2.134e-39
Identity = 55/151 (36.42%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV  V +LL     ++A  K    PIH A Q  H++ VR L+     I+    D   P+H A    H  +VK+LL       A   NG  P+H AC   ++  + LL+ +   L+A + +G  P+H A+F GH  IVK LL
Sbjct:  285 TPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL 435          

HSP 2 Score: 81.2629 bits (199), Expect = 2.134e-39
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL  + +++A  K+ + P+H A + GH E+VKLL+ +K + +       TP+H A   G+     +LL  N +     K    P+H AC +G + +V++L+ +  N  A  K   +PL +A       +V+LL
Sbjct:  455 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 602          

HSP 3 Score: 95.5153 bits (236), Expect = 8.840e-39
Identity = 52/153 (33.99%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   ++    LLL     +    K    P+H A + G++ +VRLL+  G  I+   KD+  P+H A +N HV +V++LL     L+A  KNGL PIH A    +++ V+ L+     +D  +L    P+H A+  GH  +VK+LL +
Sbjct:  219 TPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDK 371          

HSP 4 Score: 85.8853 bits (211), Expect = 8.840e-39
Identity = 48/153 (31.37%), Postives = 78/153 (50.98%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKE---VRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC + H+  +++LL  S  + A  ++   P+H A   GH  IVK L+             +   TP+H A   G+ +V   LL NN +V+   KDD  P+H A   GH  +VK+L+    N ++ T    +PL +A+++G +Q   +L D
Sbjct:  386 LHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD 538          

HSP 5 Score: 96.6709 bits (239), Expect = 3.601e-38
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            ++P+H AA+ GH +    LL++N  ++A  K D+ P+H A + GH  +V+LL+    + +        P+H A +  H +  ++LL          K G  P+H AC +G V++V+LL+      +A    G  P+H A  + + ++VK+L+S+
Sbjct:  452 ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 605          

HSP 6 Score: 82.4185 bits (202), Expect = 3.601e-38
Identity = 43/149 (28.86%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A  +  L +   LL      N+       P+H A Q G  ++V LL+S + +  + ++N LTP+H     G+  +  +L+     V    +    P+H AC +G++ +VK L+ Q  ++ + T+  ++PL  A+Q+G + IV LL
Sbjct:  619 ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLL 767          

HSP 7 Score: 99.7525 bits (247), Expect = 1.470e-36
Identity = 53/156 (33.97%), Postives = 88/156 (56.41%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCS--IEICDKDK-RKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +  H+ ++ LLLKH+ ++EA  +    P+H A   GHLN+V+ L+  G S    I   D    P+H A +  H E+ + LL++   ++A  K+   P+H A   G+ E+VKLL+ ++   D+ +  G  P+H A+  GH +  +ILL E
Sbjct:  384 TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDE 539          

HSP 8 Score: 73.9442 bits (180), Expect = 1.470e-36
Identity = 47/181 (25.97%), Postives = 82/181 (45.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVS---------------------------------YKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC  G +++VE+LL +    NAA KN   P+H A  + + ++VKLLVS                                 Y  +        +TP+H A   G  D++ +L+     V +G+K+   P+H     GH+ I  +L+ Q  ++ A ++  ++PL +A   G  ++V+ L
Sbjct:  554 LHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFL 734          

HSP 9 Score: 93.9745 bits (232), Expect = 3.091e-36
Identity = 50/158 (31.65%), Postives = 86/158 (54.43%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A++ G+V  V LLL     I+A  K +  P+H A +NGH+ VV +L+ +G  ++   K+   PIH A Q +H++ V+ LL+    ++    + L P+H A   G+  +VK+L+      +A +L G  P+H A    H   + +LL    ++E
Sbjct:  252 TPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLE 409          

HSP 10 Score: 78.9518 bits (193), Expect = 3.091e-36
Identity = 43/151 (28.48%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINA---ADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHLNIV+ LL +    N+   +      P+H A + GHCE+ + L+      + + ++  TP+H A   G+ +++ +L+ +    +        P+H A   GH    +IL+ +N      TK+ ++PL +A + G   +VELL
Sbjct:  419 LHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 569          

HSP 11 Score: 85.8853 bits (211), Expect = 3.121e-33
Identity = 57/193 (29.53%), Postives = 92/193 (47.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SP++ AAQ  H++ V  LL+H  N ++   D F   P+  A Q GH NVV LLI+ G                              + ++  K    P+H A    ++ + +LLL    N+  + KNG+ P+H A   GNV +V+LL+     +DA++     P+H A+  GH  +V+ILL +   ++ + K
Sbjct:  124 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGF--TPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTK 314          

HSP 12 Score: 76.6406 bits (187), Expect = 3.121e-33
Identity = 48/152 (31.58%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILI----SQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    H++ V  LL  + EI+    ++  P+H A   GH  +VK+L+        R  N  TP+H AC   +   M +LL ++  +E   +    P+H A F GHL+IVK L+    S N NI +      +PL +A++ G  ++ + L
Sbjct:  320 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVE-TPLHMAARAGHCEVAQFL 470          

HSP 13 Score: 83.1889 bits (204), Expect = 9.774e-30
Identity = 48/154 (31.17%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ +VE+LL Q   + A  KN   PIH A Q  H + V+ L+ Y  + +    + LTP+H A   G+  ++ VLL    K      +   P+H AC   H+  + +L+  + ++EA T+   +PL +A+  G   IV+ L
Sbjct:  281 KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSL 434          

HSP 14 Score: 67.781 bits (164), Expect = 9.774e-30
Identity = 50/189 (26.46%), Postives = 79/189 (41.80%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GHV  V  LL +   +E   K     +H A   G   VV  LI+ G ++    +    P++ A Q NH+E+VK LL+   N     ++G  P+  A   G+  +V LLI+                             N    D  S TG  P+H A+ Y +  + ++LL+   N+    K
Sbjct:   60 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK 248          

HSP 15 Score: 105.916 bits (263), Expect = 5.437e-23
Identity = 62/196 (31.63%), Postives = 98/196 (50.00%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS----------------------NQCCL-----------DAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LL++H    ++       P+H A + GH    R+L+ E        K    P+H AC+   V++V+LLL+   N  A+ KNGL P+H A  H N+++VKLL+S                      NQ  +           ++ESL G  P+H AS  G  ++V +L+S++ N+ L +K
Sbjct:  485 QTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK 680          

HSP 16 Score: 96.6709 bits (239), Expect = 4.643e-20
Identity = 47/151 (31.13%), Postives = 86/151 (56.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + +H AA+   ++  S LL++     +       P+H A Q G  ++V LLIS+  ++ + +K+   P+H   Q  HV I  +L+K   ++ A+ + G  P+H AC +GN+++VK L+  Q  +++++  G  P+H A+  GH +IV +LL
Sbjct:  618 TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 768          

HSP 17 Score: 87.4261 bits (215), Expect = 3.459e-17
Identity = 40/150 (26.67%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q G  D V+LL+     +   +K    P+H   Q GH+ +  +L+ +G S+    +    P+H AC   ++++VK LL+ + ++ +  + G  P+H A   G+ +IV LL+ +    +  +  G+ P+  A   G+  ++ +L
Sbjct:  651 TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 800          

HSP 18 Score: 86.6557 bits (213), Expect = 5.224e-17
Identity = 48/157 (30.57%), Postives = 81/157 (51.59%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H A + G VD V LLL+      A  K    P+H A  + +L+VV+LL+S+G S     ++    +H A + N +E+   LL+   N  +    G+ P+H A   G  ++V LLIS Q  ++  +  G  P+H  +  GH  I  +L+ +  ++
Sbjct:  552 TPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 708          

HSP 19 Score: 85.5001 bits (210), Expect = 1.233e-16
Identity = 48/160 (30.00%), Postives = 83/160 (51.88%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH----NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  GH++ V  LL+     N+ I + D +   P+H A + GH  V + L+     ++   KD + P+H A +  H E+VKLL++ K N +++   G  P+H A   G+ +  ++L+         +  G  P+H A  YG  ++V++LL    N
Sbjct:  417 TPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSD-YVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGAN 575          

HSP 20 Score: 81.2629 bits (199), Expect = 2.320e-15
Identity = 48/159 (30.19%), Postives = 87/159 (54.72%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+N      ++LL+++   +   K    P+H A    +L+V +LL++ G ++    K+   P+H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V +V++L+     L A++  G  PIH A+   H + V+ LL  + N E+ D
Sbjct:  188 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDD 344          

HSP 21 Score: 79.7221 bits (195), Expect = 8.609e-15
Identity = 44/148 (29.73%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  +V++L+      + + +N L+PIH A    + D +  LL  N +++    D   P+H A   GH  +VK+L+ +     A     ++PL +A +K   + ++LL
Sbjct:  254 LHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 401          

HSP 22 Score: 74.3294 bits (181), Expect = 3.886e-13
Identity = 42/150 (28.00%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +L++ ++LL +   +N   KN   P+H A + G+  +V+LL+      + + +++LTP+H A   G+  V+ +LL     ++   K+   PIH A    H+  V+ L+  N  I+  T ++ +PL +A+  G  ++V++L D
Sbjct:  221 LHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 370          

HSP 23 Score: 72.4034 bits (176), Expect = 1.366e-12
Identity = 41/148 (27.70%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  ++V +L+++   +N  +KN   P+H   Q GH  I  +LV              TP+H AC YG   ++  LL     V    +    P+H A   GH  IV +L+         T    SPL +A + G+  ++++L
Sbjct:  653 LHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 800          

HSP 24 Score: 63.5438 bits (153), Expect = 4.819e-10
Identity = 46/179 (25.70%), Postives = 79/179 (44.13%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      +   ++   P+  A Q GH  +V LL++Y    +VR          D+ +                    TP+H A  Y    V  +LL     V    K+   P+H A   G++ +V++L+ +   I+A TK+  +PL  A++ G  ++VE+L D
Sbjct:  126 LYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLD 304          

HSP 25 Score: 20.7866 bits (42), Expect = 4.819e-10
Identity = 13/40 (32.50%), Postives = 18/40 (45.00%), Query Frame = 1
Query:  376 CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            C    S  G   +H AS  GH ++V  LL    ++E   K
Sbjct:   48 CFFLYSQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTK 87          

HSP 26 Score: 63.1586 bits (152), Expect = 9.153e-10
Identity = 44/180 (24.44%), Postives = 79/180 (43.89%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+     +NA  +    P++ A Q  H E+VK L+ +  ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L + ++L+++  N+    K   +PL +AS++G   +V LL D
Sbjct:   92 ALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLD 271          

HSP 27 Score: 61.6178 bits (148), Expect = 3.073e-9
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N +TP+H A   G   ++ +LL    +++   KD+  P+H A   GH+ +V+IL+ Q   ++A TK   SP+ +A+Q
Sbjct:  187 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ 325          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 96.2857 bits (238), Expect = 2.163e-40
Identity = 45/156 (28.85%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+  H D    L+++   + A  K D+ P+H A ++GH  +VRLL+  G   +        P+H   +  H +  +LLL ++    +  K G  P+H A  +G ++I +LL+  +   ++   TG  P+H A ++ H  IV++LL++
Sbjct:  396 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNK 551          

HSP 2 Score: 90.8929 bits (224), Expect = 2.163e-40
Identity = 47/157 (29.94%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  533 CYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            C  ++    +H A  +  ++    LL      NA       P+H A Q GH ++V LL+S + +  + +++ LTP+H A   G+ ++  VL+ ++  V    +    P+H AC +G++ +VK L+    N+ A TK  ++PL  A+Q+G + IV LL
Sbjct:  557 CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLL 713          

HSP 3 Score: 96.2857 bits (238), Expect = 1.565e-38
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL     +    +     +H A + G++ +VRLL+  G  I+ C KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+  Q  +D  +L    P+H A+  GH  + K+LL +
Sbjct:  194 TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDK 346          

HSP 4 Score: 84.7297 bits (208), Expect = 1.565e-38
Identity = 40/149 (26.85%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H AC + H+ ++E+LL     I+A  +    P+H A +  H ++   L+  K     R ++  TP+H A   G+++++ +LL N    +        P+H     GH    ++L+       + TK+ ++PL +A++ G  QI ELL
Sbjct:  367 PLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELL 515          

HSP 5 Score: 87.4261 bits (215), Expect = 2.301e-35
Identity = 45/151 (29.80%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +  H+  + LLLK   +I+A  +    P+H A +  H +V   LI     +    KD + P+H A ++ H E+V+LLL++  + +     G  P+H     G+ +  +LL+ NQ    + +  G  P+H A+ YG  +I ++LL
Sbjct:  366 TPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 516          

HSP 6 Score: 82.8037 bits (203), Expect = 2.301e-35
Identity = 43/149 (28.86%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A    HLNIV +LL +    +   +N   P+H A +    +  + L+ +      +    +TP+H A   G+ D++T+LL     V +G+K    P+H A   GHL+I ++L+S + ++ A T+  ++PL +A   G  ++V+ L
Sbjct:  532 PLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL 680          

HSP 7 Score: 85.8853 bits (211), Expect = 4.522e-31
Identity = 50/165 (30.30%), Postives = 87/165 (52.73%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESL-------TGSRPIHFASFYGHDEIVKILLSERCNIE 483
            S +H A++ G+V  V LLL     I+A  K +  P+H A +NGH+ +  +L+  G  I+   K+   PIH A Q +H++ V+LLL+ + +++    + L P+H A   G+  + KLL+      +A +L        G  P+H A    H  ++++LL    +I+
Sbjct:  227 SALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASID 391          

HSP 8 Score: 70.0922 bits (170), Expect = 4.522e-31
Identity = 36/155 (23.23%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            + K  V    +D    +H A   GH  +V +LL      +        P+H   + GH +  +LL+  +       +   TP+H A  YG   +  +LL          K    P+H A +  HL+IV++L+++  +     +  ++PL +A ++
Sbjct:  418 QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQ 572          

HSP 9 Score: 92.4337 bits (228), Expect = 8.255e-31
Identity = 53/169 (31.36%), Postives = 82/169 (48.52%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLK--SKCNLEA-----SDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + KLLL   +K N  A        NG  P+H AC   ++ +++LL+ +   +DA +     P+H A+   H ++   L+  +  +  + K
Sbjct:  260 TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAK 428          

HSP 10 Score: 62.7734 bits (151), Expect = 8.255e-31
Identity = 44/182 (24.18%), Postives = 74/182 (40.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLIN---------------NFKVEVGDKDDGR------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H     GH    E+LL       +  K    P+H A + G  +I +LL+  +       +  LTP+H A ++ + +++ +LL                 +  V+    D  R                  P+H A   GH  +V +L+S+  N+    K + +PL LASQ+G   I E+L
Sbjct:  466 PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVL 647          

HSP 11 Score: 81.6481 bits (200), Expect = 3.858e-30
Identity = 47/158 (29.75%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAA-------DKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H A   GH  + ++LL +  + NA          N   P+H AC+  H  +++LL+      +   E   TP+H A    + DV   L+ N  KV    KDD  P+H A   GH  +V++L+    + +  T    +PL L ++ G +Q  ELL D
Sbjct:  327 PLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD 484          

HSP 12 Score: 71.2478 bits (173), Expect = 3.858e-30
Identity = 54/193 (27.98%), Postives = 84/193 (43.52%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H+  V  LL++  N  +   D F   P+  A Q GH NVV  LIS G                              + ++  K    P+H A    ++ + +LLL    N+  + +NG+  +H A   GNV +V+LL+     +DA +     P+H A   GH  I +ILL     I+ + K
Sbjct:   99 TPLYMAAQENHLPVVKFLLENGANQNLATEDGF--TPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK 289          

HSP 13 Score: 79.7221 bits (195), Expect = 2.569e-29
Identity = 51/194 (26.29%), Postives = 89/194 (45.88%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGR-------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y+   +    + LTP+H A   G+  V  +LL      + G K + R             P+H AC   H+ ++++L+    +I+A T++  +PL +A++   + + + L     +    +  ++  + C     HY
Sbjct:  256 KDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLL------DKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHY 443          

HSP 14 Score: 70.4774 bits (171), Expect = 2.569e-29
Identity = 47/186 (25.27%), Postives = 81/186 (43.55%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H +++ GHV  V+ LL  +  +E   K     +H A   G  +VVR L++ G ++    +    P++ A Q NH+ +VK LL++  N   + ++G  P+  A   G+  +V  LIS                             N    D  S TG  P+H A+ Y +  + ++LL+   N+  
Sbjct:   35 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNF 220          

HSP 15 Score: 105.916 bits (263), Expect = 6.979e-23
Identity = 52/150 (34.67%), Postives = 81/150 (54.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H AAQ GH D V+LLL     +   +K    P+H A Q GHLN+  +L+S   S+    +    P+H AC   ++++VK LL+ + N+ A  K G  P+H A   G+ +IV LL+ N  C +  S+ G  P+  A   G+  +  +L
Sbjct:  597 TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 746          

HSP 16 Score: 100.908 bits (250), Expect = 2.949e-21
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   VD    LL+      A       P+H A Q GH ++V LL+S+  ++ + +K    P+H A Q  H+ I ++L+    ++ A  + G  P+H AC +GN+++VK L+ +Q  ++A +  G  P+H A+  GH +IV +LL
Sbjct:  564 TPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 714          

HSP 17 Score: 93.2041 bits (230), Expect = 6.397e-19
Identity = 49/163 (30.06%), Postives = 82/163 (50.31%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             +P+H   + GH     LLL +  A  +  K    P+H A + G + +  LL+          K    P+H A  +NH+ IV+LLL    +   + +NG  P+H A    +V+  + L+      +A+SL G  P+H A+  GH ++V +LLS++ N+ L +K
Sbjct:  464 HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNK 626          

HSP 18 Score: 91.2781 bits (225), Expect = 2.696e-18
Identity = 55/196 (28.06%), Postives = 94/196 (47.96%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKD---------KRK------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H AA+ G +    LLL+      +  K    P+H A  + HLN+VRLL+++G S     ++         K++                        P+H A Q  H ++V LLL  + N+   +K+ L P+H A   G++ I ++L+S+   + AE+  G  P+H A  YG+ ++VK LL  + N+    K+
Sbjct:  498 TPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL 693          

HSP 19 Score: 59.6918 bits (143), Expect = 3.941e-18
Identity = 39/149 (26.17%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N ++ +H A   G   ++ +LL    +++   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +ASQ      V LL
Sbjct:  162 ALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLL 310          

HSP 20 Score: 52.7582 bits (125), Expect = 3.941e-18
Identity = 33/147 (22.45%), Postives = 68/147 (46.26%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA+ G++D     L++   I   ++     +H + + GH+ +V  L+ +   +E   K     +H A      ++V+ L+    N+ +  + G  P++ A    ++ +VK L+ N    +  +  G  P+  A   GH+ +V  L+S
Sbjct:    5 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 151          

HSP 21 Score: 80.1073 bits (196), Expect = 8.727e-15
Identity = 43/150 (28.67%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
             +H A   GH ++V +LL++   ++  +K+   P+H A Q GH  I ++LVS+             P+H AC YG   V+  LL +   V    K    P+H A   GH  IV +L+         +    +PL +A + G+  + ++LS
Sbjct:  598 PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLS 747          

HSP 22 Score: 76.6406 bits (187), Expect = 8.521e-14
Identity = 46/161 (28.57%), Postives = 83/161 (51.55%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEA-------CTKENWSPLDLASQKGFSQIVELL 1003
            Q+   A+H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL     ++    D   P+H A   GH  + K+L+ +     A        T   ++PL +A +K   +++ELL
Sbjct:  223 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELL 383          

HSP 23 Score: 74.3294 bits (181), Expect = 4.445e-13
Identity = 36/119 (30.25%), Postives = 63/119 (52.94%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLL 360
            S +P+H A+Q GH++   +L+ H+ ++ A  +    P+H AC  G++ VV+ L+    ++    K    P+H A Q  H +IV LLLK+      +  NG+ P+  A   G + +  +L
Sbjct:  628 SLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 746          

HSP 24 Score: 69.3218 bits (168), Expect = 1.697e-11
Identity = 40/151 (26.49%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H A    +LN+ ++LL +   +N   +N    +H A + G+  +V+LL+      +   +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+    +I+  T ++ +PL +A+  G  ++ +LL D
Sbjct:  195 PLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLD 345          

HSP 25 Score: 68.1662 bits (165), Expect = 4.233e-11
Identity = 38/149 (25.50%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A    H ++ + L+    ++NA  K+ + P+H A ++GH E+V+LL+      +       TP+H     G+     +LL N        K    P+H A  +G + I ++L+ +  +  +  K   +PL +A       IV LL
Sbjct:  400 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLL 548          

HSP 26 Score: 65.855 bits (159), Expect = 2.020e-10
Identity = 50/190 (26.32%), Postives = 79/190 (41.58%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q     ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L+SY    +VR                      D N         TP+H A  Y   +V  +LL     V    ++    +H A   G++ +V++L+ +   I+ACTK+  +PL  A + G  +I E+L D
Sbjct:   90 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 279          

HSP 27 Score: 60.4622 bits (145), Expect = 9.471e-9
Identity = 41/180 (22.78%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  L+     +N+  +    P++ A Q  H  +VK L+    ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L++ ++L+++  N+    +   S L +AS++G   +V LL D
Sbjct:   67 ALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLD 246          

HSP 28 Score: 53.1434 bits (126), Expect = 1.897e-6
Identity = 37/145 (25.52%), Postives = 65/145 (44.83%), Query Frame = 2
Query:  569 ACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A   G+L+     L    +IN  ++N    +H + + GH ++V  L+      E   +   T +H A   G  DV+  L+ +   V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V  L
Sbjct:    5 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 149          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 96.2857 bits (238), Expect = 2.574e-40
Identity = 45/156 (28.85%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+  H D    L+++   + A  K D+ P+H A ++GH  +VRLL+  G   +        P+H   +  H +  +LLL ++    +  K G  P+H A  +G ++I +LL+  +   ++   TG  P+H A ++ H  IV++LL++
Sbjct:  369 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNK 524          

HSP 2 Score: 90.5077 bits (223), Expect = 2.574e-40
Identity = 47/157 (29.94%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  533 CYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            C  ++    +H A  +  ++    LL      NA       P+H A Q GH ++V LL+S + +  + +++ LTP+H A   G+ ++  VL+ ++  V    +    P+H AC +G++ +VK L+    N+ A TK  ++PL  A+Q+G + IV LL
Sbjct:  530 CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLL 686          

HSP 3 Score: 82.8037 bits (203), Expect = 8.688e-32
Identity = 43/149 (28.86%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A    HLNIV +LL +    +   +N   P+H A +    +  + L+ +      +    +TP+H A   G+ D++T+LL     V +G+K    P+H A   GHL+I ++L+S + ++ A T+  ++PL +A   G  ++V+ L
Sbjct:  505 PLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL 653          

HSP 4 Score: 75.485 bits (184), Expect = 8.688e-32
Identity = 41/137 (29.93%), Postives = 71/137 (51.82%), Query Frame = 1
Query:   52 VSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + LLLK   +I+A  +    P+H A +  H +V   LI     +    KD + P+H A ++ H E+V+LLL++  + +     G  P+H     G+ +  +LL+ NQ    + +  G  P+H A+ YG  +I ++LL
Sbjct:  353 MELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 489          

HSP 5 Score: 86.6557 bits (213), Expect = 3.333e-31
Identity = 50/166 (30.12%), Postives = 86/166 (51.81%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFAS--------FYGHDEIVKILLSERCNIE 483
            +P+H AA   +++   LLL     +    +     +H A + G++ +VRLL+  G  I+ C KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+  Q  +D  +L    P+H A+        F+     +++LL    +I+
Sbjct:  199 TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASID 364          

HSP 6 Score: 69.707 bits (169), Expect = 3.333e-31
Identity = 36/155 (23.23%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            + K  V    +D    +H A   GH  +V +LL      +        P+H   + GH +  +LL+  +       +   TP+H A  YG   +  +LL          K    P+H A +  HL+IV++L+++  +     +  ++PL +A ++
Sbjct:  391 QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQ 545          

HSP 7 Score: 80.1073 bits (196), Expect = 5.637e-30
Identity = 45/156 (28.85%), Postives = 86/156 (55.13%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+N      ++LL+++   +   K    P+H A    +LNV +LL++ G ++    ++    +H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V I ++L+ +   + A++  G  PIH AS   H + V++LL  + +I+
Sbjct:  168 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHID 323          

HSP 8 Score: 72.0182 bits (175), Expect = 5.637e-30
Identity = 36/138 (26.09%), Postives = 67/138 (48.55%), Query Frame = 2
Query:  590 NIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + +E+LL     I+A  +    P+H A +  H ++   L+  K     R ++  TP+H A   G+++++ +LL N    +        P+H     GH    ++L+       + TK+ ++PL +A++ G  QI ELL
Sbjct:  351 SFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELL 488          

HSP 9 Score: 81.2629 bits (199), Expect = 1.046e-29
Identity = 57/197 (28.93%), Postives = 81/197 (41.12%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYAC----FYGYF-------------------------------------DVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y+   +    + LTP+H A     +Y YF                                     DV   L+ N  KV    KDD  P+H A   GH  +V++L+    + +  T    +PL L ++ G +Q  ELL D
Sbjct:  261 KDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD 457          

HSP 10 Score: 70.4774 bits (171), Expect = 1.046e-29
Identity = 47/186 (25.27%), Postives = 81/186 (43.55%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H +++ GHV  V+ LL  +  +E   K     +H A   G  +VVR L++ G ++    +    P++ A Q NH+ +VK LL++  N   + ++G  P+  A   G+  +V  LIS                             N    D  S TG  P+H A+ Y +  + ++LL+   N+  
Sbjct:   40 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNF 225          

HSP 11 Score: 83.9593 bits (206), Expect = 4.060e-28
Identity = 47/170 (27.65%), Postives = 86/170 (50.59%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIH--------YACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            S +H A++ G+V  V LLL     I+A  K +  P+H A +NGH+ +  +L+  G  I+   K+   PIH A Q +H++ V+LLL+ + +++    + L P+H        Y  F      ++LL+ +   +DA +     P+H A+   H ++   L+  +  +  + K
Sbjct:  232 SALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAK 401          

HSP 12 Score: 62.3882 bits (150), Expect = 4.060e-28
Identity = 44/182 (24.18%), Postives = 74/182 (40.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLIN---------------NFKVEVGDKDDGR------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H     GH    E+LL       +  K    P+H A + G  +I +LL+  +       +  LTP+H A ++ + +++ +LL                 +  V+    D  R                  P+H A   GH  +V +L+S+  N+    K + +PL LASQ+G   I E+L
Sbjct:  439 PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVL 620          

HSP 13 Score: 105.916 bits (263), Expect = 6.920e-23
Identity = 52/150 (34.67%), Postives = 81/150 (54.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H AAQ GH D V+LLL     +   +K    P+H A Q GHLN+  +L+S   S+    +    P+H AC   ++++VK LL+ + N+ A  K G  P+H A   G+ +IV LL+ N  C +  S+ G  P+  A   G+  +  +L
Sbjct:  570 TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 719          

HSP 14 Score: 100.908 bits (250), Expect = 2.950e-21
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   VD    LL+      A       P+H A Q GH ++V LL+S+  ++ + +K    P+H A Q  H+ I ++L+    ++ A  + G  P+H AC +GN+++VK L+ +Q  ++A +  G  P+H A+  GH +IV +LL
Sbjct:  537 TPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 687          

HSP 15 Score: 93.2041 bits (230), Expect = 6.398e-19
Identity = 49/163 (30.06%), Postives = 82/163 (50.31%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             +P+H   + GH     LLL +  A  +  K    P+H A + G + +  LL+          K    P+H A  +NH+ IV+LLL    +   + +NG  P+H A    +V+  + L+      +A+SL G  P+H A+  GH ++V +LLS++ N+ L +K
Sbjct:  437 HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNK 599          

HSP 16 Score: 91.2781 bits (225), Expect = 2.673e-18
Identity = 55/196 (28.06%), Postives = 94/196 (47.96%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKD---------KRK------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H AA+ G +    LLL+      +  K    P+H A  + HLN+VRLL+++G S     ++         K++                        P+H A Q  H ++V LLL  + N+   +K+ L P+H A   G++ I ++L+S+   + AE+  G  P+H A  YG+ ++VK LL  + N+    K+
Sbjct:  471 TPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL 666          

HSP 17 Score: 59.6918 bits (143), Expect = 3.973e-18
Identity = 39/149 (26.17%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N ++ +H A   G   ++ +LL    +++   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +ASQ      V LL
Sbjct:  167 ALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLL 315          

HSP 18 Score: 52.7582 bits (125), Expect = 3.973e-18
Identity = 33/147 (22.45%), Postives = 68/147 (46.26%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA+ G++D     L++   I   ++     +H + + GH+ +V  L+ +   +E   K     +H A      ++V+ L+    N+ +  + G  P++ A    ++ +VK L+ N    +  +  G  P+  A   GH+ +V  L+S
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 156          

HSP 19 Score: 84.7297 bits (208), Expect = 2.872e-16
Identity = 52/195 (26.67%), Postives = 82/195 (42.05%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLIS-----------------------------------------EGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P+H A +NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+                                           G SI+   +    P+H A +  H ++   L+++K  + A  K+   P+H A   G+ E+V+LL+ N    D  +  G  P+H  +  GH +  ++LL  +
Sbjct:  265 TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQ 459          

HSP 20 Score: 79.7221 bits (195), Expect = 9.509e-15
Identity = 43/150 (28.67%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
             +H A   GH ++V +LL++   ++  +K+   P+H A Q GH  I ++LVS+             P+H AC YG   V+  LL +   V    K    P+H A   GH  IV +L+         +    +PL +A + G+  + ++LS
Sbjct:  571 PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLS 720          

HSP 21 Score: 75.8702 bits (185), Expect = 1.857e-13
Identity = 46/189 (24.34%), Postives = 92/189 (48.68%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYAC--------FFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            Q+   A+H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL     ++    D   P+H A         FF     +++L+    +I+A T++  +PL +A++   + + + L     +    +  ++  + C     HY
Sbjct:  228 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHY 416          

HSP 22 Score: 74.3294 bits (181), Expect = 4.446e-13
Identity = 36/119 (30.25%), Postives = 63/119 (52.94%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLL 360
            S +P+H A+Q GH++   +L+ H+ ++ A  +    P+H AC  G++ VV+ L+    ++    K    P+H A Q  H +IV LLLK+      +  NG+ P+  A   G + +  +L
Sbjct:  601 SLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 719          

HSP 23 Score: 71.2478 bits (173), Expect = 5.001e-12
Identity = 54/193 (27.98%), Postives = 84/193 (43.52%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H+  V  LL++  N  +   D F   P+  A Q GH NVV  LIS G                              + ++  K    P+H A    ++ + +LLL    N+  + +NG+  +H A   GNV +V+LL+     +DA +     P+H A   GH  I +ILL     I+ + K
Sbjct:  104 TPLYMAAQENHLPVVKFLLENGANQNLATEDGF--TPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK 294          

HSP 24 Score: 67.781 bits (164), Expect = 4.980e-11
Identity = 38/149 (25.50%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A    H ++ + L+    ++NA  K+ + P+H A ++GH E+V+LL+      +       TP+H     G+     +LL N        K    P+H A  +G + I ++L+ +  +  +  K   +PL +A       IV LL
Sbjct:  373 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLL 521          

HSP 25 Score: 65.855 bits (159), Expect = 2.219e-10
Identity = 50/190 (26.32%), Postives = 79/190 (41.58%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q     ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L+SY    +VR                      D N         TP+H A  Y   +V  +LL     V    ++    +H A   G++ +V++L+ +   I+ACTK+  +PL  A + G  +I E+L D
Sbjct:   95 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 284          

HSP 26 Score: 63.5438 bits (153), Expect = 1.067e-9
Identity = 36/138 (26.09%), Postives = 72/138 (52.17%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLAS 970
             +H A    +LN+ ++LL +   +N   +N    +H A + G+  +V+LL+      +   +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+    +I+  T ++ +PL +A+
Sbjct:  200 PLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAA 337          

HSP 27 Score: 60.4622 bits (145), Expect = 1.049e-8
Identity = 41/180 (22.78%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  L+     +N+  +    P++ A Q  H  +VK L+    ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L++ ++L+++  N+    +   S L +AS++G   +V LL D
Sbjct:   72 ALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLD 251          

HSP 28 Score: 52.7582 bits (125), Expect = 1.946e-6
Identity = 37/145 (25.52%), Postives = 65/145 (44.83%), Query Frame = 2
Query:  569 ACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A   G+L+     L    +IN  ++N    +H + + GH ++V  L+      E   +   T +H A   G  DV+  L+ +   V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V  L
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 154          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 95.1301 bits (235), Expect = 3.645e-40
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL     +    +     +H A + G++ +VRLL+  G  I+ C KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+  Q  +D  +L    P+H A+  GH  + K+LL +
Sbjct:  199 TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDK 351          

HSP 2 Score: 91.2781 bits (225), Expect = 3.645e-40
Identity = 49/151 (32.45%), Postives = 74/151 (49.01%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H AC + H+ ++E+LL     I+A  ++   P+H A   GH  IVK L+       V      TP+H A    + DV   L+ N  KV    KDD  P+H A   GH  +V++L+    + +  T    +PL L ++ G +Q  ELL D
Sbjct:  365 PLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD 515          

HSP 3 Score: 95.1301 bits (235), Expect = 8.900e-40
Identity = 45/156 (28.85%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+  H D    L+++   + A  K D+ P+H A ++GH  +VRLL+  G   +        P+H   +  H +  +LLL ++    +  K G  P+H A  +G ++I +LL+  +   ++   TG  P+H A ++ H  IV++LL++
Sbjct:  427 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNK 582          

HSP 4 Score: 90.1225 bits (222), Expect = 8.900e-40
Identity = 47/157 (29.94%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  533 CYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            C  ++    +H A  +  ++    LL      NA       P+H A Q GH ++V LL+S + +  + +++ LTP+H A   G+ ++  VL+ ++  V    +    P+H AC +G++ +VK L+    N+ A TK  ++PL  A+Q+G + IV LL
Sbjct:  588 CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLL 744          

HSP 5 Score: 107.457 bits (267), Expect = 2.432e-37
Identity = 58/153 (37.91%), Postives = 81/153 (52.94%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + KLLL       A   NG  P+H AC   ++ +++LL+ +   +DA + +G  P+H ASF GH  IVK LL +
Sbjct:  265 TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK 417          

HSP 6 Score: 69.3218 bits (168), Expect = 2.432e-37
Identity = 36/155 (23.23%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            + K  V    +D    +H A   GH  +V +LL      +        P+H   + GH +  +LL+  +       +   TP+H A  YG   +  +LL          K    P+H A +  HL+IV++L+++  +     +  ++PL +A ++
Sbjct:  449 QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQ 603          

HSP 7 Score: 83.1889 bits (204), Expect = 1.501e-32
Identity = 58/234 (24.79%), Postives = 106/234 (45.30%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHYLCKSSLESKQFQEGEFIGSGSFGRAFKYKLPQ-NNKEIVIKYTEIDSESKYIERNINK 1255
             +H A    HLNIV +LL +    +   +N   P+H A +    +  + L+ +      +    +TP+H A   G+ D++T+LL     V +G+K    P+H A   GHL+I ++L+S + ++ A T+  ++PL +A   G  ++V+ L   L+ +   + V +LG       +     + + +   + G      S   A     PQ  N+   + + E   E   +  NI K
Sbjct:  563 PLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL---LQHQANVNAVTKLGFTPLHQAAQQ-GHTDIVTLLLKNGACPNQASMVSALTLSPPQLANERHRMSFPETMDEPMDVSPNIPK 792          

HSP 8 Score: 77.7962 bits (190), Expect = 1.501e-32
Identity = 45/154 (29.22%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFD---RCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+      +P+ F      P+H A +  H +V   LI     +    KD + P+H A ++ H E+V+LLL++  + +     G  P+H     G+ +  +LL+ NQ    + +  G  P+H A+ YG  +I ++LL
Sbjct:  397 TPLHVASFMGHLPIVKTLLQKG---ASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 547          

HSP 9 Score: 98.5969 bits (244), Expect = 3.026e-32
Identity = 51/162 (31.48%), Postives = 87/162 (53.70%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH A+Q  H+D V LLL++   I+        P+H A   GH  V +LL+ +G        +   P+H AC+ +H+ +++LLLKS  +++A  ++GL P+H A F G++ IVK L+      +  S+    P+H A+   H ++   L+  +  +  + K
Sbjct:  298 SPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAK 459          

HSP 10 Score: 61.6178 bits (148), Expect = 3.026e-32
Identity = 44/182 (24.18%), Postives = 74/182 (40.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLIN---------------NFKVEVGDKDDGR------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H     GH    E+LL       +  K    P+H A + G  +I +LL+  +       +  LTP+H A ++ + +++ +LL                 +  V+    D  R                  P+H A   GH  +V +L+S+  N+    K + +PL LASQ+G   I E+L
Sbjct:  497 PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVL 678          

HSP 11 Score: 83.9593 bits (206), Expect = 3.117e-30
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y+   +    + LTP+H A   G+  V  +LL    K      +   P+H AC   H+ ++++L+    +I+A T+   +PL +AS  G   IV+ L
Sbjct:  261 KDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTL 414          

HSP 12 Score: 69.3218 bits (168), Expect = 3.117e-30
Identity = 47/186 (25.27%), Postives = 81/186 (43.55%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H +++ GHV  V+ LL  +  +E   K     +H A   G  +VVR L++ G ++    +    P++ A Q NH+ +VK LL++  N   + ++G  P+  A   G+  +V  LIS                             N    D  S TG  P+H A+ Y +  + ++LL+   N+  
Sbjct:   40 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNF 225          

HSP 13 Score: 78.9518 bits (193), Expect = 5.961e-29
Identity = 46/176 (26.14%), Postives = 79/176 (44.89%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
             IH A    HL+ V +LL     I+    ++  P+H A   GH  + KLL+        R  N  TP+H AC   +  VM +LL +   ++   +    P+H A F GHL IVK L+ +  +    + +  +PL +A++   + + + L     +    +  ++  + C     HY
Sbjct:  299 PIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHY 474          

HSP 14 Score: 69.707 bits (169), Expect = 5.961e-29
Identity = 54/193 (27.98%), Postives = 84/193 (43.52%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H+  V  LL++  N  +   D F   P+  A Q GH NVV  LIS G                              + ++  K    P+H A    ++ + +LLL    N+  + +NG+  +H A   GNV +V+LL+     +DA +     P+H A   GH  I +ILL     I+ + K
Sbjct:  104 TPLYMAAQENHLPVVKFLLENGANQNLATEDGF--TPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK 294          

HSP 15 Score: 99.7525 bits (247), Expect = 7.293e-21
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   VD    LL+      A       P+H A Q GH ++V LL+S+  ++ + +K    P+H A Q  H+ I ++L+    ++ A  + G  P+H AC +GN+++VK L+ +Q  ++A +  G  P+H A+  GH +IV +LL
Sbjct:  595 TPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 745          

HSP 16 Score: 96.2857 bits (238), Expect = 6.723e-20
Identity = 47/132 (35.61%), Postives = 73/132 (55.30%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGS 405
            +P+H AAQ GH D V+LLL     +   +K    P+H A Q GHLN+  +L+S   S+    +    P+H AC   ++++VK LL+ + N+ A  K G  P+H A   G+ +IV LL+ N  C +  S+  +
Sbjct:  628 TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMVSA 759          

HSP 17 Score: 92.0485 bits (227), Expect = 1.437e-18
Identity = 49/163 (30.06%), Postives = 82/163 (50.31%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             +P+H   + GH     LLL +  A  +  K    P+H A + G + +  LL+          K    P+H A  +NH+ IV+LLL    +   + +NG  P+H A    +V+  + L+      +A+SL G  P+H A+  GH ++V +LLS++ N+ L +K
Sbjct:  495 HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNK 657          

HSP 18 Score: 90.1225 bits (222), Expect = 7.256e-18
Identity = 55/196 (28.06%), Postives = 94/196 (47.96%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKD---------KRK------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H AA+ G +    LLL+      +  K    P+H A  + HLN+VRLL+++G S     ++         K++                        P+H A Q  H ++V LLL  + N+   +K+ L P+H A   G++ I ++L+S+   + AE+  G  P+H A  YG+ ++VK LL  + N+    K+
Sbjct:  529 TPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL 724          

HSP 19 Score: 89.7373 bits (221), Expect = 8.921e-18
Identity = 45/154 (29.22%), Postives = 80/154 (51.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P+H A +  H+  + LLLK   +I+A  +    P+H A   GHL +V+ L+ +G S  +       P+H A +  H ++   L+++K  + A  K+   P+H A   G+ E+V+LL+ N    D  +  G  P+H  +  GH +  ++LL  +
Sbjct:  364 TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQ 517          

HSP 20 Score: 58.9214 bits (141), Expect = 9.882e-18
Identity = 39/149 (26.17%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N ++ +H A   G   ++ +LL    +++   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +ASQ      V LL
Sbjct:  167 ALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLL 315          

HSP 21 Score: 51.9878 bits (123), Expect = 9.882e-18
Identity = 33/147 (22.45%), Postives = 68/147 (46.26%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA+ G++D     L++   I   ++     +H + + GH+ +V  L+ +   +E   K     +H A      ++V+ L+    N+ +  + G  P++ A    ++ +VK L+ N    +  +  G  P+  A   GH+ +V  L+S
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 156          

HSP 22 Score: 80.4925 bits (197), Expect = 6.773e-15
Identity = 45/154 (29.22%), Postives = 82/154 (53.25%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            Q+   A+H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL     ++    D   P+H A   GH  + K+L+ +     A     ++PL +A +K   +++ELL
Sbjct:  228 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELL 381          

HSP 23 Score: 77.7962 bits (190), Expect = 4.427e-14
Identity = 41/149 (27.52%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GHL IV+ LL +    N        P+H A +  H ++   L+  K     R ++  TP+H A   G+++++ +LL N    +        P+H     GH    ++L+       + TK+ ++PL +A++ G  QI ELL
Sbjct:  398 PLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELL 546          

HSP 24 Score: 68.9366 bits (167), Expect = 2.533e-11
Identity = 40/151 (26.49%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H A    +LN+ ++LL +   +N   +N    +H A + G+  +V+LL+      +   +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+    +I+  T ++ +PL +A+  G  ++ +LL D
Sbjct:  200 PLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLD 350          

HSP 25 Score: 67.3958 bits (163), Expect = 6.885e-11
Identity = 33/97 (34.02%), Postives = 55/97 (56.70%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKS-KCNLEAS 291
            S +P+H A+Q GH++   +L+ H+ ++ A  +    P+H AC  G++ VV+ L+    ++    K    P+H A Q  H +IV LLLK+  C  +AS
Sbjct:  659 SLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQAS 755          

HSP 26 Score: 67.3958 bits (163), Expect = 7.248e-11
Identity = 38/149 (25.50%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A    H ++ + L+    ++NA  K+ + P+H A ++GH E+V+LL+      +       TP+H     G+     +LL N        K    P+H A  +G + I ++L+ +  +  +  K   +PL +A       IV LL
Sbjct:  431 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLL 579          

HSP 27 Score: 65.0846 bits (157), Expect = 3.736e-10
Identity = 50/190 (26.32%), Postives = 79/190 (41.58%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q     ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L+SY    +VR                      D N         TP+H A  Y   +V  +LL     V    ++    +H A   G++ +V++L+ +   I+ACTK+  +PL  A + G  +I E+L D
Sbjct:   95 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 284          

HSP 28 Score: 59.3066 bits (142), Expect = 2.027e-8
Identity = 41/180 (22.78%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  L+     +N+  +    P++ A Q  H  +VK L+    ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L++ ++L+++  N+    +   S L +AS++G   +V LL D
Sbjct:   72 ALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLD 251          

HSP 29 Score: 53.1434 bits (126), Expect = 1.553e-6
Identity = 38/153 (24.84%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            D+  +   A   G+L+     L    +IN  ++N    +H + + GH ++V  L+      E   +   T +H A   G  DV+  L+ +   V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V  L
Sbjct:    2 DAATSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 154          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 96.6709 bits (239), Expect = 1.311e-39
Identity = 45/156 (28.85%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+  H D    L+++   + A  K D+ P+H A ++GH  +VRLL+  G   +        P+H   +  H +  +LLL ++    +  K G  P+H A  +G ++I +LL+  +   ++   TG  P+H A ++ H  IV++LL++
Sbjct:  394 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNK 549          

HSP 2 Score: 88.1965 bits (217), Expect = 1.311e-39
Identity = 47/157 (29.94%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  533 CYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            C  ++    +H A  +  ++    LL      NA       P+H A Q GH ++V LL+S + +  + +++ LTP+H A   G+ ++  VL+ ++  V    +    P+H AC +G++ +VK L+    N+ A TK  ++PL  A+Q+G + IV LL
Sbjct:  555 CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLL 711          

HSP 3 Score: 96.6709 bits (239), Expect = 3.744e-39
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL     +    +     +H A + G++ +VRLL+  G  I+ C KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+  Q  +D  +L    P+H A+  GH  + K+LL +
Sbjct:  166 TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDK 318          

HSP 4 Score: 86.6557 bits (213), Expect = 3.744e-39
Identity = 49/150 (32.67%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC + H+ ++E+LL     I+A  ++   P+H A   GH  IVK L+       V      TP+H A    + DV   L+ N  KV    KDD  P+H A   GH  +V++L+    + +  T    +PL L ++ G +Q  ELL D
Sbjct:  333 LHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD 482          

HSP 5 Score: 108.997 bits (271), Expect = 2.474e-36
Identity = 58/153 (37.91%), Postives = 81/153 (52.94%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + KLLL       A   NG  P+H AC   ++ +++LL+ +   +DA + +G  P+H ASF GH  IVK LL +
Sbjct:  232 TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK 384          

HSP 6 Score: 64.6994 bits (156), Expect = 2.474e-36
Identity = 36/155 (23.23%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            + K  V    +D    +H A   GH  +V +LL      +        P+H   + GH +  +LL+  +       +   TP+H A  YG   +  +LL          K    P+H A +  HL+IV++L+++  +     +  ++PL +A ++
Sbjct:  416 QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQ 570          

HSP 7 Score: 82.0333 bits (201), Expect = 1.574e-32
Identity = 43/148 (29.05%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLNIV +LL +    +   +N   P+H A +    +  + L+ +      +    +TP+H A   G+ D++T+LL     V +G+K    P+H A   GHL+I ++L+S + ++ A T+  ++PL +A   G  ++V+ L
Sbjct:  531 LHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL 678          

HSP 8 Score: 78.9518 bits (193), Expect = 1.574e-32
Identity = 45/154 (29.22%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFD---RCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+      +P+ F      P+H A +  H +V   LI     +    KD + P+H A ++ H E+V+LLL++  + +     G  P+H     G+ +  +LL+ NQ    + +  G  P+H A+ YG  +I ++LL
Sbjct:  364 TPLHVASFMGHLPIVKTLLQKG---ASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 514          

HSP 9 Score: 99.7525 bits (247), Expect = 5.516e-32
Identity = 51/162 (31.48%), Postives = 87/162 (53.70%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH A+Q  H+D V LLL++   I+        P+H A   GH  V +LL+ +G        +   P+H AC+ +H+ +++LLLKS  +++A  ++GL P+H A F G++ IVK L+      +  S+    P+H A+   H ++   L+  +  +  + K
Sbjct:  265 SPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAK 426          

HSP 10 Score: 59.3066 bits (142), Expect = 5.516e-32
Identity = 44/181 (24.31%), Postives = 74/181 (40.88%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLIN---------------NFKVEVGDKDDGR------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H     GH    E+LL       +  K    P+H A + G  +I +LL+  +       +  LTP+H A ++ + +++ +LL                 +  V+    D  R                  P+H A   GH  +V +L+S+  N+    K + +PL LASQ+G   I E+L
Sbjct:  465 LHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVL 645          

HSP 11 Score: 83.5741 bits (205), Expect = 1.851e-30
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y+   +    + LTP+H A   G+  V  +LL    K      +   P+H AC   H+ ++++L+    +I+A T+   +PL +AS  G   IV+ L
Sbjct:  228 KDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTL 381          

HSP 12 Score: 70.4774 bits (171), Expect = 1.851e-30
Identity = 47/186 (25.27%), Postives = 81/186 (43.55%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H +++ GHV  V+ LL  +  +E   K     +H A   G  +VVR L++ G ++    +    P++ A Q NH+ +VK LL++  N   + ++G  P+  A   G+  +V  LIS                             N    D  S TG  P+H A+ Y +  + ++LL+   N+  
Sbjct:    7 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNF 192          

HSP 13 Score: 77.0258 bits (188), Expect = 9.595e-29
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    HL+ V +LL     I+    ++  P+H A   GH  + KLL+        R  N  TP+H AC   +  VM +LL +   ++   +    P+H A F GHL IVK L+ +  +    + +  +PL +A++   + + + L
Sbjct:  267 IHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFL 414          

HSP 14 Score: 71.2478 bits (173), Expect = 9.595e-29
Identity = 54/193 (27.98%), Postives = 84/193 (43.52%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H+  V  LL++  N  +   D F   P+  A Q GH NVV  LIS G                              + ++  K    P+H A    ++ + +LLL    N+  + +NG+  +H A   GNV +V+LL+     +DA +     P+H A   GH  I +ILL     I+ + K
Sbjct:   71 TPLYMAAQENHLPVVKFLLENGANQNLATEDGF--TPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK 261          

HSP 15 Score: 106.301 bits (264), Expect = 6.681e-23
Identity = 52/150 (34.67%), Postives = 81/150 (54.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H AAQ GH D V+LLL     +   +K    P+H A Q GHLN+  +L+S   S+    +    P+H AC   ++++VK LL+ + N+ A  K G  P+H A   G+ +IV LL+ N  C +  S+ G  P+  A   G+  +  +L
Sbjct:  595 TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 744          

HSP 16 Score: 100.908 bits (250), Expect = 2.749e-21
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   VD    LL+      A       P+H A Q GH ++V LL+S+  ++ + +K    P+H A Q  H+ I ++L+    ++ A  + G  P+H AC +GN+++VK L+ +Q  ++A +  G  P+H A+  GH +IV +LL
Sbjct:  562 TPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 712          

HSP 17 Score: 93.5893 bits (231), Expect = 6.112e-19
Identity = 49/163 (30.06%), Postives = 82/163 (50.31%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             +P+H   + GH     LLL +  A  +  K    P+H A + G + +  LL+          K    P+H A  +NH+ IV+LLL    +   + +NG  P+H A    +V+  + L+      +A+SL G  P+H A+  GH ++V +LLS++ N+ L +K
Sbjct:  462 HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNK 624          

HSP 18 Score: 91.6633 bits (226), Expect = 2.509e-18
Identity = 55/196 (28.06%), Postives = 94/196 (47.96%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKD---------KRK------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H AA+ G +    LLL+      +  K    P+H A  + HLN+VRLL+++G S     ++         K++                        P+H A Q  H ++V LLL  + N+   +K+ L P+H A   G++ I ++L+S+   + AE+  G  P+H A  YG+ ++VK LL  + N+    K+
Sbjct:  496 TPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL 691          

HSP 19 Score: 90.8929 bits (224), Expect = 3.633e-18
Identity = 45/154 (29.22%), Postives = 80/154 (51.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P+H A +  H+  + LLLK   +I+A  +    P+H A   GHL +V+ L+ +G S  +       P+H A +  H ++   L+++K  + A  K+   P+H A   G+ E+V+LL+ N    D  +  G  P+H  +  GH +  ++LL  +
Sbjct:  331 TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQ 484          

HSP 20 Score: 64.6994 bits (156), Expect = 3.259e-15
Identity = 48/179 (26.82%), Postives = 77/179 (43.02%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L+SY    +VR                      D N         TP+H A  Y   +V  +LL     V    ++    +H A   G++ +V++L+ +   I+ACTK+  +PL  A + G  +I E+L D
Sbjct:   73 LYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 251          

HSP 21 Score: 38.1206 bits (87), Expect = 3.259e-15
Identity = 17/66 (25.76%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  298 NGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            NGL  +H +   G+V++V  L+     L+  +  G+  +H A+  G +++V+ L++   N+  Q +
Sbjct:    2 NGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQ 67          

HSP 22 Score: 80.8777 bits (198), Expect = 4.566e-15
Identity = 45/154 (29.22%), Postives = 82/154 (53.25%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            Q+   A+H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL     ++    D   P+H A   GH  + K+L+ +     A     ++PL +A +K   +++ELL
Sbjct:  195 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELL 348          

HSP 23 Score: 78.1814 bits (191), Expect = 3.059e-14
Identity = 43/149 (28.86%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H A   GH ++V +LL++   ++  +K+   P+H A Q GH  I ++LVS+             P+H AC YG   V+  LL +   V    K    P+H A   GH  IV +L+         +    +PL +A + G+  + ++LS
Sbjct:  597 LHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLS 745          

HSP 24 Score: 74.7146 bits (182), Expect = 4.344e-13
Identity = 36/119 (30.25%), Postives = 63/119 (52.94%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLL 360
            S +P+H A+Q GH++   +L+ H+ ++ A  +    P+H AC  G++ VV+ L+    ++    K    P+H A Q  H +IV LLLK+      +  NG+ P+  A   G + +  +L
Sbjct:  626 SLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 744          

HSP 25 Score: 72.7886 bits (177), Expect = 1.553e-12
Identity = 41/148 (27.70%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHL IV+ LL +    N        P+H A +  H ++   L+  K     R ++  TP+H A   G+++++ +LL N    +        P+H     GH    ++L+       + TK+ ++PL +A++ G  QI ELL
Sbjct:  366 LHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELL 513          

HSP 26 Score: 69.3218 bits (168), Expect = 1.820e-11
Identity = 40/150 (26.67%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +LN+ ++LL +   +N   +N    +H A + G+  +V+LL+      +   +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+    +I+  T ++ +PL +A+  G  ++ +LL D
Sbjct:  168 LHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLD 317          

HSP 27 Score: 63.1586 bits (152), Expect = 1.463e-9
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H ++ + L+    ++NA  K+ + P+H A ++GH E+V+LL+      +       TP+H     G+     +LL N        K    P+H A  +G + I ++L+ +  +  +  K   +PL +A       IV LL
Sbjct:  399 LHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLL 546          

HSP 28 Score: 57.7658 bits (138), Expect = 5.917e-8
Identity = 41/180 (22.78%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  L+     +N+  +    P++ A Q  H  +VK L+    ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L++ ++L+++  N+    +   S L +AS++G   +V LL D
Sbjct:   39 ALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLD 218          

HSP 29 Score: 56.9954 bits (136), Expect = 1.012e-7
Identity = 39/149 (26.17%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N ++ +H A   G   ++ +LL    +++   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +ASQ      V LL
Sbjct:  134 ALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLL 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 96.2857 bits (238), Expect = 1.471e-39
Identity = 45/156 (28.85%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+  H D    L+++   + A  K D+ P+H A ++GH  +VRLL+  G   +        P+H   +  H +  +LLL ++    +  K G  P+H A  +G ++I +LL+  +   ++   TG  P+H A ++ H  IV++LL++
Sbjct:  432 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNK 587          

HSP 2 Score: 88.1965 bits (217), Expect = 1.471e-39
Identity = 47/157 (29.94%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  533 CYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            C  ++    +H A  +  ++    LL      NA       P+H A Q GH ++V LL+S + +  + +++ LTP+H A   G+ ++  VL+ ++  V    +    P+H AC +G++ +VK L+    N+ A TK  ++PL  A+Q+G + IV LL
Sbjct:  593 CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLL 749          

HSP 3 Score: 96.2857 bits (238), Expect = 4.100e-39
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL     +    +     +H A + G++ +VRLL+  G  I+ C KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+  Q  +D  +L    P+H A+  GH  + K+LL +
Sbjct:  204 TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDK 356          

HSP 4 Score: 86.6557 bits (213), Expect = 4.100e-39
Identity = 49/150 (32.67%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC + H+ ++E+LL     I+A  ++   P+H A   GH  IVK L+       V      TP+H A    + DV   L+ N  KV    KDD  P+H A   GH  +V++L+    + +  T    +PL L ++ G +Q  ELL D
Sbjct:  371 LHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD 520          

HSP 5 Score: 108.997 bits (271), Expect = 2.823e-36
Identity = 58/153 (37.91%), Postives = 81/153 (52.94%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A +NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + KLLL       A   NG  P+H AC   ++ +++LL+ +   +DA + +G  P+H ASF GH  IVK LL +
Sbjct:  270 TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK 422          

HSP 6 Score: 64.6994 bits (156), Expect = 2.823e-36
Identity = 36/155 (23.23%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            + K  V    +D    +H A   GH  +V +LL      +        P+H   + GH +  +LL+  +       +   TP+H A  YG   +  +LL          K    P+H A +  HL+IV++L+++  +     +  ++PL +A ++
Sbjct:  454 QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQ 608          

HSP 7 Score: 82.0333 bits (201), Expect = 1.738e-32
Identity = 43/148 (29.05%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLNIV +LL +    +   +N   P+H A +    +  + L+ +      +    +TP+H A   G+ D++T+LL     V +G+K    P+H A   GHL+I ++L+S + ++ A T+  ++PL +A   G  ++V+ L
Sbjct:  569 LHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL 716          

HSP 8 Score: 78.9518 bits (193), Expect = 1.738e-32
Identity = 45/154 (29.22%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFD---RCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+      +P+ F      P+H A +  H +V   LI     +    KD + P+H A ++ H E+V+LLL++  + +     G  P+H     G+ +  +LL+ NQ    + +  G  P+H A+ YG  +I ++LL
Sbjct:  402 TPLHVASFMGHLPIVKTLLQKG---ASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 552          

HSP 9 Score: 99.7525 bits (247), Expect = 6.089e-32
Identity = 51/162 (31.48%), Postives = 87/162 (53.70%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH A+Q  H+D V LLL++   I+        P+H A   GH  V +LL+ +G        +   P+H AC+ +H+ +++LLLKS  +++A  ++GL P+H A F G++ IVK L+      +  S+    P+H A+   H ++   L+  +  +  + K
Sbjct:  303 SPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAK 464          

HSP 10 Score: 59.3066 bits (142), Expect = 6.089e-32
Identity = 44/181 (24.31%), Postives = 74/181 (40.88%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLIN---------------NFKVEVGDKDDGR------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H     GH    E+LL       +  K    P+H A + G  +I +LL+  +       +  LTP+H A ++ + +++ +LL                 +  V+    D  R                  P+H A   GH  +V +L+S+  N+    K + +PL LASQ+G   I E+L
Sbjct:  503 LHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVL 683          

HSP 11 Score: 83.5741 bits (205), Expect = 1.945e-30
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y+   +    + LTP+H A   G+  V  +LL    K      +   P+H AC   H+ ++++L+    +I+A T+   +PL +AS  G   IV+ L
Sbjct:  266 KDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTL 419          

HSP 12 Score: 70.0922 bits (170), Expect = 1.945e-30
Identity = 47/186 (25.27%), Postives = 81/186 (43.55%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H +++ GHV  V+ LL  +  +E   K     +H A   G  +VVR L++ G ++    +    P++ A Q NH+ +VK LL++  N   + ++G  P+  A   G+  +V  LIS                             N    D  S TG  P+H A+ Y +  + ++LL+   N+  
Sbjct:   45 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNF 230          

HSP 13 Score: 77.0258 bits (188), Expect = 1.033e-28
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    HL+ V +LL     I+    ++  P+H A   GH  + KLL+        R  N  TP+H AC   +  VM +LL +   ++   +    P+H A F GHL IVK L+ +  +    + +  +PL +A++   + + + L
Sbjct:  305 IHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFL 452          

HSP 14 Score: 70.8626 bits (172), Expect = 1.033e-28
Identity = 54/193 (27.98%), Postives = 84/193 (43.52%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H+  V  LL++  N  +   D F   P+  A Q GH NVV  LIS G                              + ++  K    P+H A    ++ + +LLL    N+  + +NG+  +H A   GNV +V+LL+     +DA +     P+H A   GH  I +ILL     I+ + K
Sbjct:  109 TPLYMAAQENHLPVVKFLLENGANQNLATEDGF--TPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK 299          

HSP 15 Score: 105.916 bits (263), Expect = 7.432e-23
Identity = 52/150 (34.67%), Postives = 81/150 (54.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H AAQ GH D V+LLL     +   +K    P+H A Q GHLN+  +L+S   S+    +    P+H AC   ++++VK LL+ + N+ A  K G  P+H A   G+ +IV LL+ N  C +  S+ G  P+  A   G+  +  +L
Sbjct:  633 TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 782          

HSP 16 Score: 100.908 bits (250), Expect = 3.137e-21
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   VD    LL+      A       P+H A Q GH ++V LL+S+  ++ + +K    P+H A Q  H+ I ++L+    ++ A  + G  P+H AC +GN+++VK L+ +Q  ++A +  G  P+H A+  GH +IV +LL
Sbjct:  600 TPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 750          

HSP 17 Score: 93.2041 bits (230), Expect = 6.792e-19
Identity = 49/163 (30.06%), Postives = 82/163 (50.31%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             +P+H   + GH     LLL +  A  +  K    P+H A + G + +  LL+          K    P+H A  +NH+ IV+LLL    +   + +NG  P+H A    +V+  + L+      +A+SL G  P+H A+  GH ++V +LLS++ N+ L +K
Sbjct:  500 HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNK 662          

HSP 18 Score: 91.2781 bits (225), Expect = 2.837e-18
Identity = 55/196 (28.06%), Postives = 94/196 (47.96%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKD---------KRK------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H AA+ G +    LLL+      +  K    P+H A  + HLN+VRLL+++G S     ++         K++                        P+H A Q  H ++V LLL  + N+   +K+ L P+H A   G++ I ++L+S+   + AE+  G  P+H A  YG+ ++VK LL  + N+    K+
Sbjct:  534 TPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL 729          

HSP 19 Score: 90.8929 bits (224), Expect = 3.968e-18
Identity = 45/154 (29.22%), Postives = 80/154 (51.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P+H A +  H+  + LLLK   +I+A  +    P+H A   GHL +V+ L+ +G S  +       P+H A +  H ++   L+++K  + A  K+   P+H A   G+ E+V+LL+ N    D  +  G  P+H  +  GH +  ++LL  +
Sbjct:  369 TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQ 522          

HSP 20 Score: 56.9954 bits (136), Expect = 2.446e-17
Identity = 39/149 (26.17%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N ++ +H A   G   ++ +LL    +++   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +ASQ      V LL
Sbjct:  172 ALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLL 320          

HSP 21 Score: 52.7582 bits (125), Expect = 2.446e-17
Identity = 33/147 (22.45%), Postives = 68/147 (46.26%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA+ G++D     L++   I   ++     +H + + GH+ +V  L+ +   +E   K     +H A      ++V+ L+    N+ +  + G  P++ A    ++ +VK L+ N    +  +  G  P+  A   GH+ +V  L+S
Sbjct:   15 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 161          

HSP 22 Score: 80.8777 bits (198), Expect = 4.574e-15
Identity = 45/154 (29.22%), Postives = 82/154 (53.25%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            Q+   A+H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL     ++    D   P+H A   GH  + K+L+ +     A     ++PL +A +K   +++ELL
Sbjct:  233 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELL 386          

HSP 23 Score: 78.1814 bits (191), Expect = 3.064e-14
Identity = 43/149 (28.86%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H A   GH ++V +LL++   ++  +K+   P+H A Q GH  I ++LVS+             P+H AC YG   V+  LL +   V    K    P+H A   GH  IV +L+         +    +PL +A + G+  + ++LS
Sbjct:  635 LHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLS 783          

HSP 24 Score: 74.3294 bits (181), Expect = 4.659e-13
Identity = 36/119 (30.25%), Postives = 63/119 (52.94%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLL 360
            S +P+H A+Q GH++   +L+ H+ ++ A  +    P+H AC  G++ VV+ L+    ++    K    P+H A Q  H +IV LLLK+      +  NG+ P+  A   G + +  +L
Sbjct:  664 SLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 782          

HSP 25 Score: 72.7886 bits (177), Expect = 1.556e-12
Identity = 41/148 (27.70%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHL IV+ LL +    N        P+H A +  H ++   L+  K     R ++  TP+H A   G+++++ +LL N    +        P+H     GH    ++L+       + TK+ ++PL +A++ G  QI ELL
Sbjct:  404 LHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELL 551          

HSP 26 Score: 69.3218 bits (168), Expect = 1.823e-11
Identity = 40/150 (26.67%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +LN+ ++LL +   +N   +N    +H A + G+  +V+LL+      +   +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+    +I+  T ++ +PL +A+  G  ++ +LL D
Sbjct:  206 LHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLD 355          

HSP 27 Score: 64.6994 bits (156), Expect = 5.265e-10
Identity = 48/179 (26.82%), Postives = 77/179 (43.02%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L+SY    +VR                      D N         TP+H A  Y   +V  +LL     V    ++    +H A   G++ +V++L+ +   I+ACTK+  +PL  A + G  +I E+L D
Sbjct:  111 LYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 289          

HSP 28 Score: 63.1586 bits (152), Expect = 1.465e-9
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H ++ + L+    ++NA  K+ + P+H A ++GH E+V+LL+      +       TP+H     G+     +LL N        K    P+H A  +G + I ++L+ +  +  +  K   +PL +A       IV LL
Sbjct:  437 LHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLL 584          

HSP 29 Score: 57.7658 bits (138), Expect = 5.924e-8
Identity = 41/180 (22.78%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  L+     +N+  +    P++ A Q  H  +VK L+    ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L++ ++L+++  N+    +   S L +AS++G   +V LL D
Sbjct:   77 ALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLD 256          

HSP 30 Score: 53.1434 bits (126), Expect = 1.741e-6
Identity = 38/153 (24.84%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            D+  +   A   G+L+     L    +IN  ++N    +H + + GH ++V  L+      E   +   T +H A   G  DV+  L+ +   V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V  L
Sbjct:    7 DAATSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 159          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 100.908 bits (250), Expect = 5.555e-37
Identity = 55/156 (35.26%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+V+  +LLL    A++   +    P+H A + G+ N+V+LL+  G  I+   +D   P+H A ++ H ++V+LLL+ K  L A  KNGL P+H A    +VE VK L+  +  +D  +L     +H A+  GH  + K+LL +R N
Sbjct:  231 TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN 386          

HSP 2 Score: 74.3294 bits (181), Expect = 5.555e-37
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+L+     I A  ++   PIH A   GH  IV LL+      +V +    T +H A   G  +V+  LL N   V+   +++  P+H A   G   IV++L+    + +A T   ++PL +++++G   +  +L
Sbjct:  398 LHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 545          

HSP 3 Score: 90.1225 bits (222), Expect = 3.562e-36
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   N   P+H AC+    ++++LLV Y    +   E+ LTPIH A F G+ +++ +LL N    +V +      +H A   G + +V+ L+     ++A  +E  +PL +AS+ G ++IV+LL
Sbjct:  364 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 512          

HSP 4 Score: 82.4185 bits (202), Expect = 3.562e-36
Identity = 48/164 (29.27%), Postives = 88/164 (53.66%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLK--HNNAIEAPDKFDRC------PIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     + +LLL+  HN  +++    +R       P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H A   G+ ++V+LL+  +  L A +  G  P+H A+   H E VK LL  +  ++
Sbjct:  192 LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 355          

HSP 5 Score: 92.0485 bits (227), Expect = 9.066e-35
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   V LLL+    + A  K    P+H A Q  H+  V+ L+     ++    D    +H A    H  + KLLL  + N  A   NG  P+H AC    +++++LL+     + A + +G  PIH A+F GH  IV +LL
Sbjct:  297 TPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLL 447          

HSP 6 Score: 75.8702 bits (185), Expect = 9.066e-35
Identity = 41/149 (27.52%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G + +V  LL     ++A  +  + P+H A + G  EIV+LL+ +    +    N  TP+H +   G  DV +VLL       +  K    P+H A  +G L + K+L+ +    ++  K   +PL +A+     ++  LL
Sbjct:  463 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLL 611          

HSP 7 Score: 82.8037 bits (203), Expect = 1.843e-32
Identity = 39/156 (25.00%), Postives = 83/156 (53.21%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA+ G V+ V  LL++   ++A  + ++ P+H A + G   +V+LL+      +    +   P+H + +   V++  +LL++      + K G  P+H A  +G++++ KLL+  +   D+    G  P+H A+ Y + ++  +LL +
Sbjct:  459 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 614          

HSP 8 Score: 77.411 bits (189), Expect = 1.843e-32
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    E N   K    P+H A Q GH ++V LL+    +  +  ++ LT +H A      +V  +L  +    +   K    P+  AC +G++ +V  L+ Q  N+ A TK  ++PL  A+Q+G + I+ +L
Sbjct:  629 LHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 776          

HSP 9 Score: 82.4185 bits (202), Expect = 5.291e-31
Identity = 43/153 (28.10%), Postives = 79/153 (51.63%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            Q+P+H A++ G  + V LLL+H    +A       P+H + + G ++V  +L+  G +  +  K    P+H A +   +++ KLLL+ +   +++ KNGL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL+
Sbjct:  494 QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 646          

HSP 10 Score: 72.7886 bits (177), Expect = 5.291e-31
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH ++V +LL +   I+ + K+    +H A Q     +  +L  +  D++   +   TP+  AC YG   ++  LL     V    K+   P+H A   GH HI+ +L+       A T    + L +A + G+  +V+ L
Sbjct:  662 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 809          

HSP 11 Score: 87.8113 bits (216), Expect = 6.292e-31
Identity = 46/151 (30.46%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  + LL+K+  +I+A  +    PIH A   GHLN+V LL+  G S ++ +      +H A +   VE+V+ LL++   ++A  +    P+H A   G  EIV+LL+ +    DA +  G  P+H ++  G  ++  +LL
Sbjct:  396 TPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 546          

HSP 12 Score: 67.0106 bits (162), Expect = 6.292e-31
Identity = 38/149 (25.50%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H A   G L++ ++LL +    ++A KN   P+H A    + ++  LL+          +N  TP+H A       + + LL    +     K    P+H A   GH  +V +L+ +  NI   TK   + L LA+Q+    + ++L+
Sbjct:  563 LHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT 711          

HSP 13 Score: 75.485 bits (184), Expect = 9.921e-27
Identity = 44/162 (27.16%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVV 501
            +H AA+ GHV  V  LL   +++++  K     +H A   G   VV++L+ EG +I    ++   P++ A Q NH+++VK LL++  N   + ++G  P+  A   G+ + V +L+ N    D +       +H A+     +   +LL    N ++Q K++
Sbjct:   64 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMM 221          

HSP 14 Score: 65.4698 bits (158), Expect = 9.921e-27
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H A   G+  V+ +LL     +    K+   P+H A    H+  VK L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  233 LHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD 382          

HSP 15 Score: 85.8853 bits (211), Expect = 2.140e-23
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H +A+ G VD  S+LL+   A     K    P+H A + G L+V +LL+    + +   K+   P+H A   ++ ++  LLL+   +  A+ KNG  P+H A     ++I   L++     +  +  G  P+H AS  GH ++V +LL +  NI +  K
Sbjct:  528 TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK 689          

HSP 16 Score: 43.5134 bits (101), Expect = 2.140e-23
Identity = 26/116 (22.41%), Postives = 52/116 (44.83%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            ++H A     +N+ ++L     + +A  K    P+  AC  G+ ++V  L+    +   + +N  TP+H A   G+  ++ VLL +  K      +    +  A   G++ +V  L
Sbjct:  694 SLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 809          

HSP 17 Score: 90.5077 bits (223), Expect = 3.149e-18
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +   S LL +        K    P+H A Q GH ++V LL+ +G +I +  K     +H A Q + V +  +L K   + +A  K G  P+  AC +GNV++V  L+     ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  627 TPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 777          

HSP 18 Score: 87.4261 bits (215), Expect = 3.283e-17
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH++ V LLL++  + +  +      +H A + G + VVR L+  G  ++   ++++ P+H A +    EIV+LLL+   + +A+  NG  P+H +   G V++  +L+         +  G  P+H A+ YG  ++ K+LL  R
Sbjct:  429 TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRR 582          

HSP 19 Score: 80.1073 bits (196), Expect = 5.674e-15
Identity = 46/150 (30.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q GH D V+LLL     I    K     +H A Q   +NV  +L   G   +   K    P+  AC   +V++V  LLK   N+ A  KNG  P+H A   G+  I+ +L+ +    +A +  G+  +  A   G+  +V  L
Sbjct:  660 TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 809          

HSP 20 Score: 78.1814 bits (191), Expect = 2.005e-14
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDK--DDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H A ++GH ++V+LL+  K     R +N L+P+H A    + + +  LL   +K  V D   D    +H A   GH  + K+L+ +  N  A     ++PL +A +K   +++ELL
Sbjct:  266 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL--QYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 413          

HSP 21 Score: 76.6406 bits (187), Expect = 6.667e-14
Identity = 45/162 (27.78%), Postives = 73/162 (45.06%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL+   +  A  K    P+H A +   + +   L++ G       K    P+H A Q  H ++V LLL    N+  S K+GL  +H A     V +  +L  +    DA +  G  P+  A  YG+ ++V  LL +  N+  + K
Sbjct:  594 TPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK 755          

HSP 22 Score: 75.485 bits (184), Expect = 1.698e-13
Identity = 52/193 (26.94%), Postives = 85/193 (44.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI--------CDKDKRK-----------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P++ AAQ  H+D V  LL++  N +    D F   P+  A Q GH   V +L+      ++          KD  K                             P+H A    +V +  LLL     ++ + +NG+ P+H A   GN  +VKLL+     +DA++  G  P+H A+  GHD++V++LL  +
Sbjct:  128 TPLYMAAQENHIDVVKYLLENGANQSTATEDGF--TPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERK 318          

HSP 23 Score: 74.7146 bits (182), Expect = 2.585e-13
Identity = 46/159 (28.93%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H A   GH  +VE+LL +   + A  KN   P+H A Q  H E VK L+ YK   +    + LT +H A   G++ V  +LL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV LL
Sbjct:  288 IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL 446          

HSP 24 Score: 74.7146 bits (182), Expect = 2.793e-13
Identity = 42/150 (28.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H +   G +++  +LL      + A K    P+H A + G  ++ KLL+  +   +   +N LTP+H A  Y    V  +LL          K+   P+H A     + I   L++        TK+  +PL LASQ+G + +V LL D
Sbjct:  530 LHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLD 679          

HSP 25 Score: 74.3294 bits (181), Expect = 3.675e-13
Identity = 39/159 (24.53%), Postives = 71/159 (44.65%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            V    ++    +H A   G   IV++LL      +AA  N   P+H + + G  ++  +L+       +  +   TP+H A  YG  DV  +LL      +   K+   P+H A  + +  +  +L+ +  +  A  K  ++PL +A++K   QI   L
Sbjct:  486 VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTL 644          

HSP 26 Score: 73.9442 bits (180), Expect = 4.961e-13
Identity = 43/146 (29.45%), Postives = 73/146 (50.00%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G++D V   LK    I   ++     +H A + GH+ +V+ L+  G S++   K     +H A      E+VK+L+K   N+ A  +NG  P++ A    ++++VK L+ N       +  G  P+  A   GH++ V ILL
Sbjct:   34 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL 179          

HSP 27 Score: 73.1738 bits (178), Expect = 7.486e-13
Identity = 52/208 (25.00%), Postives = 89/208 (42.79%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR-------------------------------------DENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRK 1024
            KE   +    Q+    ++ A    H+++V+ LL      + A ++   P+  A Q GH + V +L+      +VR                                      E+  TP+H A  YG  +V T+LL     V+   ++   P+H A   G+ ++VK+L+ +   I+A T++  +PL  A++ G  Q+VELL   L RK
Sbjct:  114 KEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL---LERK 318          

HSP 28 Score: 71.633 bits (174), Expect = 2.730e-12
Identity = 39/139 (28.06%), Postives = 66/139 (47.48%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFAS 426
            +P+H AA+ G +D   LLL+   A ++  K    P+H A    +  V  LL+ +G S     K+   P+H A + N ++I   LL          K G+ P+H A   G+ ++V LL+     +   + +G   +H A+
Sbjct:  561 TPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAA 699          

HSP 29 Score: 70.4774 bits (171), Expect = 5.953e-12
Identity = 42/175 (24.00%), Postives = 79/175 (45.14%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            IH A   GHLNIV +LL      +  +      +H A + G  E+V+ L+      + R   + TP+H A   G  +++ +LL +    +    +   P+H +   G + +  +L+         TK+ ++PL +A++ G   + +LL   L+R+       + G+      +HY
Sbjct:  431 IHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL---LQRRAAADSAGKNGLTPLHVAAHY 602          

HSP 30 Score: 65.855 bits (159), Expect = 1.377e-10
Identity = 47/186 (25.27%), Postives = 82/186 (44.09%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL-----SDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            Q+   A+H A   GH+ +V+ LL +   +++A K     +H A   G  E+VK+LV    +   + +N  TP++ A    + DV+  LL N        +D   P+  A   GH   V IL+  +       K     L +A++K  ++   LL     +  ++ K++ +   E G       +HY
Sbjct:   58 QNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHY 239          

HSP 31 Score: 63.1586 bits (152), Expect = 9.434e-10
Identity = 34/118 (28.81%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A + G+L+ V   +  G  I  C+++    +H A +  HV +V+ LL    +++++ K G   +H A   G  E+VK+L+     ++A+S  G  P++ A+   H ++VK LL    N
Sbjct:   34 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 151          

HSP 32 Score: 63.1586 bits (152), Expect = 9.846e-10
Identity = 39/158 (24.68%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  530 KCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    DS  +   A   G+L+ V   L    +IN  ++N    +H A + GH  +V+ L+      +   +   T +H A   G  +V+ VL+     +    ++   P++ A    H+ +VK L+    N    T++ ++PL +A Q+G +Q V +L
Sbjct:   21 RIRQSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAIL 178          

HSP 33 Score: 60.8474 bits (146), Expect = 5.629e-9
Identity = 30/106 (28.30%), Postives = 55/106 (51.89%), Query Frame = 2
Query:  656 PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    +++   +D   P+H A   GH  +V++L+ +   + A TK   SPL +A+Q
Sbjct:  232 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQ 337          

HSP 34 Score: 51.2174 bits (121), Expect = 5.246e-6
Identity = 27/91 (29.67%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  +++ V   LK   ++   ++NGL  +H A   G+V +V+ L+     +D+ +  G+  +H AS  G  E+VK+L+ E  NI  Q +
Sbjct:   34 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQ 124          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 95.5153 bits (236), Expect = 6.109e-37
Identity = 49/151 (32.45%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H  A++GH   V +LL  +  I +  K    P+H A Q  HLN V+LL+     ++    D    +H A    H ++ K+LL  K +  A   NG  P+H AC    + +++LL+ +   + A + +G  PIH A+F GH  IV  L+
Sbjct:  297 TPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 447          

HSP 2 Score: 79.7221 bits (195), Expect = 6.109e-37
Identity = 41/159 (25.79%), Postives = 74/159 (46.54%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            V+   +D    +H +   G  +IV+ LL Q    NAA  +   P+H A + GH ++   L+ +     +  +   TP+H A  YG  +V ++LL  +   +   K    P+H A  + +  +  +L+ Q  +  A  K  ++PL +A++K    I   L
Sbjct:  486 VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSL 644          

HSP 3 Score: 89.7373 bits (221), Expect = 3.058e-36
Identity = 45/156 (28.85%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+++  +LLL    A++   + D  P+H A + G+ N+V+LL+  G  I+   +D   P+H   ++ H ++V++LL     + +  KNGL P+H A    ++  V+LL+ +   +D  +      +H A+  GH ++ K+LL ++ +
Sbjct:  231 TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS 386          

HSP 4 Score: 82.8037 bits (203), Expect = 3.058e-36
Identity = 44/150 (29.33%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC +  + ++E+LL     I A  ++   PIH A   GH  IV  L+ +       +    T +H A   G  +V+  L+ +  +VE   KDD  P+H +   G   IV+ L+ Q  +  A T   ++PL LA+++G   +   L D
Sbjct:  398 LHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLD 547          

HSP 5 Score: 90.5077 bits (223), Expect = 6.812e-36
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA++G  + V  L++    +EA  K D+ P+H + + G  ++V+ L+ +G S          P+H A +  H ++   LL    +L  + K G  P+H A  +G +E+  LL+      DA   +G  P+H A+ Y + ++  +LL +
Sbjct:  459 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 614          

HSP 6 Score: 81.2629 bits (199), Expect = 6.812e-36
Identity = 42/148 (28.38%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  ++I   LL    + NA  +     +H A Q GH ++V LL+S   +  + +++ LTP+H A      +V  VL+     V+   K    P+H  C +G++ IV  L+  +  + A TK  ++ L  A+Q+G + I+ +L
Sbjct:  629 LHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVL 776          

HSP 7 Score: 84.7297 bits (208), Expect = 7.224e-35
Identity = 57/227 (25.11%), Postives = 104/227 (45.81%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSL--------VEELGIQCFDGCSHYLCKSSLESKQFQEGEFIGSGS------FGRAFKYKLPQNNKEI 1195
            ++H A   GH+++V +LL+++  +N ++K+   P+H A Q     + ++LV+     + + +   TP+H  C YG   ++  LL ++ KV    K+    +H A   GH HI+ +L+  N +    T    + L +A + G+  +V+ L       +  +         V E   +  D     + K+S   K   +GE+I  G        G   KY  PQ+ KE+
Sbjct:  661 SVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEVRKASAPEK-LSDGEYISDGEEGEDAITGDTDKYLGPQDLKEL 886          

HSP 8 Score: 83.5741 bits (205), Expect = 7.224e-35
Identity = 46/152 (30.26%), Postives = 75/152 (49.34%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            Q+P+H +A+ G  D V  LL+   +  A       P+H A + GH +V   L+  G S+ I  K    P+H A +   +E+  LLL+   + +A+ K+GL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL
Sbjct:  494 QTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL 645          

HSP 9 Score: 88.1965 bits (217), Expect = 1.582e-32
Identity = 45/162 (27.78%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  + LLLKH  +I+A  +    PIH A   GH+N+V  L+  G S    +      +H A ++   E+V+ L++    +EA  K+   P+H +   G  +IV+ L+      +A + +G  P+H A+  GH+++   LL    ++ +  K
Sbjct:  396 TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTK 557          

HSP 10 Score: 72.0182 bits (175), Expect = 1.582e-32
Identity = 39/148 (26.35%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +  +  +LL Q    +AA KN   P+H A +    +I   L+ Y  D        +  +H A   G+ D++++LL  N  V + +K    P+H A     +++ ++L++Q  +++A TK  ++PL +    G  +IV  L
Sbjct:  596 LHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL 743          

HSP 11 Score: 78.9518 bits (193), Expect = 3.292e-31
Identity = 46/186 (24.73%), Postives = 86/186 (46.24%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVK-----------------------------LLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H A++ GHV+ VS LL+    ++A  K     +H A   G   VV++L++ G ++    ++   P++ A Q NH+E+V+ LL +  +   + ++G  P+  A   G+ ++V                              LL+ N    D ES +G  P+H A+ YG+  +  +LL+    ++ 
Sbjct:   72 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF 257          

HSP 12 Score: 77.0258 bits (188), Expect = 3.292e-31
Identity = 40/148 (27.03%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H   ++GH ++V++L+        + +N L+P+H A    + + + +LL +N  V+    D    +H A   GH  + K+L+ +  +  A     ++PL +A +K   +++ELL
Sbjct:  266 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 413          

HSP 13 Score: 77.7962 bits (190), Expect = 6.526e-31
Identity = 47/194 (24.23%), Postives = 84/194 (43.30%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVK-----------------------------LLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +  + +H A+  G  + V +L+ +   + A  +    P++ A Q  HL VVR L+  G S  +  +D   P+  A Q  H ++V                              LLL++  N +   K+G  P+H A  +GN+ +  LL++    +D  +     P+H AS  G+  +VK+LL     I+ + +
Sbjct:  100 KGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR 293          

HSP 14 Score: 77.0258 bits (188), Expect = 6.526e-31
Identity = 41/148 (27.70%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLN V++LL  +  ++    +Y   +H A   GH ++ K+L+  K     +  N  TP+H AC      VM +LL +   ++   +    PIH A F GH++IV  L+    +         + L +A++ G +++V  L
Sbjct:  332 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYL 479          

HSP 15 Score: 73.9442 bits (180), Expect = 2.157e-26
Identity = 48/186 (25.81%), Postives = 81/186 (43.55%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIE---------------------APDKFDR------------CPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            SP+H A Q  H++ V LLL+HN  ++                     A    D+             P+H AC+   + V+ LL+  G SI+   +    PIH A    HV IV  L+    +   ++  G   +H A   G  E+V+ L+ +   ++A++     P+H ++  G  +IV+ LL +
Sbjct:  330 SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ 515          

HSP 16 Score: 65.855 bits (159), Expect = 2.157e-26
Identity = 38/148 (25.68%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH ++   LL     ++   K    P+H A + G  E+  LL+      +   ++ LTP+H A  Y    V  +LL          K+   P+H A     + I   L+    +  A T++  + + LA+Q+G   +V LL
Sbjct:  530 LHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 677          

HSP 17 Score: 69.3218 bits (168), Expect = 5.078e-26
Identity = 38/146 (26.03%), Postives = 72/146 (49.32%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ GH++     +K+   +   ++     +H A + GH+ VV  L+    +++   K     +H A      E+VK+L+ +  N+ A  +NG  P++ A    ++E+V+ L+ N       +  G  P+  A   GHD++V +LL
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 187          

HSP 18 Score: 68.9366 bits (167), Expect = 5.078e-26
Identity = 39/149 (26.17%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A  +       +LL      +   K+   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    K++   +D   P+H     GH  +V++L+ ++  I + TK   SPL +A+Q      V+LL
Sbjct:  199 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLL 347          

HSP 19 Score: 78.1814 bits (191), Expect = 2.199e-24
Identity = 51/190 (26.84%), Postives = 85/190 (44.74%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q+    ++ A    HL +V  LL      + A ++   P+  A Q GH ++V LL+      +VR          D+ K                    TP+H A  YG  +V T+LL     V+   ++D  P+H A   G+ ++VK+L+ +   I+A T++  +PL   ++ G  Q+VE+L D
Sbjct:  127 VNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLD 316          

HSP 20 Score: 54.6842 bits (130), Expect = 2.199e-24
Identity = 27/91 (29.67%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  H+E     +K+  ++   ++NGL  +H A   G+VE+V  L+  +  +DA +  G+  +H AS  G  E+VK+L++   N+  Q +
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQ 132          

HSP 21 Score: 95.9005 bits (237), Expect = 7.900e-20
Identity = 44/151 (29.14%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +D  + LL++     A  +     +H A Q GH+++V LL+S   ++ + +K    P+H A Q + V + ++L+    +++A  K G  P+H  C +GN++IV  L+ +   ++A++  G   +H A+  GH  I+ +LL
Sbjct:  627 TPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 777          

HSP 22 Score: 90.8929 bits (224), Expect = 3.238e-18
Identity = 46/150 (30.67%), Postives = 76/150 (50.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            + +H AAQ GHVD VSLLL  N  +   +K    P+H A Q   +NV  +L+++G  ++   K    P+H  C   +++IV  LL+    + A  KNG   +H A   G+  I+ +L+ N    +  ++ G+  +  A   G+  +V  L
Sbjct:  660 ASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 809          

HSP 23 Score: 87.8113 bits (216), Expect = 2.422e-17
Identity = 46/153 (30.07%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +PIH AA  GHV+ VS L+ H  +    +      +H A ++G   VVR L+ +G  +E   KD + P+H + +    +IV+ LL+   +  A+  +G  P+H A   G+ ++   L+ +   L   +  G  P+H A+ YG  E+  +LL +
Sbjct:  429 TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQK 581          

HSP 24 Score: 87.8113 bits (216), Expect = 2.507e-17
Identity = 49/162 (30.25%), Postives = 80/162 (49.38%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA+ GH D  + LL H  ++    K    P+H A + G L V  LL+ +  S +   K    P+H A   ++ ++  LLL    +  A+ KNG  P+H A     ++I   L+      +A +  G   +H A+  GH ++V +LLS   N+ L +K
Sbjct:  528 TPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 689          

HSP 25 Score: 84.3445 bits (207), Expect = 3.212e-16
Identity = 45/162 (27.78%), Postives = 76/162 (46.91%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL    +  A  K    P+H A +   +++   L+  G       +     +H A Q  HV++V LLL    N+  S+K+GL P+H A     V + ++L++    +DA++  G  P+H    YG+ +IV  LL     +  + K
Sbjct:  594 TPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTK 755          

HSP 26 Score: 82.8037 bits (203), Expect = 8.255e-16
Identity = 44/163 (26.99%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H AA+ G ++  SLLL+ + + +A  K    P+H A    +  V  LL+ +G S     K+   P+H A + N ++I   LL+   +  A  + G+  +H A   G+V++V LL+S    ++  + +G  P+H A+      + ++L+++  +++ Q K+
Sbjct:  561 TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKM 723          

HSP 27 Score: 80.4925 bits (197), Expect = 4.996e-15
Identity = 42/159 (26.42%), Postives = 84/159 (52.83%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+     A +LLL+++   +   K    P+H A   G++NV  LL++   +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H     G+ ++V++L+     + +++  G  P+H A+   H   V++LL    N+ + D
Sbjct:  200 LHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDD 356          

HSP 28 Score: 77.7962 bits (190), Expect = 3.740e-14
Identity = 38/113 (33.63%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            A + GHL      I  G  + IC+++    +H A +  HVE+V  LL+ + N++A+ K G   +H A   G  E+VK+L++N   ++A+S  G  P++ A+   H E+V+ LL
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 154          

HSP 29 Score: 75.8702 bits (185), Expect = 1.148e-13
Identity = 43/175 (24.57%), Postives = 76/175 (43.43%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            IH A   GH+NIV  L+      N  +      +H A ++G  E+V+ LV      E + ++  TP+H +   G  D++  LL               P+H A   GH  +   L+    ++   TK+ ++PL +A++ G  ++  LL   L++        + G+      +HY
Sbjct:  431 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLL---LQKSASPDAAGKSGLTPLHVAAHY 602          

HSP 30 Score: 74.3294 bits (181), Expect = 4.397e-13
Identity = 44/159 (27.67%), Postives = 74/159 (46.54%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H     GH  +VEMLL +S  I +  KN   P+H A Q  H   V+LL+ +    +    + LT +H A   G++ V  VLL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV  L
Sbjct:  288 IDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQL 446          

HSP 31 Score: 72.4034 bits (176), Expect = 1.519e-12
Identity = 43/169 (25.44%), Postives = 81/169 (47.93%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGR----AIHYACCR-GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            ++ D+  CY + S +    A +    R GHL      +    ++N  ++N    +H A + GH E+V  L+  + + +   +   T +H A   G  +V+ VL+ N   V    ++   P++ A    HL +V+ L+    +    T++ ++PL +A Q+G  Q+V LL
Sbjct:   18 EQGDFGSCYSRSSQKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLL 186          

HSP 32 Score: 72.0182 bits (175), Expect = 1.964e-12
Identity = 38/151 (25.17%), Postives = 71/151 (47.02%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+    ++ A  K+ + P+H + + G  +IV+ L+           +  TP+H A   G+ DV   LL +   + +  K    P+H A  +G L +  +L+ ++ + +A  K   +PL +A+     ++  LL D
Sbjct:  463 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLD 613          

HSP 33 Score: 70.8626 bits (172), Expect = 4.984e-12
Identity = 38/150 (25.33%), Postives = 78/150 (52.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL ++  ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H     G+  V+ +LL  +  +    K+   P+H A    HL+ V++L+  N  ++  T +  + L +A+  G  ++ ++L D
Sbjct:  233 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD 382          

HSP 34 Score: 68.5514 bits (166), Expect = 2.076e-11
Identity = 46/172 (26.74%), Postives = 79/172 (45.93%), Query Frame = 2
Query:  506 IEKEKDYVKCYY------QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +EK  DY+K         Q+   A+H A   GH+ +V  LL +   ++AA K     +H A   G  E+VK+LV+   +   + +N  TP++ A    + +V+  LL N     +  +D   P+  A   GH  +V +L+  +       K     L +A++K  ++   LL
Sbjct:   48 LEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKAAALL 215          

HSP 35 Score: 60.4622 bits (145), Expect = 8.217e-9
Identity = 34/133 (25.56%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  611 AQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++S + + A+ +Y R    A + GH E     +    D  + ++N L  +H A   G+ +V++ LL     V+   K     +H A   G   +VK+L++   N+ A ++  ++PL +A+Q+   ++V  L D
Sbjct:   27 SRSSQKSDANASYLR----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLD 155          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 100.908 bits (250), Expect = 8.266e-37
Identity = 55/156 (35.26%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+V+  +LLL    A++   +    P+H A + G+ N+V+LL+  G  I+   +D   P+H A ++ H ++V+LLL+ K  L A  KNGL P+H A    +VE VK L+  +  +D  +L     +H A+  GH  + K+LL +R N
Sbjct:  214 TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN 369          

HSP 2 Score: 73.9442 bits (180), Expect = 8.266e-37
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+L+     I A  ++   PIH A   GH  IV LL+      +V +    T +H A   G  +V+  LL N   V+   +++  P+H A   G   IV++L+    + +A T   ++PL +++++G   +  +L
Sbjct:  381 LHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 528          

HSP 3 Score: 89.7373 bits (221), Expect = 5.003e-36
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   N   P+H AC+    ++++LLV Y    +   E+ LTPIH A F G+ +++ +LL N    +V +      +H A   G + +V+ L+     ++A  +E  +PL +AS+ G ++IV+LL
Sbjct:  347 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 495          

HSP 4 Score: 82.4185 bits (202), Expect = 5.003e-36
Identity = 48/164 (29.27%), Postives = 88/164 (53.66%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLK--HNNAIEAPDKFDRC------PIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     + +LLL+  HN  +++    +R       P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H A   G+ ++V+LL+  +  L A +  G  P+H A+   H E VK LL  +  ++
Sbjct:  175 LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 338          

HSP 5 Score: 91.6633 bits (226), Expect = 1.232e-34
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   V LLL+    + A  K    P+H A Q  H+  V+ L+     ++    D    +H A    H  + KLLL  + N  A   NG  P+H AC    +++++LL+     + A + +G  PIH A+F GH  IV +LL
Sbjct:  280 TPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLL 430          

HSP 6 Score: 75.485 bits (184), Expect = 1.232e-34
Identity = 41/149 (27.52%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G + +V  LL     ++A  +  + P+H A + G  EIV+LL+ +    +    N  TP+H +   G  DV +VLL       +  K    P+H A  +G L + K+L+ +    ++  K   +PL +A+     ++  LL
Sbjct:  446 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLL 594          

HSP 7 Score: 82.4185 bits (202), Expect = 2.176e-32
Identity = 39/156 (25.00%), Postives = 83/156 (53.21%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA+ G V+ V  LL++   ++A  + ++ P+H A + G   +V+LL+      +    +   P+H + +   V++  +LL++      + K G  P+H A  +G++++ KLL+  +   D+    G  P+H A+ Y + ++  +LL +
Sbjct:  442 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 597          

HSP 8 Score: 77.411 bits (189), Expect = 2.176e-32
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    E N   K    P+H A Q GH ++V LL+    +  +  ++ LT +H A      +V  +L  +    +   K    P+  AC +G++ +V  L+ Q  N+ A TK  ++PL  A+Q+G + I+ +L
Sbjct:  612 LHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 759          

HSP 9 Score: 82.0333 bits (201), Expect = 6.045e-31
Identity = 43/153 (28.10%), Postives = 79/153 (51.63%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            Q+P+H A++ G  + V LLL+H    +A       P+H + + G ++V  +L+  G +  +  K    P+H A +   +++ KLLL+ +   +++ KNGL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL+
Sbjct:  477 QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 629          

HSP 10 Score: 72.7886 bits (177), Expect = 6.045e-31
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH ++V +LL +   I+ + K+    +H A Q     +  +L  +  D++   +   TP+  AC YG   ++  LL     V    K+   P+H A   GH HI+ +L+       A T    + L +A + G+  +V+ L
Sbjct:  645 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 11 Score: 87.4261 bits (215), Expect = 7.307e-31
Identity = 46/151 (30.46%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  + LL+K+  +I+A  +    PIH A   GHLN+V LL+  G S ++ +      +H A +   VE+V+ LL++   ++A  +    P+H A   G  EIV+LL+ +    DA +  G  P+H ++  G  ++  +LL
Sbjct:  379 TPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 529          

HSP 12 Score: 67.0106 bits (162), Expect = 7.307e-31
Identity = 38/149 (25.50%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H A   G L++ ++LL +    ++A KN   P+H A    + ++  LL+          +N  TP+H A       + + LL    +     K    P+H A   GH  +V +L+ +  NI   TK   + L LA+Q+    + ++L+
Sbjct:  546 LHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT 694          

HSP 13 Score: 75.0998 bits (183), Expect = 1.336e-26
Identity = 44/162 (27.16%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVV 501
            +H AA+ GHV  V  LL   +++++  K     +H A   G   VV++L+ EG +I    ++   P++ A Q NH+++VK LL++  N   + ++G  P+  A   G+ + V +L+ N    D +       +H A+     +   +LL    N ++Q K++
Sbjct:   47 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMM 204          

HSP 14 Score: 65.0846 bits (157), Expect = 1.336e-26
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H A   G+  V+ +LL     +    K+   P+H A    H+  VK L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  216 LHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD 365          

HSP 15 Score: 85.5001 bits (210), Expect = 3.051e-23
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H +A+ G VD  S+LL+   A     K    P+H A + G L+V +LL+    + +   K+   P+H A   ++ ++  LLL+   +  A+ KNG  P+H A     ++I   L++     +  +  G  P+H AS  GH ++V +LL +  NI +  K
Sbjct:  511 TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK 672          

HSP 16 Score: 43.5134 bits (101), Expect = 3.051e-23
Identity = 26/116 (22.41%), Postives = 52/116 (44.83%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            ++H A     +N+ ++L     + +A  K    P+  AC  G+ ++V  L+    +   + +N  TP+H A   G+  ++ VLL +  K      +    +  A   G++ +V  L
Sbjct:  677 SLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 17 Score: 90.1225 bits (222), Expect = 3.751e-18
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +   S LL +        K    P+H A Q GH ++V LL+ +G +I +  K     +H A Q + V +  +L K   + +A  K G  P+  AC +GNV++V  L+     ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  610 TPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 760          

HSP 18 Score: 87.0409 bits (214), Expect = 3.563e-17
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH++ V LLL++  + +  +      +H A + G + VVR L+  G  ++   ++++ P+H A +    EIV+LLL+   + +A+  NG  P+H +   G V++  +L+         +  G  P+H A+ YG  ++ K+LL  R
Sbjct:  412 TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRR 565          

HSP 19 Score: 79.7221 bits (195), Expect = 6.345e-15
Identity = 46/150 (30.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q GH D V+LLL     I    K     +H A Q   +NV  +L   G   +   K    P+  AC   +V++V  LLK   N+ A  KNG  P+H A   G+  I+ +L+ +    +A +  G+  +  A   G+  +V  L
Sbjct:  643 TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 20 Score: 78.1814 bits (191), Expect = 2.244e-14
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDK--DDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H A ++GH ++V+LL+  K     R +N L+P+H A    + + +  LL   +K  V D   D    +H A   GH  + K+L+ +  N  A     ++PL +A +K   +++ELL
Sbjct:  249 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL--QYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 396          

HSP 21 Score: 76.6406 bits (187), Expect = 7.407e-14
Identity = 45/162 (27.78%), Postives = 73/162 (45.06%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL+   +  A  K    P+H A +   + +   L++ G       K    P+H A Q  H ++V LLL    N+  S K+GL  +H A     V +  +L  +    DA +  G  P+  A  YG+ ++V  LL +  N+  + K
Sbjct:  577 TPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK 738          

HSP 22 Score: 75.0998 bits (183), Expect = 1.954e-13
Identity = 52/193 (26.94%), Postives = 85/193 (44.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI--------CDKDKRK-----------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P++ AAQ  H+D V  LL++  N +    D F   P+  A Q GH   V +L+      ++          KD  K                             P+H A    +V +  LLL     ++ + +NG+ P+H A   GN  +VKLL+     +DA++  G  P+H A+  GHD++V++LL  +
Sbjct:  111 TPLYMAAQENHIDVVKYLLENGANQSTATEDGF--TPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERK 301          

HSP 23 Score: 74.3294 bits (181), Expect = 3.027e-13
Identity = 46/159 (28.93%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H A   GH  +VE+LL +   + A  KN   P+H A Q  H E VK L+ YK   +    + LT +H A   G++ V  +LL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV LL
Sbjct:  271 IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL 429          

HSP 24 Score: 74.3294 bits (181), Expect = 3.080e-13
Identity = 42/150 (28.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H +   G +++  +LL      + A K    P+H A + G  ++ KLL+  +   +   +N LTP+H A  Y    V  +LL          K+   P+H A     + I   L++        TK+  +PL LASQ+G + +V LL D
Sbjct:  513 LHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLD 662          

HSP 25 Score: 73.9442 bits (180), Expect = 4.304e-13
Identity = 39/159 (24.53%), Postives = 71/159 (44.65%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            V    ++    +H A   G   IV++LL      +AA  N   P+H + + G  ++  +L+       +  +   TP+H A  YG  DV  +LL      +   K+   P+H A  + +  +  +L+ +  +  A  K  ++PL +A++K   QI   L
Sbjct:  469 VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTL 627          

HSP 26 Score: 73.559 bits (179), Expect = 5.520e-13
Identity = 43/146 (29.45%), Postives = 73/146 (50.00%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G++D V   LK    I   ++     +H A + GH+ +V+ L+  G S++   K     +H A      E+VK+L+K   N+ A  +NG  P++ A    ++++VK L+ N       +  G  P+  A   GH++ V ILL
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL 162          

HSP 27 Score: 73.1738 bits (178), Expect = 8.772e-13
Identity = 52/208 (25.00%), Postives = 89/208 (42.79%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR-------------------------------------DENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRK 1024
            KE   +    Q+    ++ A    H+++V+ LL      + A ++   P+  A Q GH + V +L+      +VR                                      E+  TP+H A  YG  +V T+LL     V+   ++   P+H A   G+ ++VK+L+ +   I+A T++  +PL  A++ G  Q+VELL   L RK
Sbjct:   97 KEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL---LERK 301          

HSP 28 Score: 71.2478 bits (173), Expect = 3.121e-12
Identity = 39/139 (28.06%), Postives = 66/139 (47.48%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFAS 426
            +P+H AA+ G +D   LLL+   A ++  K    P+H A    +  V  LL+ +G S     K+   P+H A + N ++I   LL          K G+ P+H A   G+ ++V LL+     +   + +G   +H A+
Sbjct:  544 TPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAA 682          

HSP 29 Score: 70.0922 bits (170), Expect = 7.047e-12
Identity = 42/175 (24.00%), Postives = 79/175 (45.14%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            IH A   GHLNIV +LL      +  +      +H A + G  E+V+ L+      + R   + TP+H A   G  +++ +LL +    +    +   P+H +   G + +  +L+         TK+ ++PL +A++ G   + +LL   L+R+       + G+      +HY
Sbjct:  414 IHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL---LQRRAAADSAGKNGLTPLHVAAHY 585          

HSP 30 Score: 65.855 bits (159), Expect = 1.593e-10
Identity = 47/186 (25.27%), Postives = 82/186 (44.09%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL-----SDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            Q+   A+H A   GH+ +V+ LL +   +++A K     +H A   G  E+VK+LV    +   + +N  TP++ A    + DV+  LL N        +D   P+  A   GH   V IL+  +       K     L +A++K  ++   LL     +  ++ K++ +   E G       +HY
Sbjct:   41 QNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHY 222          

HSP 31 Score: 63.1586 bits (152), Expect = 1.038e-9
Identity = 34/118 (28.81%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A + G+L+ V   +  G  I  C+++    +H A +  HV +V+ LL    +++++ K G   +H A   G  E+VK+L+     ++A+S  G  P++ A+   H ++VK LL    N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 134          

HSP 32 Score: 62.7734 bits (151), Expect = 1.200e-9
Identity = 39/153 (25.49%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            DS  +   A   G+L+ V   L    +IN  ++N    +H A + GH  +V+ L+      +   +   T +H A   G  +V+ VL+     +    ++   P++ A    H+ +VK L+    N    T++ ++PL +A Q+G +Q V +L
Sbjct:    9 DSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAIL 161          

HSP 33 Score: 60.4622 bits (145), Expect = 5.841e-9
Identity = 30/106 (28.30%), Postives = 55/106 (51.89%), Query Frame = 2
Query:  656 PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    +++   +D   P+H A   GH  +V++L+ +   + A TK   SPL +A+Q
Sbjct:  215 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQ 320          

HSP 34 Score: 50.8322 bits (120), Expect = 5.564e-6
Identity = 27/91 (29.67%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  +++ V   LK   ++   ++NGL  +H A   G+V +V+ L+     +D+ +  G+  +H AS  G  E+VK+L+ E  NI  Q +
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQ 107          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 86.6557 bits (213), Expect = 4.569e-36
Identity = 46/149 (30.87%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A  +  + +   LL      NA       P+H A Q GH E+V LL+S + +  + +++ LTP+H     G+  V  VL+ +   V+   +    P+H A  +G++ +VK L+    ++ A TK  +SPL  A+Q+G + IV LL
Sbjct:  202 PLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLL 350          

HSP 2 Score: 85.5001 bits (210), Expect = 4.569e-36
Identity = 47/152 (30.92%), Postives = 79/152 (51.97%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            ++P+H AA+ GH +    LL++     A  K D+ P+H A + GH  +V+LL+  G S  +       P+H A +  HV+    LL+ + +     K G  P+H A  +G V + +LL+ +    +A    G  P+H A  + + +IVK+LL
Sbjct:   35 ETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 186          

HSP 3 Score: 94.7449 bits (234), Expect = 1.134e-28
Identity = 52/162 (32.10%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA+ GHVD    LL+   +     K    P+H A + G + +  LL+          K+   P+H A  +N+++IVKLLL    +  +   NG  P+H A     +E+ + L+      +AES+ G  P+H A+  GH E+V +LLS++ N  L +K
Sbjct:  102 TPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNK 263          

HSP 4 Score: 52.7582 bits (125), Expect = 1.134e-28
Identity = 28/85 (32.94%), Postives = 40/85 (47.06%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLI 811
             +H A   G++ +V+ LL    ++NA  K    P+H A Q GH +IV LL+           N  TP+  A   GY  V  VL +
Sbjct:  301 PLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKV 385          

HSP 5 Score: 73.1738 bits (178), Expect = 2.371e-27
Identity = 38/149 (25.50%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A    +L+IV++LL +    ++   N   P+H A +    E+ + L+ Y           +TP+H A   G+ +++ +LL       +G+K    P+H     GH+ +  +LI     ++A T+  ++PL +AS  G  ++V+ L
Sbjct:  169 PLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFL 317          

HSP 6 Score: 69.707 bits (169), Expect = 2.371e-27
Identity = 43/154 (27.92%), Postives = 75/154 (48.70%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI---SNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+   +    +     P+H A + GH  V + L+          KD + P+H A +  H  +VKLLL++  +   +   G  P+H A   G+V+    L+   ++Q C+  +  T   P+H A+ YG   + ++LL
Sbjct:    3 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFT---PLHVAAKYGKVRLAELLL 153          

HSP 7 Score: 100.523 bits (249), Expect = 2.571e-21
Identity = 47/151 (31.13%), Postives = 85/151 (56.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   ++    LL++  +  A       P+H A Q GH  +V LL+S+  +  + +K    P+H   Q  HV +  +L+K    ++A+ + G  P+H A  +GN+++VK L+ +Q  ++A++  G  P+H A+  GH +IV +LL
Sbjct:  201 TPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL 351          

HSP 8 Score: 98.5969 bits (244), Expect = 8.733e-21
Identity = 51/163 (31.29%), Postives = 83/163 (50.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A  + ++D V LLL    +  +P      P+H A +   + V R L+  G S          P+H A Q  H E+V LLL  + N    +K+GL P+H     G+V +  +LI +   +DA +  G  P+H AS YG+ ++VK LL  + ++  + K+
Sbjct:  168 TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKL 330          

HSP 9 Score: 93.2041 bits (230), Expect = 4.447e-19
Identity = 49/165 (29.70%), Postives = 85/165 (51.52%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGH---DEIVKILLSERCNIELQDK 495
            +P+H AAQ GH + V+LLL         +K    P+H   Q GH+ V  +LI  G +++   +    P+H A    ++++VK LL+ + ++ A  K G  P+H A   G+ +IV LL+ N    +  S  G+ P+  A   G+    +++K++  E   + + DK
Sbjct:  234 TPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDK 398          

HSP 10 Score: 73.9442 bits (180), Expect = 3.963e-13
Identity = 42/149 (28.19%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GHL IV+ LL +    N ++     P+H A + GH E+ K L+  K     + ++  TP+H A   G+  ++ +LL N     +       P+H A   GH+     L+ +  +    TK+ ++PL +A++ G  ++ ELL
Sbjct:    4 PLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELL 152          

HSP 11 Score: 72.0182 bits (175), Expect = 1.618e-12
Identity = 38/149 (25.50%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GH  +V +LL++    N  +K+   P+H   Q GH  +  +L+ +    +       TP+H A  YG   ++  LL +   V    K    P+H A   GH  IV +L+    +    +    +PL +A + G+  + ++L
Sbjct:  235 PLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 383          

HSP 12 Score: 65.855 bits (159), Expect = 1.419e-10
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  109 CPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
             P+H A   GHL +V+ L+  G S  + +     P+H A +  H E+ K LL++K    A  K+   P+H A   G+  +VKLL+ N    +  +  G  P+H A+  GH +    LL +  +
Sbjct:    3 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS 125          

HSP 13 Score: 65.855 bits (159), Expect = 1.519e-10
Identity = 36/144 (25.00%), Postives = 66/144 (45.83%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            D    +H A   GH  +V++LL      N A      P+H A + GH +    L+  +  +    +   TP+H A  YG   +  +LL ++       K+   P+H A    +L IVK+L+ +  +  +     ++PL +A+++
Sbjct:   66 DDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQ 209          

HSP 14 Score: 60.8474 bits (146), Expect = 4.350e-9
Identity = 41/149 (27.52%), Postives = 66/149 (44.30%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GH  + + LL    + NA  K+ + P+H A + GH  +VKLL+       +      TP+H A   G+ D    LL          K    P+H A  +G + + ++L+  + +  A  K   +PL +A       IV+LL
Sbjct:   37 PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 185          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 102.064 bits (253), Expect = 5.185e-36
Identity = 55/156 (35.26%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+V+  +LLL    A++   +    P+H A + G+ N+V+LL+  G  I+   +D   P+H A ++ H ++V+LLL+ K  L A  KNGL P+H A    +VE VK L+  +  +D  +L     +H A+  GH  + K+LL +R N
Sbjct:  235 TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN 390          

HSP 2 Score: 70.0922 bits (170), Expect = 5.185e-36
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+L+     I A  ++   PIH A   GH  IV LL+      +V +    T +H A   G  +V+  LL N   V+   +++  P+H A   G   IV++L+    + +A T   ++PL +++++G   +  +L
Sbjct:  402 LHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 549          

HSP 3 Score: 86.6557 bits (213), Expect = 1.959e-35
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   N   P+H AC+    ++++LLV Y    +   E+ LTPIH A F G+ +++ +LL N    +V +      +H A   G + +V+ L+     ++A  +E  +PL +AS+ G ++IV+LL
Sbjct:  368 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 516          

HSP 4 Score: 83.1889 bits (204), Expect = 1.959e-35
Identity = 48/164 (29.27%), Postives = 88/164 (53.66%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLK--HNNAIEAPDKFDRC------PIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     + +LLL+  HN  +++    +R       P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H A   G+ ++V+LL+  +  L A +  G  P+H A+   H E VK LL  +  ++
Sbjct:  196 LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 359          

HSP 5 Score: 92.8189 bits (229), Expect = 3.668e-33
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   V LLL+    + A  K    P+H A Q  H+  V+ L+     ++    D    +H A    H  + KLLL  + N  A   NG  P+H AC    +++++LL+     + A + +G  PIH A+F GH  IV +LL
Sbjct:  301 TPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLL 451          

HSP 6 Score: 69.707 bits (169), Expect = 3.668e-33
Identity = 41/149 (27.52%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G + +V  LL     ++A  +  + P+H A + G  EIV+LL+ +    +    N  TP+H +   G  DV +VLL       +  K    P+H A  +G L + K+L+ +    ++  K   +PL +A+     ++  LL
Sbjct:  467 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLL 615          

HSP 7 Score: 83.5741 bits (205), Expect = 8.360e-32
Identity = 39/156 (25.00%), Postives = 83/156 (53.21%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA+ G V+ V  LL++   ++A  + ++ P+H A + G   +V+LL+      +    +   P+H + +   V++  +LL++      + K G  P+H A  +G++++ KLL+  +   D+    G  P+H A+ Y + ++  +LL +
Sbjct:  463 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 618          

HSP 8 Score: 74.3294 bits (181), Expect = 8.360e-32
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    E N   K    P+H A Q GH ++V LL+    +  +  ++ LT +H A      +V  +L  +    +   K    P+  AC +G++ +V  L+ Q  N+ A TK  ++PL  A+Q+G + I+ +L
Sbjct:  633 LHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 780          

HSP 9 Score: 83.1889 bits (204), Expect = 3.044e-30
Identity = 43/153 (28.10%), Postives = 79/153 (51.63%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            Q+P+H A++ G  + V LLL+H    +A       P+H + + G ++V  +L+  G +  +  K    P+H A +   +++ KLLL+ +   +++ KNGL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL+
Sbjct:  498 QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 650          

HSP 10 Score: 69.707 bits (169), Expect = 3.044e-30
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH ++V +LL +   I+ + K+    +H A Q     +  +L  +  D++   +   TP+  AC YG   ++  LL     V    K+   P+H A   GH HI+ +L+       A T    + L +A + G+  +V+ L
Sbjct:  666 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 11 Score: 88.5817 bits (218), Expect = 1.519e-29
Identity = 46/151 (30.46%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  + LL+K+  +I+A  +    PIH A   GHLN+V LL+  G S ++ +      +H A +   VE+V+ LL++   ++A  +    P+H A   G  EIV+LL+ +    DA +  G  P+H ++  G  ++  +LL
Sbjct:  400 TPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 550          

HSP 12 Score: 61.6178 bits (148), Expect = 1.519e-29
Identity = 38/149 (25.50%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H A   G L++ ++LL +    ++A KN   P+H A    + ++  LL+          +N  TP+H A       + + LL    +     K    P+H A   GH  +V +L+ +  NI   TK   + L LA+Q+    + ++L+
Sbjct:  567 LHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT 715          

HSP 13 Score: 76.2554 bits (186), Expect = 4.271e-28
Identity = 52/193 (26.94%), Postives = 85/193 (44.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI--------CDKDKRK-----------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P++ AAQ  H+D V  LL++  N +    D F   P+  A Q GH   V +L+      ++          KD  K                             P+H A    +V +  LLL     ++ + +NG+ P+H A   GN  +VKLL+     +DA++  G  P+H A+  GHD++V++LL  +
Sbjct:  132 TPLYMAAQENHIDVVKYLLENGANQSTATEDGF--TPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERK 322          

HSP 14 Score: 68.9366 bits (167), Expect = 4.271e-28
Identity = 40/148 (27.03%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H+  V+ LL     ++    +Y   +H A   GH  + KLL+  + +   R  N  TP+H AC      VM +L+     ++   +    PIH A F GHL+IV +L+    + +       + L +A++ G  ++V  L
Sbjct:  336 LHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL 483          

HSP 15 Score: 76.2554 bits (186), Expect = 5.870e-26
Identity = 44/162 (27.16%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVV 501
            +H AA+ GHV  V  LL   +++++  K     +H A   G   VV++L+ EG +I    ++   P++ A Q NH+++VK LL++  N   + ++G  P+  A   G+ + V +L+ N    D +       +H A+     +   +LL    N ++Q K++
Sbjct:   68 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMM 225          

HSP 16 Score: 62.003 bits (149), Expect = 5.870e-26
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H A   G+  V+ +LL     +    K+   P+H A    H+  VK L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  237 LHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD 386          

HSP 17 Score: 86.6557 bits (213), Expect = 5.103e-23
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H +A+ G VD  S+LL+   A     K    P+H A + G L+V +LL+    + +   K+   P+H A   ++ ++  LLL+   +  A+ KNG  P+H A     ++I   L++     +  +  G  P+H AS  GH ++V +LL +  NI +  K
Sbjct:  532 TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK 693          

HSP 18 Score: 41.5874 bits (96), Expect = 5.103e-23
Identity = 26/116 (22.41%), Postives = 52/116 (44.83%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            ++H A     +N+ ++L     + +A  K    P+  AC  G+ ++V  L+    +   + +N  TP+H A   G+  ++ VLL +  K      +    +  A   G++ +V  L
Sbjct:  698 SLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 19 Score: 91.2781 bits (225), Expect = 2.271e-18
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +   S LL +        K    P+H A Q GH ++V LL+ +G +I +  K     +H A Q + V +  +L K   + +A  K G  P+  AC +GNV++V  L+     ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  631 TPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 781          

HSP 20 Score: 88.1965 bits (217), Expect = 2.532e-17
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH++ V LLL++  + +  +      +H A + G + VVR L+  G  ++   ++++ P+H A +    EIV+LLL+   + +A+  NG  P+H +   G V++  +L+         +  G  P+H A+ YG  ++ K+LL  R
Sbjct:  433 TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRR 586          

HSP 21 Score: 80.8777 bits (198), Expect = 4.236e-15
Identity = 46/150 (30.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q GH D V+LLL     I    K     +H A Q   +NV  +L   G   +   K    P+  AC   +V++V  LLK   N+ A  KNG  P+H A   G+  I+ +L+ +    +A +  G+  +  A   G+  +V  L
Sbjct:  664 TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 22 Score: 77.411 bits (189), Expect = 5.005e-14
Identity = 45/162 (27.78%), Postives = 73/162 (45.06%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL+   +  A  K    P+H A +   + +   L++ G       K    P+H A Q  H ++V LLL    N+  S K+GL  +H A     V +  +L  +    DA +  G  P+  A  YG+ ++V  LL +  N+  + K
Sbjct:  598 TPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK 759          

HSP 23 Score: 75.0998 bits (183), Expect = 2.249e-13
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDK--DDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H A ++GH ++V+LL+  K     R +N L+P+H A    + + +  LL   +K  V D   D    +H A   GH  + K+L+ +  N  A     ++PL +A +K   +++ELL
Sbjct:  270 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL--QYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 417          

HSP 24 Score: 74.3294 bits (181), Expect = 4.052e-13
Identity = 43/146 (29.45%), Postives = 73/146 (50.00%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G++D V   LK    I   ++     +H A + GH+ +V+ L+  G S++   K     +H A      E+VK+L+K   N+ A  +NG  P++ A    ++++VK L+ N       +  G  P+  A   GH++ V ILL
Sbjct:   38 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL 183          

HSP 25 Score: 73.1738 bits (178), Expect = 8.733e-13
Identity = 46/154 (29.87%), Postives = 75/154 (48.70%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH  +VE+LL +   + A  KN   P+H A Q  H E VK L+ YK   +    + LT +H A   G++ V  +LL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV LL
Sbjct:  297 RDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL 450          

HSP 26 Score: 72.0182 bits (175), Expect = 2.157e-12
Identity = 39/139 (28.06%), Postives = 66/139 (47.48%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFAS 426
            +P+H AA+ G +D   LLL+   A ++  K    P+H A    +  V  LL+ +G S     K+   P+H A + N ++I   LL          K G+ P+H A   G+ ++V LL+     +   + +G   +H A+
Sbjct:  565 TPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAA 703          

HSP 27 Score: 68.5514 bits (166), Expect = 2.489e-11
Identity = 42/150 (28.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H +   G +++  +LL      + A K    P+H A + G  ++ KLL+  +   +   +N LTP+H A  Y    V  +LL          K+   P+H A     + I   L++        TK+  +PL LASQ+G + +V LL D
Sbjct:  534 LHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLD 683          

HSP 28 Score: 67.781 bits (164), Expect = 4.443e-11
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G   IV++LL      +AA  N   P+H + + G  ++  +L+       +  +   TP+H A  YG  DV  +LL      +   K+   P+H A  + +  +  +L+ +  +  A  K  ++PL +A++K   QI   L
Sbjct:  501 LHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTL 648          

HSP 29 Score: 67.3958 bits (163), Expect = 6.462e-11
Identity = 52/208 (25.00%), Postives = 89/208 (42.79%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR-------------------------------------DENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRK 1024
            KE   +    Q+    ++ A    H+++V+ LL      + A ++   P+  A Q GH + V +L+      +VR                                      E+  TP+H A  YG  +V T+LL     V+   ++   P+H A   G+ ++VK+L+ +   I+A T++  +PL  A++ G  Q+VELL   L RK
Sbjct:  118 KEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL---LERK 322          

HSP 30 Score: 63.929 bits (154), Expect = 7.695e-10
Identity = 34/118 (28.81%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A + G+L+ V   +  G  I  C+++    +H A +  HV +V+ LL    +++++ K G   +H A   G  E+VK+L+     ++A+S  G  P++ A+   H ++VK LL    N
Sbjct:   38 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 155          

HSP 31 Score: 62.7734 bits (151), Expect = 1.361e-9
Identity = 41/159 (25.79%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            IH A   GHLNIV +LL      +  +      +H A + G  E+V+ L+      + R   + TP+H A   G  +++ +LL +    +    +   P+H +   G + +  +L+         TK+ ++PL +A++ G   + +LL    RR   DS
Sbjct:  435 IHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ--RRAAADS 591          

HSP 32 Score: 61.2326 bits (147), Expect = 4.219e-9
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQN 916
            Q+   A+H A   GH+ +V+ LL +   +++A K     +H A   G  E+VK+LV    +   + +N  TP++ A    + DV+  LL N        +D   P+  A   GH   V IL+  +
Sbjct:   62 QNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 186          

HSP 33 Score: 60.077 bits (144), Expect = 9.225e-9
Identity = 39/153 (25.49%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            DS  +   A   G+L+ V   L    +IN  ++N    +H A + GH  +V+ L+      +   +   T +H A   G  +V+ VL+     +    ++   P++ A    H+ +VK L+    N    T++ ++PL +A Q+G +Q V +L
Sbjct:   30 DSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAIL 182          

HSP 34 Score: 55.4546 bits (132), Expect = 2.604e-7
Identity = 33/126 (26.19%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  626 INAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +N   ++   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    +++   +D   P+H A   GH  +V++L+ +   + A TK   SPL +A+Q    + V+ L
Sbjct:  226 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHL 351          

HSP 35 Score: 51.6026 bits (122), Expect = 4.329e-6
Identity = 27/91 (29.67%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  +++ V   LK   ++   ++NGL  +H A   G+V +V+ L+     +D+ +  G+  +H AS  G  E+VK+L+ E  NI  Q +
Sbjct:   38 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQ 128          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 95.9005 bits (237), Expect = 3.764e-39
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL    ++    +    P+H A + G++ +VRLL+  G  IE   KD+  P+H A +N HV I ++LL     ++A  KNGL PIH A    +++ V+LL+     +D  +L    P+H A+  GH  + K+LL +
Sbjct:  208 TPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK 360          

HSP 2 Score: 88.9669 bits (219), Expect = 3.764e-39
Identity = 49/145 (33.79%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            +H AC + H+ ++E+LL     I+A  ++   P+H A   GH  IVK L+       V +    TP+H A   G+ +V   LL N  KV    KDD  P+H A   GH ++VK+L+  N N    T    +PL +A+++G  + V
Sbjct:  375 LHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETV 519          

HSP 3 Score: 94.7449 bits (234), Expect = 4.111e-37
Identity = 48/154 (31.17%), Postives = 81/154 (52.60%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            + ++P+H AA+ GH +    LL++   + A  K D+ P+H A + GH N+V+LL+    +  +       P+H A +  HVE V  LL+ + +     K G  P+H A  +G V + +LL+      +A    G  P+H A  + + +IVK+LL
Sbjct:  436 KVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 589          

HSP 4 Score: 83.5741 bits (205), Expect = 4.111e-37
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + +   LL      NA       P+H A Q GH E+V LL+S + +  + +++ LTP+H     G+  V  VL+ +   V+   +    P+H A  +G++ +VK L+    ++ A TK  +SPL  A+Q+G + IV LL
Sbjct:  606 LHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLL 753          

HSP 5 Score: 107.842 bits (268), Expect = 1.420e-36
Identity = 58/151 (38.41%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV    +LL H   I+A  K    PIH A Q  HL+ VRLL+     I+    D   P+H A    H  + K+LL       +   NG  P+H AC   +V +++LL+     +DA + +G  P+H ASF GH  IVK LL
Sbjct:  274 TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL 424          

HSP 6 Score: 68.5514 bits (166), Expect = 1.420e-36
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL    ++NA  K+ + P+H A + GH  +VKLL+    +  +      TP+H A   G+ + +  LL          K    P+H A  +G + + ++L+ ++ +  A  K   +PL +A       IV+LL
Sbjct:  441 LHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 588          

HSP 7 Score: 82.0333 bits (201), Expect = 1.794e-31
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+N      ++LL+++   +   K    P+H A    +LNV +LL++ G S+    ++   P+H A +  +V +V+LLL     +E   K+ L P+H A  +G+V I ++L+ +   + A++  G  PIH A+   H + V++LL     I+
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID 332          

HSP 8 Score: 77.411 bits (189), Expect = 1.794e-31
Identity = 45/155 (29.03%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLL-------INNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + ++LL +  + N+   N   P+H AC+  H  +++LL+      +   E+ LTP+H A F G+  ++  LL       ++N KVE        P+H A   GH  + K L+     + A  K++ +PL  A++ G + +V+LL
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-------PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 489          

HSP 9 Score: 83.5741 bits (205), Expect = 1.303e-28
Identity = 54/156 (34.62%), Postives = 79/156 (50.64%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRD--ENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH+ I E+LL     I A  KN   PIH A Q  H + V+LL+ Y  D E+ D   + LTP+H A   G+  V  VLL    K      +   P+H AC   H+ ++++L+    +I+A T+   +PL +AS  G   IV+ L
Sbjct:  270 KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQY--DAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNL 423          

HSP 10 Score: 66.2402 bits (160), Expect = 1.303e-28
Identity = 46/186 (24.73%), Postives = 79/186 (42.47%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIV-----------------------------KLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H A++ GHV  V  LL     +E   K     +H A   G   VVR L++ G ++    +    P++ A Q NH+E+VK LL++  N   + ++G  P+  A   G+  +V                              +L+ N    D  S TG  P+H A+ Y +  + ++LL+   ++  
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNF 234          

HSP 11 Score: 77.411 bits (189), Expect = 2.804e-28
Identity = 44/148 (29.73%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A    HL+ V +LL    EI+    ++  P+H A   GH  + K+L+        R  N  TP+H AC   +  VM +LL     ++   +    P+H A F GHL IVK L+ +  +      +  +PL +A++ G +++ + L
Sbjct:  309 IHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 456          

HSP 12 Score: 71.2478 bits (173), Expect = 2.804e-28
Identity = 51/193 (26.42%), Postives = 87/193 (45.08%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H++ V  LL++  N  +   D F   P+  A Q GH NVV  LI+ G                              + ++  K    P+H A    ++ + +LLL    ++  + +NG+ P+H A   GNV +V+LL+     ++ ++     P+H A+  GH  I +ILL     I+ + K
Sbjct:  113 TPLYMAAQENHLEVVKFLLENGANQNVATEDGF--TPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTK 303          

HSP 13 Score: 78.5666 bits (192), Expect = 6.287e-28
Identity = 46/154 (29.87%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI---SNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A+  GH+  V  LL+   +    +     P+H A + GH  V + L+     +    KD + P+H A +  H  +VKLLL++  N   +   G  P+H A   G+VE V  L+   ++Q C+  +  T   P+H A+ YG   + ++LL
Sbjct:  406 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFT---PLHVAAKYGKVRVAELLL 556          

HSP 14 Score: 68.9366 bits (167), Expect = 6.287e-28
Identity = 38/148 (25.68%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +L+IV++LL +    ++   N   P+H A +    E+ + L+ Y           +TP+H A   G+ +++ +LL       +G+K    P+H     GH+ +  +LI     ++A T+  ++PL +AS  G  ++V+ L
Sbjct:  573 LHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL 720          

HSP 15 Score: 95.9005 bits (237), Expect = 3.696e-27
Identity = 62/196 (31.63%), Postives = 93/196 (47.45%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI----------------------SNQC-----------CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ GH + V LLL++N            P+H A + GH+  V  L+ +  S     K    P+H A +   V + +LLL+   +  A+ KNGL P+H A  H N++IVKLL+                       NQ              +AES+ G  P+H A+  GH E+V +LLS++ N  L +K
Sbjct:  471 QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNK 666          

HSP 16 Score: 48.9062 bits (115), Expect = 3.696e-27
Identity = 27/84 (32.14%), Postives = 40/84 (47.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLI 811
            +H A   G++ +V+ LL    ++NA  K    P+H A Q GH +IV LL+           +  TP+  A   GY  V  VL +
Sbjct:  705 LHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKV 788          

HSP 17 Score: 107.071 bits (266), Expect = 1.966e-22
Identity = 55/162 (33.95%), Postives = 90/162 (55.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V LLL+++  I+        P+H A   GH  V ++L+ +G        +   P+H AC+ NHV +++LLLK+  +++A  ++GL P+H A F G++ IVK L+      +  ++    P+H A+  GH E+ K LL  +  +  + K
Sbjct:  307 SPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAK 468          

HSP 18 Score: 61.6178 bits (148), Expect = 2.224e-20
Identity = 41/149 (27.52%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A          +LL      +   K    P+H A    +  + +LL++         +N +TP+H A   G   ++ +LL    ++E   KD+  P+H A   GH+ I +IL+     I+A TK   SP+ +A+Q      V LL
Sbjct:  176 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          

HSP 19 Score: 60.4622 bits (145), Expect = 2.224e-20
Identity = 35/118 (29.66%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A ++G+L+     +  G  I  C+++    +H A +  HV++V  LL  +  LE + K G   +H A   G  E+V+ L++    ++A+S  G  P++ A+   H E+VK LL    N
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN 136          

HSP 20 Score: 97.8265 bits (242), Expect = 1.391e-19
Identity = 48/151 (31.79%), Postives = 85/151 (56.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   V+    LL++  +  A       P+H A Q GH  +V LL+S+  +  + +K    P+H   Q  HV +  +L+K    ++A+ + G  P+H A  +GN+++VK L+ +Q  ++A++  G  P+H A+  GH +IV +LL
Sbjct:  604 TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL 754          

HSP 21 Score: 96.2857 bits (238), Expect = 4.344e-19
Identity = 51/163 (31.29%), Postives = 83/163 (50.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A  + ++D V LLL    +  +P      P+H A +   + V R L+  G S          P+H A Q  H E+V LLL  + N    +K+GL P+H     G+V +  +LI +   +DA +  G  P+H AS YG+ ++VK LL  + ++  + K+
Sbjct:  571 TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKL 733          

HSP 22 Score: 94.3597 bits (233), Expect = 1.849e-18
Identity = 51/156 (32.69%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H A +  HV  + LLLK   +I+A  +    P+H A   GHL +V+ L+  G S  + +     P+H A +  H E+ K LL++K  + A  K+   P+H A   G+  +VKLL+ N    +  +  G  P+H A+  GH E V  LL +  +
Sbjct:  373 TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 528          

HSP 23 Score: 88.1965 bits (217), Expect = 1.264e-16
Identity = 49/165 (29.70%), Postives = 84/165 (50.91%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGH---DEIVKILLSERCNIELQDK 495
            +P+H AAQ GH + V+LLL         +K    P+H   Q GH+ V  +LI  G  ++   +    P+H A    ++++VK LL+ + ++ A  K G  P+H A   G+ +IV LL+ N    +  S  G+ P+  A   G+    +++K++  E   + + DK
Sbjct:  637 TPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDK 801          

HSP 24 Score: 63.1586 bits (152), Expect = 2.904e-16
Identity = 46/179 (25.70%), Postives = 78/179 (43.58%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            ++ A    HL +V+ LL      N A ++   P+  A Q GH  +V  L++Y    +VR          D+ +                    TP+H A  Y   +V  +LL     V    ++   P+H A   G++ +V++L+ +   IE  TK+  +PL  A++ G  +I E+L D
Sbjct:  115 LYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLD 293          

HSP 25 Score: 45.0542 bits (105), Expect = 2.904e-16
Identity = 21/78 (26.92%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  262 LKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            L++  ++   ++NGL  +H A   G+V++V  L+  +  L+  +  G+  +H A+  G DE+V+ L++   N+  Q +
Sbjct:   32 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQ 109          

HSP 26 Score: 79.7221 bits (195), Expect = 5.350e-14
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHL IV+ LL +    N ++     P+H A + GH E+ K L+  K     + ++  TP+H A   G+ +++ +LL NN    +       P+H A   GH+  V  L+ +  +    TK+ ++PL +A++ G  ++ ELL
Sbjct:  408 LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELL 555          

HSP 27 Score: 77.7962 bits (190), Expect = 2.294e-13
Identity = 43/157 (27.39%), Postives = 82/157 (52.23%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDT 1012
            Q+    +H A  RG++ +V +LL +  +I    K+   P+H A +NGH  I ++L+ +    + + +N L+PIH A    + D + +LL  + +++    D   P+H A   GH  + K+L+ +     +     ++PL +A +K   +++ELL  T
Sbjct:  237 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT 393          

HSP 28 Score: 75.8702 bits (185), Expect = 1.034e-12
Identity = 41/150 (27.33%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +LN+ ++LL +   +N   +N   P+H A + G+  +V+LL+      E + +++LTP+H A   G+  +  +LL +   ++   K+   PIH A    HL  V++L+  +  I+  T ++ +PL +A+  G  ++ ++L D
Sbjct:  210 LHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLD 359          

HSP 29 Score: 68.9366 bits (167), Expect = 1.408e-10
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  +V +LL++    N  +K+   P+H   Q GH  +  +L+ +    +       TP+H A  YG   ++  LL +   V    K    P+H A   GH  IV +L+    +    + +  +PL +A + G+  + ++L
Sbjct:  639 LHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 30 Score: 67.781 bits (164), Expect = 2.671e-10
Identity = 43/164 (26.22%), Postives = 75/164 (45.73%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + K  V    +D    +H A   GH N+V++LL  +   N A      P+H A + GH E V  L+  +  +    +   TP+H A  YG   V  +LL  +       K+   P+H A    +L IVK+L+ +  +  +     ++PL +A+++   ++   L
Sbjct:  458 QNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSL 621          

HSP 31 Score: 55.8398 bits (133), Expect = 1.368e-6
Identity = 36/147 (24.49%), Postives = 70/147 (47.62%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            AA++G++D     L++   I   ++     +H A + GH+ +V  L+ +   +E   K     +H A      E+V+ L+    N+ A  + G  P++ A    ++E+VK L+ N    +  +  G  P+  A   GH+ +V  L++
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN 165          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54KA7|SECG_DICDI (Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.643e-38
Identity = 49/159 (30.82%), Postives = 77/159 (48.43%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + C       ++H A   G L++V++L+    +IN  D+    P+H A  NGH    KLLV       + D    TP+H A F G    +  L+ +  ++EV D   G P+H A + GH    +IL+ +  N+ A    + +PL LAS  G    V++L
Sbjct:  328 IDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVL 486          

HSP 2 Score: 90.5077 bits (223), Expect = 2.643e-38
Identity = 48/152 (31.58%), Postives = 86/152 (56.58%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            ++P+H+A+  G+   V LL+K ++ + A D     P+H A  +GH + V LL+ +G  ++  D     P+H A    +V+ V+ L+++  N+   D  G+ P+H+ CF+GN+++ K LI     ++     G  P+H A+F GH E+ + LL
Sbjct:  170 ETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLL 321          

HSP 3 Score: 78.5666 bits (192), Expect = 2.091e-29
Identity = 51/164 (31.10%), Postives = 80/164 (48.78%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKR--KPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            ++P+H+AA  G    V+ LL         D     P+ +A   GHL  ++LL+ +G  +++  KD +   P+H A      E V  LL  K +  A   NG  P+H+A   GN + V+LLI     ++A       P+H ASF GH   V +LL +   ++ +D
Sbjct:   70 RTPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEKG-GVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRD 232          

HSP 4 Score: 73.9442 bits (180), Expect = 2.091e-29
Identity = 42/160 (26.25%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDK-EVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + C   +    +H+ C  G+L + + L+    +IN  D+    P+H A  NGH E+ + L+       + RD  + T +H A F G  D++ +L+    ++ + D++   P+H A F GH    K+L+ +   I     +  +PL  A+  G S+ +  L
Sbjct:  261 INCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLLYLDPTMIDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATL 420          

HSP 5 Score: 79.7221 bits (195), Expect = 6.967e-24
Identity = 44/148 (29.73%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H+A   G+   VE+L+    ++NA D +   P+H A  +GH   V LL+      + RD + ++P+H A   GY D +  L+ N   +   D +   P+H+ CF G+L + K LI     I    +   +PL  A+  G  ++ E L
Sbjct:  173 LHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYL 320          

HSP 6 Score: 54.299 bits (129), Expect = 6.967e-24
Identity = 40/139 (28.78%), Postives = 63/139 (45.32%), Query Frame = 1
Query:   67 KHNNAIEAPDKFDRCPIHYACQNGHLN-VVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCC-LDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            KH+N+  AP    R  +HY    G +  +  LL +   S +  D +KR P+H A        V  LL  K N    D  G  P+ +A   G++E +KLL+      ++ +      P+H AS +   E V  LL+ + +
Sbjct:   28 KHSNS--APT---RPSVHYYSSTGDIEKLSNLLNNSATSPDTPDSEKRTPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKAD 161          

HSP 7 Score: 90.5077 bits (223), Expect = 2.179e-17
Identity = 49/164 (29.88%), Postives = 84/164 (51.22%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            R  + +H AA NG +D V LL+++   I   D+    P+H A  NGH +  +LL+ +G  I I D     P+H A  N   + +  L++S   LE  D  G  P+H A ++G+ +  ++L+     ++A     S P+H AS  G  + V +L+  +  I+ ++
Sbjct:  334 RQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKN 497          

HSP 8 Score: 83.1889 bits (204), Expect = 4.557e-15
Identity = 52/163 (31.90%), Postives = 80/163 (49.08%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHN-NAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            ++P+H AA NGH +    LL  +   I+  D      +H A  NG L++V LLI     I I D++   P+H A  N H    KLL+     +   D  G  P+H A F+G  + +  LI +   L+ +   G  P+H A++ GH +  +ILL +  N+   D
Sbjct:  302 ETPLHKAAFNGHKEVCEYLLYLDPTMIDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVD 464          

HSP 9 Score: 81.6481 bits (200), Expect = 1.079e-14
Identity = 45/158 (28.48%), Postives = 76/158 (48.10%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A+ NGH     LL+     I   D     P+H A  NG    +  LI  G  +E+ D     P+H A  N H +  ++LLK   N+ A D +   P+H A   G  + V +LI  +  +DA++  G  P+ +A    H ++ ++L+    +++
Sbjct:  370 TPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVLIRAGADLD 527          

HSP 10 Score: 75.485 bits (184), Expect = 1.134e-12
Identity = 44/156 (28.21%), Postives = 77/156 (49.36%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYG---HDEIVKIL 459
            +  +P+H AA NG    ++ L++    +E  D     P+H A  NGH +  R+L+ +G ++   D     P+H A      + V +L++ K  ++A +  G  P+ YA    + ++ ++LI     LD  SL  S  + F   +G   HDEI +I+
Sbjct:  400 QGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVLIRAGADLDQVSLRSS--VDFTKTFGTENHDEIYQIV 553          

HSP 11 Score: 73.1738 bits (178), Expect = 4.805e-12
Identity = 56/190 (29.47%), Postives = 83/190 (43.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSC-EINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDD--GRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL--SDTLRRKIIDSLVEELGIQCFDGCSHYLCKSSLESK 1111
            ++HY    G +  +  LL  S    +  D   R P+HHA   G    V  L+  K +  ++D    TP+ +A   G+ + +  LL+    V+V  KDD  G P+H A  F     V  L++   +  A T    +PL  AS  G  Q VELL  +D+    + +  +  L    F G  H  C S L  K
Sbjct:   38 SVHYYSSTGDIEKLSNLLNNSATSPDTPDSEKRTPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIK-LLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSG--HSSCVSLLLKK 224          

HSP 12 Score: 69.707 bits (169), Expect = 6.479e-11
Identity = 43/149 (28.86%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQS-CEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            + +A  RGHL  +++L+ +   ++N  D     P+H A      E V  L++ K D      N  TP+H+A   G    + +L+  + KV   D D   P+H A F GH   V +L+ +   ++       SPL  A+  G+   VE L
Sbjct:  106 LQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQL 254          

HSP 13 Score: 67.781 bits (164), Expect = 2.714e-10
Identity = 41/154 (26.62%), Postives = 66/154 (42.86%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            ++    +H A   GH +  ++L+ +   I   D     P+H A  NG  + +  L+    + EV+D    TP+H A + G+ D   +LL     V   D     P+H A   G    V +LI     I+A      +PL  A +K  S +  +L
Sbjct:  366 EEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVL 519          

HSP 14 Score: 67.781 bits (164), Expect = 2.761e-10
Identity = 45/166 (27.11%), Postives = 76/166 (45.78%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            ++ +P+H A+     + V  LL       A       P+H+A   G+   V LLI     +   D D   P+H A  + H   V LLLK    ++  D +G+ P+H A   G V+ V+ L+ N   ++   + G  P+H   F G+ ++ K L+     I + D++
Sbjct:  135 KNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEM 300          

HSP 15 Score: 63.929 bits (154), Expect = 4.290e-9
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 2
Query:  506 IEKEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELG 1054
            +EK    V      +G  +H A        V  LL    +  A   N   P+HHA   G+ + V+LL+         D + +TP+H A F G+   +++LL    KV+  D     P+H A   G++  V+ L+    NI     E  +PL      G  Q+ + L + L  KI  ++V+E+G
Sbjct:  122 VEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIE-LGAKI--NMVDEMG 301          

HSP 16 Score: 63.1586 bits (152), Expect = 6.095e-9
Identity = 39/158 (24.68%), Postives = 74/158 (46.84%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNA-IEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+ +A+  GH++ + LL++     +   D  +  P+H A        V  L++          +   P+H A    + + V+LL+K+   + A D + + P+H A F G+   V LL+     +D   + G  P+H A+  G+ + V+ L+    NI
Sbjct:  104 TPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENI 261          

HSP 17 Score: 62.3882 bits (150), Expect = 1.120e-8
Identity = 44/165 (26.67%), Postives = 75/165 (45.45%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWS-PLDLASQKGFSQIVELL 1003
            K    V     D    +H A   GH + V +LL +  +++  D +   P+H+A   G+ + V+ LV    +    D   +TP+H+ CF G   +   L+    K+ + D+    P+H A F GH  + + L+  +  +  C     S  L LA+  G   +V+LL
Sbjct:  190 KADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLLYLDPTMIDCRDSRQSTSLHLAAFNGLLDMVDLL 354          

HSP 18 Score: 53.1434 bits (126), Expect = 8.858e-6
Identity = 28/123 (22.76%), Postives = 54/123 (43.90%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIE 928
            +H A   G    +  L+    E+   D     P+H+A  NGH +  ++L+    +    D +  TP+H A   G  D + VL+    +++  +     P+ YA    H  + ++LI    +++
Sbjct:  405 LHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVLIRAGADLD 527          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 90.1225 bits (222), Expect = 1.972e-35
Identity = 42/156 (26.92%), Postives = 80/156 (51.28%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA++G  + V  L++    +EA  K D+ P+H + + G  ++V+ L+ +G S          P+H + +  H ++   LL    +L  + K G  P+H A  +G +E+  LL+      DA   +G  P+H A+ Y + ++  +LL +
Sbjct:  473 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 628          

HSP 2 Score: 82.4185 bits (202), Expect = 1.972e-35
Identity = 43/148 (29.05%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  ++I   LL    + NA  +     +H A Q GH ++V LL+S   +  + +++ LTP+H A      +V  VL+     V+   K    P+H  C +G++ IV  L+  +  + A TK  ++PL  A+Q+G + I+ +L
Sbjct:  643 LHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVL 790          

HSP 3 Score: 97.4413 bits (241), Expect = 1.957e-34
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H  A++GH   V +LL     I +  K    P+H A Q  HLN V+LL+     ++    D    +H A    H ++ K+LL  K N  A   NG  P+H AC    + +++LL+ +   + A + +G  PIH A+F GH  IV  L+
Sbjct:  311 TPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 461          

HSP 4 Score: 71.633 bits (174), Expect = 1.957e-34
Identity = 38/150 (25.33%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            V+   +D    +H +   G  +IV+ LL Q    NAA  +   P+H + + GH ++   L+ +     +  +   TP+H A  YG  +V ++LL  +   +   K    P+H A  + +  +  +L+ Q  +  A  K  ++PL +A++K
Sbjct:  500 VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKK 649          

HSP 5 Score: 92.8189 bits (229), Expect = 2.040e-34
Identity = 46/156 (29.49%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+++  +LLL    A++   + D  P+H A + G+ N+V+LL+  G  I+   +D   P+H   ++ H ++V++LL     + +  KNGL P+H A    ++  V+LL+ +   +D  +      +H A+  GH ++ K+LL ++ N
Sbjct:  245 TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN 400          

HSP 6 Score: 76.6406 bits (187), Expect = 2.040e-34
Identity = 43/150 (28.67%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC +  + ++E+LL     I A  ++   PIH A   GH  IV  L+ +       +    T +H A   G  +V+  L+ +  +VE   KDD  P+H +   G   IV+ L+ Q  +  A T   ++PL L++++G   +   L D
Sbjct:  412 LHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLD 561          

HSP 7 Score: 84.7297 bits (208), Expect = 5.315e-34
Identity = 58/227 (25.55%), Postives = 105/227 (46.26%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSL--------VEELGIQCFDGCSHYLCKSSLESKQFQEGEFIGSGSFGR------AFKYKLPQNNKEI 1195
            ++H A   GH+++V +LL+++  +N ++K+   P+H A Q     + ++LV+     + + +   TP+H  C YG   ++  LL ++ KV    K+   P+H A   GH HI+ +L+  N +    T    + L +A + G+  +V+ L       +  +         V E   +  D     + K+S   K   +GE+I  G  G         KY  PQ+ KE+
Sbjct:  675 SVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEVGKASAPEK-LSDGEYISDGEEGEDAITGDTDKYLGPQDLKEL 900          

HSP 8 Score: 83.1889 bits (204), Expect = 5.315e-34
Identity = 45/152 (29.61%), Postives = 75/152 (49.34%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            Q+P+H +A+ G  D V  LL+   +  A       P+H + + GH +V   L+  G S+ I  K    P+H A +   +E+  LLL+   + +A+ K+GL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL
Sbjct:  508 QTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL 659          

HSP 9 Score: 76.2554 bits (186), Expect = 9.330e-29
Identity = 45/167 (26.95%), Postives = 87/167 (52.10%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRC------PIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+     A +LLL++  N  IE+    +R       P+H A   G++NV  LL++   +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H     G+ ++V++L+     + +++  G  P+H A+   H   V++LL    N+ + D
Sbjct:  206 LHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDD 370          

HSP 10 Score: 73.9442 bits (180), Expect = 9.330e-29
Identity = 40/149 (26.85%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   N   P+H AC+     +++LL+ +    +   E+ LTPIH A F G+ ++++ L+ +       +      +H A   G   +V+ L+     +EA  K++ +PL ++++ G + IV+ L
Sbjct:  378 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQL 526          

HSP 11 Score: 75.8702 bits (185), Expect = 1.745e-28
Identity = 41/148 (27.70%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLN V++LL  +  ++    +Y   +H A   GH ++ K+L+  K +   +  N  TP+H AC      VM +LL +   ++   +    PIH A F GH++IV  L+    +         + L +A++ G +++V  L
Sbjct:  346 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYL 493          

HSP 12 Score: 73.559 bits (179), Expect = 1.745e-28
Identity = 47/202 (23.27%), Postives = 85/202 (42.08%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLL-------------------------------------KSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +  + +H A+  G  + V +L+ +   + A  +    P++ A Q  HL VVR L+  G S  +  +D   P+  A Q  H ++V LLL                                     +SK  +  + ++G  P+H A  +GN+ +  LL++    +D  +     P+H AS  G+  +VK+LL     I+ + +
Sbjct:  106 KGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR 307          

HSP 13 Score: 78.1814 bits (191), Expect = 3.146e-27
Identity = 43/162 (26.54%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVV 501
            +H A++ GHV+ VS LL+    ++A  K     +H A   G   VV++L++ G ++    ++   P++ A Q NH+E+V+ LL +  +   + ++G  P+  A   G+ ++V LL+ N    D +       +H A+     +   +LL    N +++ K+V
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMV 235          

HSP 14 Score: 67.0106 bits (162), Expect = 3.146e-27
Identity = 38/150 (25.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL ++  ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H     G+  V+ +LL     +    K+   P+H A    HL+ V++L+  N  ++  T +  + L +A+  G  ++ ++L D
Sbjct:  247 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD 396          

HSP 15 Score: 70.4774 bits (171), Expect = 1.994e-21
Identity = 50/198 (25.25%), Postives = 84/198 (42.42%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR-------------------------------------DENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q+    ++ A    HL +V  LL      + A ++   P+  A Q GH ++V LL+      +VR                                      E+  TP+H A  YG  +V T+LL     V+   ++D  P+H A   G+ ++VK+L+ +   I+A T++  +PL   ++ G  Q+VE+L D
Sbjct:  133 VNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLD 330          

HSP 16 Score: 55.4546 bits (132), Expect = 1.994e-21
Identity = 27/91 (29.67%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  H+E     +K+  ++   ++NGL  +H A   G+VE+V  L+  +  +DA +  G+  +H AS  G  E+VK+L++   N+  Q +
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQ 138          

HSP 17 Score: 100.138 bits (248), Expect = 2.776e-20
Identity = 45/151 (29.80%), Postives = 85/151 (56.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +D  + LL++     A  +     +H A Q GH+++V LL+S   ++ + +K    P+H A Q + V + ++L+    +++A  K G  P+H  C +GN++IV  L+ +   ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  641 TPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 791          

HSP 18 Score: 95.1301 bits (235), Expect = 1.151e-18
Identity = 47/150 (31.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            + +H AAQ GHVD VSLLL  N  +   +K    P+H A Q   +NV  +L+++G  ++   K    P+H  C   +++IV  LL+    + A  KNG  P+H A   G+  I+ +L+ N    +  ++ G+  +  A   G+  +V  L
Sbjct:  674 ASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 19 Score: 88.1965 bits (217), Expect = 1.713e-16
Identity = 44/162 (27.16%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  + LLLKH  +I+A  +    PIH A   GH+N+V  L+  G S    +      +H A ++   E+V+ L++    +EA  K+   P+H +   G  +IV+ L+      +A + +G  P+H ++  GH+++   LL    ++ +  K
Sbjct:  410 TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTK 571          

HSP 20 Score: 87.8113 bits (216), Expect = 2.235e-16
Identity = 48/162 (29.63%), Postives = 80/162 (49.38%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H +A+ GH D  + LL H  ++    K    P+H A + G L V  LL+ +  S +   K    P+H A   ++ ++  LLL    +  A+ KNG  P+H A     ++I   L+      +A +  G   +H A+  GH ++V +LLS   N+ L +K
Sbjct:  542 TPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 703          

HSP 21 Score: 87.4261 bits (215), Expect = 2.313e-16
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +PIH AA  GHV+ VS L+ H  +    +      +H A ++G   VVR L+ +G  +E   KD + P+H + +    +IV+ LL+   +  A+  +G  P+H +   G+ ++   L+ +   L   +  G  P+H A+ YG  E+  +LL +
Sbjct:  443 TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQK 595          

HSP 22 Score: 85.1149 bits (209), Expect = 1.342e-15
Identity = 45/162 (27.78%), Postives = 76/162 (46.91%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL    +  A  K    P+H A +   +++   L+  G       +     +H A Q  HV++V LLL    N+  S+K+GL P+H A     V + ++L++    +DA++  G  P+H    YG+ +IV  LL     +  + K
Sbjct:  608 TPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTK 769          

HSP 23 Score: 83.5741 bits (205), Expect = 3.533e-15
Identity = 44/163 (26.99%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H AA+ G ++  SLLL+ + + +A  K    P+H A    +  V  LL+ +G S     K+   P+H A + N ++I   LL+   +  A  + G+  +H A   G+V++V LL+S    ++  + +G  P+H A+      + ++L+++  +++ Q K+
Sbjct:  575 TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKM 737          

HSP 24 Score: 78.1814 bits (191), Expect = 1.706e-13
Identity = 38/113 (33.63%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            A + GHL      I  G  + IC+++    +H A +  HVE+V  LL+ + N++A+ K G   +H A   G  E+VK+L++N   ++A+S  G  P++ A+   H E+V+ LL
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 160          

HSP 25 Score: 75.485 bits (184), Expect = 1.157e-12
Identity = 41/148 (27.70%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H   ++GH ++V++L+        + +N L+P+H A    + + + +LL +N  V+    D    +H A   GH  + K+L+ +  N  A     ++PL +A +K   +++ELL
Sbjct:  280 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELL 427          

HSP 26 Score: 71.2478 bits (173), Expect = 2.657e-11
Identity = 43/154 (27.92%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H     GH  +VEMLL ++  I +  KN   P+H A Q  H   V+LL+ +    +    + LT +H A   G++ V  VLL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV  L
Sbjct:  307 RDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQL 460          

HSP 27 Score: 70.0922 bits (170), Expect = 6.235e-11
Identity = 38/146 (26.03%), Postives = 72/146 (49.32%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ GH++     +K+   +   ++     +H A + GH+ VV  L+    +++   K     +H A      E+VK+L+ +  N+ A  +NG  P++ A    ++E+V+ L+ N       +  G  P+  A   GHD++V +LL
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 193          

HSP 28 Score: 68.1662 bits (165), Expect = 1.989e-10
Identity = 38/148 (25.68%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A   GH+NIV  L+      N  +      +H A ++G  E+V+ LV      E + ++  TP+H +   G  D++  LL               P+H +   GH  +   L+    ++   TK+ ++PL +A++ G  ++  LL
Sbjct:  445 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLL 592          

HSP 29 Score: 67.3958 bits (163), Expect = 4.320e-10
Identity = 37/141 (26.24%), Postives = 69/141 (48.94%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            GHL      +    ++N  ++N    +H A + GH E+V  L+  + + +   +   T +H A   G  +V+ VL+ N   V    ++   P++ A    HL +V+ L+    +    T++ ++PL +A Q+G  Q+V LL
Sbjct:   52 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLL 192          

HSP 30 Score: 66.2402 bits (160), Expect = 8.839e-10
Identity = 54/205 (26.34%), Postives = 93/205 (45.37%), Query Frame = 2
Query:  506 IEKEKDYVK-------CYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL--SDT---LRRKIIDSLVEELGIQCFDGCSHY 1084
            +EK  DY+K       C  Q+   A+H A   GH+ +V  LL +   ++AA K     +H A   G  E+VK+LV+   +   + +N  TP++ A    + +V+  LL N     +  +D   P+  A   GH  +V +L+  +       K     L +A++K  ++   LL  +DT   +  K++ +   E G       +HY
Sbjct:   54 LEKALDYIKNGVDVNICN-QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHY 253          

HSP 31 Score: 64.6994 bits (156), Expect = 2.395e-9
Identity = 37/151 (24.50%), Postives = 71/151 (47.02%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+    ++ A  K+ + P+H + + G  +IV+ L+           +  TP+H +   G+ DV   LL +   + +  K    P+H A  +G L +  +L+ ++ + +A  K   +PL +A+     ++  LL D
Sbjct:  477 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLD 627          

HSP 32 Score: 59.6918 bits (143), Expect = 9.243e-8
Identity = 37/148 (25.00%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH ++   LL     ++   K    P+H A + G  E+  LL+      +   ++ LTP+H A  Y    V  +LL          K+   P+H A     + I   L+    +  A T++  + + LA+Q+G   +V LL
Sbjct:  544 LHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 691          

HSP 33 Score: 59.6918 bits (143), Expect = 9.979e-8
Identity = 35/126 (27.78%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  626 INAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +N A ++   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    K++   +D   P+H     GH  +V++L+ +   I + TK   SPL +A+Q      V+LL
Sbjct:  236 VNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLL 361          

HSP 34 Score: 56.9954 bits (136), Expect = 6.322e-7
Identity = 33/125 (26.40%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  635 ADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+ +Y R    A + GH E     +    D  + ++N L  +H A   G+ +V++ LL     V+   K     +H A   G   +VK+L++   N+ A ++  ++PL +A+Q+   ++V  L D
Sbjct:   41 ANASYLR----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLD 161          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 3.066e-35
Identity = 55/156 (35.26%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+V+  +LLL    A++   +    P+H A + G+ N+V+LL+  G  I+   +D   P+H A ++ H ++V+LLL+ K  L A  KNGL P+H A    +VE VK L+  +  +D  +L     +H A+  GH  + K+LL +R N
Sbjct:  235 TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN 390          

HSP 2 Score: 70.0922 bits (170), Expect = 3.066e-35
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+L+     I A  ++   PIH A   GH  IV LL+      +V +    T +H A   G  +V+  LL N   V+   +++  P+H A   G   IV++L+    + +A T   ++PL +++++G   +  +L
Sbjct:  402 LHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 549          

HSP 3 Score: 86.6557 bits (213), Expect = 1.168e-34
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   N   P+H AC+    ++++LLV Y    +   E+ LTPIH A F G+ +++ +LL N    +V +      +H A   G + +V+ L+     ++A  +E  +PL +AS+ G ++IV+LL
Sbjct:  368 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 516          

HSP 4 Score: 83.5741 bits (205), Expect = 1.168e-34
Identity = 48/164 (29.27%), Postives = 88/164 (53.66%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLK--HNNAIEAPDKFDRC------PIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+     + +LLL+  HN  +++    +R       P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H A   G+ ++V+LL+  +  L A +  G  P+H A+   H E VK LL  +  ++
Sbjct:  196 LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 359          

HSP 5 Score: 92.8189 bits (229), Expect = 2.206e-32
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   V LLL+    + A  K    P+H A Q  H+  V+ L+     ++    D    +H A    H  + KLLL  + N  A   NG  P+H AC    +++++LL+     + A + +G  PIH A+F GH  IV +LL
Sbjct:  301 TPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLL 451          

HSP 6 Score: 69.707 bits (169), Expect = 2.206e-32
Identity = 41/149 (27.52%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   G + +V  LL     ++A  +  + P+H A + G  EIV+LL+ +    +    N  TP+H +   G  DV +VLL       +  K    P+H A  +G L + K+L+ +    ++  K   +PL +A+     ++  LL
Sbjct:  467 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLL 615          

HSP 7 Score: 83.5741 bits (205), Expect = 4.945e-31
Identity = 39/156 (25.00%), Postives = 83/156 (53.21%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA+ G V+ V  LL++   ++A  + ++ P+H A + G   +V+LL+      +    +   P+H + +   V++  +LL++      + K G  P+H A  +G++++ KLL+  +   D+    G  P+H A+ Y + ++  +LL +
Sbjct:  463 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 618          

HSP 8 Score: 74.3294 bits (181), Expect = 4.945e-31
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + I   LL    E N   K    P+H A Q GH ++V LL+    +  +  ++ LT +H A      +V  +L  +    +   K    P+  AC +G++ +V  L+ Q  N+ A TK  ++PL  A+Q+G + I+ +L
Sbjct:  633 LHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 780          

HSP 9 Score: 83.1889 bits (204), Expect = 1.830e-29
Identity = 43/153 (28.10%), Postives = 79/153 (51.63%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            Q+P+H A++ G  + V LLL+H    +A       P+H + + G ++V  +L+  G +  +  K    P+H A +   +++ KLLL+ +   +++ KNGL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL+
Sbjct:  498 QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 650          

HSP 10 Score: 69.707 bits (169), Expect = 1.830e-29
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH ++V +LL +   I+ + K+    +H A Q     +  +L  +  D++   +   TP+  AC YG   ++  LL     V    K+   P+H A   GH HI+ +L+       A T    + L +A + G+  +V+ L
Sbjct:  666 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 11 Score: 88.5817 bits (218), Expect = 9.056e-29
Identity = 46/151 (30.46%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +   +  + LL+K+  +I+A  +    PIH A   GHLN+V LL+  G S ++ +      +H A +   VE+V+ LL++   ++A  +    P+H A   G  EIV+LL+ +    DA +  G  P+H ++  G  ++  +LL
Sbjct:  400 TPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 550          

HSP 12 Score: 61.6178 bits (148), Expect = 9.056e-29
Identity = 38/149 (25.50%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +H A   G L++ ++LL +    ++A KN   P+H A    + ++  LL+          +N  TP+H A       + + LL    +     K    P+H A   GH  +V +L+ +  NI   TK   + L LA+Q+    + ++L+
Sbjct:  567 LHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT 715          

HSP 13 Score: 76.2554 bits (186), Expect = 2.589e-27
Identity = 52/193 (26.94%), Postives = 85/193 (44.04%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI--------CDKDKRK-----------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +P++ AAQ  H+D V  LL++  N +    D F   P+  A Q GH   V +L+      ++          KD  K                             P+H A    +V +  LLL     ++ + +NG+ P+H A   GN  +VKLL+     +DA++  G  P+H A+  GHD++V++LL  +
Sbjct:  132 TPLYMAAQENHIDVVKYLLENGANQSTATEDGF--TPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERK 322          

HSP 14 Score: 68.9366 bits (167), Expect = 2.589e-27
Identity = 40/148 (27.03%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    H+  V+ LL     ++    +Y   +H A   GH  + KLL+  + +   R  N  TP+H AC      VM +L+     ++   +    PIH A F GHL+IV +L+    + +       + L +A++ G  ++V  L
Sbjct:  336 LHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL 483          

HSP 15 Score: 76.2554 bits (186), Expect = 3.501e-25
Identity = 44/162 (27.16%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVV 501
            +H AA+ GHV  V  LL   +++++  K     +H A   G   VV++L+ EG +I    ++   P++ A Q NH+++VK LL++  N   + ++G  P+  A   G+ + V +L+ N    D +       +H A+     +   +LL    N ++Q K++
Sbjct:   68 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMM 225          

HSP 16 Score: 62.003 bits (149), Expect = 3.501e-25
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H A   G+  V+ +LL     +    K+   P+H A    H+  VK L+     ++  T +  + L +A+  G  ++ +LL D
Sbjct:  237 LHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD 386          

HSP 17 Score: 86.6557 bits (213), Expect = 3.044e-22
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H +A+ G VD  S+LL+   A     K    P+H A + G L+V +LL+    + +   K+   P+H A   ++ ++  LLL+   +  A+ KNG  P+H A     ++I   L++     +  +  G  P+H AS  GH ++V +LL +  NI +  K
Sbjct:  532 TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK 693          

HSP 18 Score: 41.5874 bits (96), Expect = 3.044e-22
Identity = 26/116 (22.41%), Postives = 52/116 (44.83%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKIL 904
            ++H A     +N+ ++L     + +A  K    P+  AC  G+ ++V  L+    +   + +N  TP+H A   G+  ++ VLL +  K      +    +  A   G++ +V  L
Sbjct:  698 SLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 19 Score: 91.2781 bits (225), Expect = 1.588e-17
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +   S LL +        K    P+H A Q GH ++V LL+ +G +I +  K     +H A Q + V +  +L K   + +A  K G  P+  AC +GNV++V  L+     ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  631 TPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 781          

HSP 20 Score: 88.1965 bits (217), Expect = 1.755e-16
Identity = 46/154 (29.87%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH++ V LLL++  + +  +      +H A + G + VVR L+  G  ++   ++++ P+H A +    EIV+LLL+   + +A+  NG  P+H +   G V++  +L+         +  G  P+H A+ YG  ++ K+LL  R
Sbjct:  433 TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRR 586          

HSP 21 Score: 80.8777 bits (198), Expect = 2.886e-14
Identity = 46/150 (30.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H A+Q GH D V+LLL     I    K     +H A Q   +NV  +L   G   +   K    P+  AC   +V++V  LLK   N+ A  KNG  P+H A   G+  I+ +L+ +    +A +  G+  +  A   G+  +V  L
Sbjct:  664 TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 22 Score: 77.411 bits (189), Expect = 3.499e-13
Identity = 45/162 (27.78%), Postives = 73/162 (45.06%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL+   +  A  K    P+H A +   + +   L++ G       K    P+H A Q  H ++V LLL    N+  S K+GL  +H A     V +  +L  +    DA +  G  P+  A  YG+ ++V  LL +  N+  + K
Sbjct:  598 TPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK 759          

HSP 23 Score: 75.0998 bits (183), Expect = 1.572e-12
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDK--DDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H A ++GH ++V+LL+  K     R +N L+P+H A    + + +  LL   +K  V D   D    +H A   GH  + K+L+ +  N  A     ++PL +A +K   +++ELL
Sbjct:  270 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL--QYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 417          

HSP 24 Score: 74.3294 bits (181), Expect = 2.809e-12
Identity = 43/146 (29.45%), Postives = 73/146 (50.00%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G++D V   LK    I   ++     +H A + GH+ +V+ L+  G S++   K     +H A      E+VK+L+K   N+ A  +NG  P++ A    ++++VK L+ N       +  G  P+  A   GH++ V ILL
Sbjct:   38 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL 183          

HSP 25 Score: 73.1738 bits (178), Expect = 6.105e-12
Identity = 46/154 (29.87%), Postives = 75/154 (48.70%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H A   GH  +VE+LL +   + A  KN   P+H A Q  H E VK L+ YK   +    + LT +H A   G++ V  +LL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV LL
Sbjct:  297 RDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL 450          

HSP 26 Score: 72.0182 bits (175), Expect = 1.508e-11
Identity = 39/139 (28.06%), Postives = 66/139 (47.48%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFAS 426
            +P+H AA+ G +D   LLL+   A ++  K    P+H A    +  V  LL+ +G S     K+   P+H A + N ++I   LL          K G+ P+H A   G+ ++V LL+     +   + +G   +H A+
Sbjct:  565 TPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAA 703          

HSP 27 Score: 68.5514 bits (166), Expect = 1.740e-10
Identity = 42/150 (28.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H +   G +++  +LL      + A K    P+H A + G  ++ KLL+  +   +   +N LTP+H A  Y    V  +LL          K+   P+H A     + I   L++        TK+  +PL LASQ+G + +V LL D
Sbjct:  534 LHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLD 683          

HSP 28 Score: 67.781 bits (164), Expect = 3.106e-10
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G   IV++LL      +AA  N   P+H + + G  ++  +L+       +  +   TP+H A  YG  DV  +LL      +   K+   P+H A  + +  +  +L+ +  +  A  K  ++PL +A++K   QI   L
Sbjct:  501 LHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTL 648          

HSP 29 Score: 67.3958 bits (163), Expect = 4.518e-10
Identity = 52/208 (25.00%), Postives = 89/208 (42.79%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR-------------------------------------DENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRK 1024
            KE   +    Q+    ++ A    H+++V+ LL      + A ++   P+  A Q GH + V +L+      +VR                                      E+  TP+H A  YG  +V T+LL     V+   ++   P+H A   G+ ++VK+L+ +   I+A T++  +PL  A++ G  Q+VELL   L RK
Sbjct:  118 KEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL---LERK 322          

HSP 30 Score: 63.929 bits (154), Expect = 5.380e-9
Identity = 34/118 (28.81%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            A + G+L+ V   +  G  I  C+++    +H A +  HV +V+ LL    +++++ K G   +H A   G  E+VK+L+     ++A+S  G  P++ A+   H ++VK LL    N
Sbjct:   38 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 155          

HSP 31 Score: 62.7734 bits (151), Expect = 9.515e-9
Identity = 41/159 (25.79%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            IH A   GHLNIV +LL      +  +      +H A + G  E+V+ L+      + R   + TP+H A   G  +++ +LL +    +    +   P+H +   G + +  +L+         TK+ ++PL +A++ G   + +LL    RR   DS
Sbjct:  435 IHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ--RRAAADS 591          

HSP 32 Score: 61.2326 bits (147), Expect = 2.949e-8
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQN 916
            Q+   A+H A   GH+ +V+ LL +   +++A K     +H A   G  E+VK+LV    +   + +N  TP++ A    + DV+  LL N        +D   P+  A   GH   V IL+  +
Sbjct:   62 QNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 186          

HSP 33 Score: 60.077 bits (144), Expect = 6.450e-8
Identity = 39/153 (25.49%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            DS  +   A   G+L+ V   L    +IN  ++N    +H A + GH  +V+ L+      +   +   T +H A   G  +V+ VL+     +    ++   P++ A    H+ +VK L+    N    T++ ++PL +A Q+G +Q V +L
Sbjct:   30 DSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAIL 182          

HSP 34 Score: 55.4546 bits (132), Expect = 1.820e-6
Identity = 33/126 (26.19%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  626 INAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +N   ++   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    +++   +D   P+H A   GH  +V++L+ +   + A TK   SPL +A+Q    + V+ L
Sbjct:  226 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHL 351          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 90.1225 bits (222), Expect = 5.195e-35
Identity = 42/156 (26.92%), Postives = 80/156 (51.28%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            R ++ +H AA++G  + V  L++    +EA  K D+ P+H + + G  ++V+ L+ +G S          P+H + +  H ++   LL    +L  + K G  P+H A  +G +E+  LL+      DA   +G  P+H A+ Y + ++  +LL +
Sbjct:  465 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 620          

HSP 2 Score: 81.2629 bits (199), Expect = 5.195e-35
Identity = 42/148 (28.38%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  ++I   LL    + NA  +     +H A Q GH ++V LL+    +  + +++ LTP+H A      +V  VL+     V+   K    P+H  C +G++ IV  L+  +  + A TK  ++PL  A+Q+G + I+ +L
Sbjct:  635 LHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVL 782          

HSP 3 Score: 92.8189 bits (229), Expect = 1.915e-34
Identity = 46/156 (29.49%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+++  +LLL    A++   + D  P+H A + G+ N+V+LL+  G  I+   +D   P+H   ++ H ++V++LL     + +  KNGL P+H A    ++  V+LL+ +   +D  +      +H A+  GH ++ K+LL ++ N
Sbjct:  237 TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN 392          

HSP 4 Score: 76.6406 bits (187), Expect = 1.915e-34
Identity = 43/150 (28.67%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC +  + ++E+LL     I A  ++   PIH A   GH  IV  L+ +       +    T +H A   G  +V+  L+ +  +VE   KDD  P+H +   G   IV+ L+ Q  +  A T   ++PL L++++G   +   L D
Sbjct:  404 LHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLD 553          

HSP 5 Score: 97.8265 bits (242), Expect = 2.185e-34
Identity = 50/151 (33.11%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H  A++GH   V +LL     I +  K    P+H A Q  HLN V+LL+     ++    D    +H A    H ++ K+LL  K N  A   NG  P+H AC    +++++LL+ +   + A + +G  PIH A+F GH  IV  L+
Sbjct:  303 TPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 453          

HSP 6 Score: 71.2478 bits (173), Expect = 2.185e-34
Identity = 40/159 (25.16%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            V+   +D    +H +   G  +IV+ LL Q    NAA  +   P+H + + GH ++   L+ +     +  +   TP+H A  YG  +V  +LL  +   +   K    P+H A  + +  +  +L+ Q  +  A  K  ++PL +A++K    I   L
Sbjct:  492 VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTL 650          

HSP 7 Score: 83.9593 bits (206), Expect = 1.006e-33
Identity = 45/152 (29.61%), Postives = 75/152 (49.34%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            Q+P+H +A+ G  D V  LL+   +  A       P+H + + GH +V   L+  G S+ I  K    P+H A +   +E+  LLL+   + +A+ K+GL P+H A  + N ++  LL+       A +  G  P+H A+     +I   LL
Sbjct:  500 QTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL 651          

HSP 8 Score: 83.1889 bits (204), Expect = 1.006e-33
Identity = 41/149 (27.52%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            ++H A   GH+++V +LL ++  +N ++K+   P+H A Q     + ++LV+     + + +   TP+H  C YG   ++  LL ++ KV    K+   P+H A   GH HI+ +L+  N +    T    + L +A + G+  +V+ L
Sbjct:  667 SVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 9 Score: 83.1889 bits (204), Expect = 5.231e-31
Identity = 43/159 (27.04%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+     A +LLL+++N  +   K    P+H A   G++NV  LL++   +++   ++   P+H A +  +  +VKLLL     ++A  ++GL P+H     G+ ++V++L+     + +++  G  P+H A+   H   V++LL    N+ + D
Sbjct:  206 LHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDD 362          

HSP 10 Score: 74.3294 bits (181), Expect = 5.231e-31
Identity = 40/149 (26.85%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A   GH  + ++LL +    NA   N   P+H AC+    ++++LL+ +    +   E+ LTPIH A F G+ ++++ L+ +       +      +H A   G   +V+ L+     +EA  K++ +PL ++++ G + IV+ L
Sbjct:  370 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQL 518          

HSP 11 Score: 88.5817 bits (218), Expect = 6.700e-31
Identity = 44/162 (27.16%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A +   +  + LLLKH  +I+A  +    PIH A   GH+N+V  L+  G S    +      +H A ++   E+V+ L++    +EA  K+   P+H +   G  +IV+ L+      +A + +G  P+H ++  GH+++   LL    ++ +  K
Sbjct:  402 TPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTK 563          

HSP 12 Score: 68.9366 bits (167), Expect = 6.700e-31
Identity = 39/148 (26.35%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +  +  +LL Q    +AA KN   P+H A +    +I   L+ Y  D        +  +H A   G+ D++++LL  N  V + +K    P+H A     +++ ++L++Q  +++A TK  ++PL +    G  +IV  L
Sbjct:  602 LHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL 749          

HSP 13 Score: 80.8777 bits (198), Expect = 1.223e-30
Identity = 47/186 (25.27%), Postives = 86/186 (46.24%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQC-----------------------------CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H A++ GHV+ VS LL+    ++A  K     +H A   G   VV++L++ G ++    ++   P++ A Q NH+E+VK LL +  +   + ++G  P+  A   G+ ++V LL+ N                                 D ES +G  P+H A+ YG+  +  +LL+    ++ 
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF 263          

HSP 14 Score: 75.8702 bits (185), Expect = 1.223e-30
Identity = 41/148 (27.70%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  ++   P+H   ++GH ++V++L+        + +N L+P+H A    + + + +LL +N  V+    D    +H A   GH  + K+L+ +  N  A     ++PL +A +K   +++ELL
Sbjct:  272 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELL 419          

HSP 15 Score: 77.0258 bits (188), Expect = 1.171e-29
Identity = 46/164 (28.05%), Postives = 82/164 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H++ V  LL +  + ++   D F   P+  A Q GH  VV LL+      +   K +   +H A + +  +   LLL++  N +   K+G  P+H A  +GN+ +  LL++    +D  +     P+H AS  G+  +VK+LL     I+ + +
Sbjct:  142 TPLYMAAQENHLEVVKFLLDNGASQSLATEDGF--TPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR 299          

HSP 16 Score: 76.2554 bits (186), Expect = 1.171e-29
Identity = 41/148 (27.70%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLN V++LL  +  ++    +Y   +H A   GH ++ K+L+  K +   +  N  TP+H AC      VM +LL +   ++   +    PIH A F GH++IV  L+    +         + L +A++ G +++V  L
Sbjct:  338 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYL 485          

HSP 17 Score: 71.633 bits (174), Expect = 7.642e-24
Identity = 40/146 (27.40%), Postives = 72/146 (49.32%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ GH++     +K+   I   ++     +H A + GH+ VV  L+    +++   K     +H A      E+VK+L+ +  N+ A  +NG  P++ A    ++E+VK L+ N       +  G  P+  A   GHD++V +LL
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 193          

HSP 18 Score: 62.003 bits (149), Expect = 7.642e-24
Identity = 39/149 (26.17%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A  +       +LL      +   K+   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    K++   +D   P+H     GH  +V++L+ +   I + TK   SPL +A+Q      V+LL
Sbjct:  205 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLL 353          

HSP 19 Score: 73.1738 bits (178), Expect = 2.205e-22
Identity = 51/190 (26.84%), Postives = 86/190 (45.26%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q+    ++ A    HL +V+ LL      + A ++   P+  A Q GH ++V LL+      +VR          D+ K                    TP+H A  YG  +V T+LL     V+   ++D  P+H A   G+ ++VK+L+ +   I+A T++  +PL   ++ G  Q+VE+L D
Sbjct:  133 VNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLD 322          

HSP 20 Score: 55.4546 bits (132), Expect = 2.205e-22
Identity = 27/91 (29.67%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  223 ACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            A +  H+E     +K+  ++   ++NGL  +H A   G+VE+V  L+  +  +DA +  G+  +H AS  G  E+VK+L++   N+  Q +
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQ 138          

HSP 21 Score: 98.9821 bits (245), Expect = 7.360e-20
Identity = 44/151 (29.14%), Postives = 84/151 (55.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   +D  + LL++     A  +     +H A Q GH+++V LL+    ++ + +K    P+H A Q + V + ++L+    +++A  K G  P+H  C +GN++IV  L+ +   ++A++  G  P+H A+  GH  I+ +LL
Sbjct:  633 TPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 783          

HSP 22 Score: 94.3597 bits (233), Expect = 2.132e-18
Identity = 47/150 (31.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            + +H AAQ GHVD VSLLL  N  +   +K    P+H A Q   +NV  +L+++G  ++   K    P+H  C   +++IV  LL+    + A  KNG  P+H A   G+  I+ +L+ N    +  ++ G+  +  A   G+  +V  L
Sbjct:  666 ASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 23 Score: 87.4261 bits (215), Expect = 2.457e-16
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +PIH AA  GHV+ VS L+ H  +    +      +H A ++G   VVR L+ +G  +E   KD + P+H + +    +IV+ LL+   +  A+  +G  P+H +   G+ ++   L+ +   L   +  G  P+H A+ YG  E+  +LL +
Sbjct:  435 TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQK 587          

HSP 24 Score: 86.6557 bits (213), Expect = 5.133e-16
Identity = 47/162 (29.01%), Postives = 79/162 (48.77%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H +A+ GH D  + LL H  ++    K    P+H A + G L V  LL+ +  S +   K    P+H A   ++ ++  LLL    +  A+ KNG  P+H A     ++I   L+      +A +  G   +H A+  GH ++V +LL    N+ L +K
Sbjct:  534 TPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNK 695          

HSP 25 Score: 85.1149 bits (209), Expect = 1.485e-15
Identity = 45/162 (27.78%), Postives = 76/162 (46.91%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL    +  A  K    P+H A +   +++   L+  G       +     +H A Q  HV++V LLL    N+  S+K+GL P+H A     V + ++L++    +DA++  G  P+H    YG+ +IV  LL     +  + K
Sbjct:  600 TPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTK 761          

HSP 26 Score: 80.1073 bits (196), Expect = 5.726e-14
Identity = 40/113 (35.40%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            A + GHL      I  G  I IC+++    +H A +  HVE+V  LL+ + N++A+ K G   +H A   G  E+VK+L++N   ++A+S  G  P++ A+   H E+VK LL
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLL 160          

HSP 27 Score: 70.8626 bits (172), Expect = 3.192e-11
Identity = 43/154 (27.92%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H     GH  +VEMLL ++  I +  KN   P+H A Q  H   V+LL+ +    +    + LT +H A   G++ V  VLL           +   P+H AC    + ++++L+    +I+A T+   +P+ +A+  G   IV  L
Sbjct:  299 RDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQL 452          

HSP 28 Score: 68.9366 bits (167), Expect = 1.442e-10
Identity = 39/141 (27.66%), Postives = 69/141 (48.94%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            GHL      +    +IN  ++N    +H A + GH E+V  L+  + + +   +   T +H A   G  +V+ VL+ N   V    ++   P++ A    HL +VK L+    +    T++ ++PL +A Q+G  Q+V LL
Sbjct:   52 GHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLL 192          

HSP 29 Score: 68.1662 bits (165), Expect = 2.153e-10
Identity = 38/148 (25.68%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IH A   GH+NIV  L+      N  +      +H A ++G  E+V+ LV      E + ++  TP+H +   G  D++  LL               P+H +   GH  +   L+    ++   TK+ ++PL +A++ G  ++  LL
Sbjct:  437 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLL 584          

HSP 30 Score: 67.0106 bits (162), Expect = 5.308e-10
Identity = 38/150 (25.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL ++  ++   +N   P+H A + G+  +VKLL+      + +  + LTP+H     G+  V+ +LL     +    K+   P+H A    HL+ V++L+  N  ++  T +  + L +A+  G  ++ ++L D
Sbjct:  239 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD 388          

HSP 31 Score: 64.6994 bits (156), Expect = 2.478e-9
Identity = 37/151 (24.50%), Postives = 71/151 (47.02%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+    ++ A  K+ + P+H + + G  +IV+ L+           +  TP+H +   G+ DV   LL +   + +  K    P+H A  +G L +  +L+ ++ + +A  K   +PL +A+     ++  LL D
Sbjct:  469 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLD 619          

HSP 32 Score: 64.6994 bits (156), Expect = 2.542e-9
Identity = 41/144 (28.47%), Postives = 69/144 (47.92%), Query Frame = 2
Query:  506 IEKEKDYVK-------CYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQN 916
            +EK  DY+K       C  Q+   A+H A   GH+ +V  LL +   ++AA K     +H A   G  E+VK+LV+   +   + +N  TP++ A    + +V+  LL N     +  +D   P+  A   GH  +V +L+  +
Sbjct:   54 LEKALDYIKNGVDINICN-QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEND 196          

HSP 33 Score: 60.4622 bits (145), Expect = 5.865e-8
Identity = 37/148 (25.00%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H +   GH ++   LL     ++   K    P+H A + G  E+  LL+      +   ++ LTP+H A  Y    V  +LL          K+   P+H A     + I   L+    +  A T++  + + LA+Q+G   +V LL
Sbjct:  536 LHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 683          

HSP 34 Score: 56.9954 bits (136), Expect = 5.673e-7
Identity = 33/125 (26.40%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  635 ADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+ +Y R    A + GH E     +    D  + ++N L  +H A   G+ +V++ LL     V+   K     +H A   G   +VK+L++   N+ A ++  ++PL +A+Q+   ++V+ L D
Sbjct:   41 ANASYLR----AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLD 161          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A182GGY8 (ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.968e-61
Identity = 61/161 (37.89%), Postives = 107/161 (66.46%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +  +P+H A QNGH + V +L++    IEA ++ +  P+H+AC NGH  VV +LI E  +IE  ++D   P+H +C++ H E+V++L++ K N+EA +++   P+H AC  G+ E+V++LI  +  ++A +     P+H AS+ GH+++V+IL+ E+ NIE
Sbjct: 1398 KKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIE 1558          

HSP 2 Score: 129.413 bits (324), Expect = 1.968e-61
Identity = 59/164 (35.98%), Postives = 98/164 (59.76%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +EK  ++   Q++   +H AC  GH  +VE+L+     I A  ++   P+H ACQNGH E+V++LV  K + +   E K TP+H AC  G+ +V+ +L+     ++   +    P+H AC  GH  +V+IL+ +  NIEA  ++NW+PL LA +KG  ++V++L
Sbjct: 1552 REKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKIL 1715          

HSP 3 Score: 133.265 bits (334), Expect = 4.609e-59
Identity = 65/165 (39.39%), Postives = 104/165 (63.03%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            + +P+H A QNGH + V +L+K N  I+A  +    P+H AC  GH   V++LI E  +I+  D++K  P+H ACQN H E+V++L+K K N++A  +    P+H AC +G+ E+V++LI  +  +DA +   S P+H A   GH E+V+IL+  + NIE  ++V
Sbjct: 1267 NWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQV 1431          

HSP 4 Score: 126.331 bits (316), Expect = 4.609e-59
Identity = 64/191 (33.51%), Postives = 112/191 (58.64%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE----LGIQCFDG 1072
            +EK  ++   QD+   +H +C  GH  +VE+L+ +   I A +++   P+H ACQ+GH E+V++L+  + + E  ++   TP+H A + G+  V+ +L+     +E   +++  P+H AC  GH  +V+ILI    NIEA T++NW+PL  A Q G +++VE+L     +  ID+L E+    L + C +G
Sbjct: 1453 REKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEIL--VKEKANIDALAEKKFTPLHLACQNG 1641          

HSP 5 Score: 130.954 bits (328), Expect = 3.609e-57
Identity = 61/158 (38.61%), Postives = 99/158 (62.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+A QNG  + V +L++    IEA ++ +  P+H ACQNGH  VV +LI E  +I+   + K  P+H AC   H E V++L+  K N++A D+N   P+H AC +G+ E+V++L+  +  +DA +     P+H A   GH E+V+IL+ E+ NI+
Sbjct: 1236 TPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANID 1393          

HSP 6 Score: 122.479 bits (306), Expect = 3.609e-57
Identity = 64/191 (33.51%), Postives = 110/191 (57.59%), Query Frame = 2
Query:  515 EKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLVEE----LGIQCFDG 1072
            EK  +    +     +H AC  GH  +VE+L+     I A ++    P+H AC NGH E+V++L+  K + E  +++  TP+H +C +G+ +V+ +L+     +E  ++D+  P+H AC  GH  +V+ILI +  NIEA  + N++PL +AS  G  ++VE+L   +R K  I++L +E    L + C +G
Sbjct: 1388 EKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEIL---IREKANIEALGQENWTPLHLACRNG 1575          

HSP 7 Score: 133.65 bits (335), Expect = 3.731e-57
Identity = 60/164 (36.59%), Postives = 99/164 (60.37%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            KEK  +    +     +H AC  GH  +VE+L+ +   I+A  +    P+H ACQNGH E+V++L+  K + E  ++   TP+H+AC  G+ +V+ +L+     +E  ++D+  P+H +C  GH  +V+ILI +  NIEA  ++NW+PL LA Q G  ++VE+L
Sbjct: 1354 KEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEIL 1517          

HSP 8 Score: 119.783 bits (299), Expect = 3.731e-57
Identity = 60/162 (37.04%), Postives = 98/162 (60.49%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            + +H +A +GH   V LLL +   + A D  +  P+H+AC +G   VV +LI    +I+   K+K  P+HFACQN   E+V++L++ K N+EA +++   P+H AC +G+ E+V++LI     +DA +     P+H A   GH E V+IL+ E+ NI+  D+
Sbjct: 1170 TALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDE 1331          

HSP 9 Score: 135.191 bits (339), Expect = 7.362e-57
Identity = 63/158 (39.87%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A QNGH + V +L+K    I+A  +    P+H ACQNGH  VV +LI E  +I+   + K  P+H ACQN H E+V++L++ K N+EA ++    P+H+AC +G+ E+V++LI  +  ++A +     P+H +  +GH E+V+IL+ E+ NIE
Sbjct: 1335 TPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIE 1492          

HSP 10 Score: 117.087 bits (292), Expect = 7.362e-57
Identity = 62/191 (32.46%), Postives = 108/191 (56.54%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE----LGIQCFDG 1072
            +EK  ++   QD+   +H AC  GH  +VE+L+ +   I A ++    P+H A  NGH ++V++L+  K + E   +   TP+H AC  G+ +V+ +L+     +E   +D+  P+H AC  GH  +V+IL+ +  NI+A  ++ ++PL LA Q G  ++VE+L     +  ID+L E+    L + C +G
Sbjct: 1486 REKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIG--EKANIDALTEKKSTPLHLACQNG 1674          

HSP 11 Score: 125.946 bits (315), Expect = 6.044e-56
Identity = 60/162 (37.04%), Postives = 98/162 (60.49%), Query Frame = 2
Query:  518 KDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            K  ++   QD+   +H AC  GH  +VE+L+ +   I+A  +    P+H ACQNGH E+V++L+  K + +   E K TP+H AC  G+ +V+ +L+     +E  ++D+  P+H AC  GH  +VKILI +  NI+A T++  +PL LA Q+G  ++VE+ 
Sbjct: 1587 KANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIF 1748          

HSP 12 Score: 123.25 bits (308), Expect = 6.044e-56
Identity = 56/160 (35.00%), Postives = 102/160 (63.75%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            + +P+H+A  NGH + V +L++    IEA ++ +  P+H +C++GH  VV +LI E  +IE  ++D   P+H ACQ+ H E+V++L++ + N+EA ++    P+H A ++G+ ++V++LI  +  ++A       P+H A   GH E+V+IL+  + NIE
Sbjct: 1432 NWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIE 1591          

HSP 13 Score: 129.413 bits (324), Expect = 1.092e-52
Identity = 62/158 (39.24%), Postives = 98/158 (62.03%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A QNGH + V +L+     I+A  +    P+H ACQNGH  VV +LI    +IE  ++    P+HFAC N H E+V++L++ K N+EA +++   P+H +C HG+ E+V++LI  +  ++A +     P+H A   GH E+V+IL+ E  NIE
Sbjct: 1368 TPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIE 1525          

HSP 14 Score: 108.997 bits (271), Expect = 1.092e-52
Identity = 54/164 (32.93%), Postives = 94/164 (57.32%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +E+  ++   Q +   +H A   GH  +VE+L+ +   I A  +    P+H AC+NGH E+V++L+  K + E   ++  TP+H AC  G+ +V+ +L+     ++   +    P+H AC  GH  +V+ILI +  NI+A T++  +PL LA Q G  ++VE+L
Sbjct: 1519 REEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEIL 1682          

HSP 15 Score: 117.472 bits (293), Expect = 1.312e-51
Identity = 55/169 (32.54%), Postives = 96/169 (56.80%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLR 1018
            KEK  +    +     +H AC  GH  +VE+L+ +   I+A  +    P+H ACQNGH E+V++LV  K + E  +++  TP+H AC  G+ +V+ +L+     ++   +    P+H AC  GH  +V+I + +N NI A   E  +PL+LASQ G +++ +++ +  +
Sbjct: 1618 KEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKEKAK 1786          

HSP 16 Score: 117.087 bits (292), Expect = 1.312e-51
Identity = 56/160 (35.00%), Postives = 100/160 (62.50%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            + +P+H + ++GH + V +L++    IEA ++ +  P+H ACQ+GH  VV +LI E  +IE  ++    P+H A  N H ++V++L++ K N+EA  +    P+H AC +G+ E+V++LI  +  ++A +     P+H A   GH E+V+IL+ E+ NI+
Sbjct: 1465 NWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANID 1624          

HSP 17 Score: 128.642 bits (322), Expect = 4.149e-50
Identity = 66/191 (34.55%), Postives = 104/191 (54.45%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLVEELGIQCFDGCSH 1081
            KE   +    +     +H AC RGH   V++L+ +   I+A D+N   P+H ACQNGH E+V++LV  K + +   E K TP+H AC  G+ +V+ +L+     ++   +    P+H AC  GH  +V+ILI    NIEA  + NW+PL  A   G  ++VE+L   +R K+ I++L ++        C H
Sbjct: 1288 KENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEIL---IREKVNIEALNQDNWTPLHLSCRH 1475          

HSP 18 Score: 101.293 bits (251), Expect = 4.149e-50
Identity = 50/156 (32.05%), Postives = 90/156 (57.69%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA +G ++ V  L+ +   + AP       +H +  +GH  +V LL+  G ++   D ++  P+H+AC +   E+V++L+  K N++A  KN   P+H+AC +G  E+V++LI  +  ++A +     P+H A   GH E+V+IL+ E  NI+
Sbjct: 1139 MHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANID 1294          

HSP 19 Score: 119.398 bits (298), Expect = 8.756e-35
Identity = 58/164 (35.37%), Postives = 97/164 (59.15%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +EK  ++   Q +   +H AC  GH  +VE+L+ ++  I+A  ++   P+H AC  GH E V++L+  K + +  DENK TP+H AC  G+ +V+ +L+     ++   +    P+H AC  GH  +V+ILI +  NI+A T++  +PL LA Q G  ++VE+L
Sbjct: 1255 REKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEIL 1418          

HSP 20 Score: 58.9214 bits (141), Expect = 8.756e-35
Identity = 55/224 (24.55%), Postives = 85/224 (37.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRL----LISEGCSIEICD----------------------------KDKRKPI-HFACQNNHVEIVKLLLKSKCN---------------------------------LEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            S +HYA  +  +     L+     +    +  + P++ A   GH  VV L    LI +  S  I D                            KD   P+ H A  +  +E VK L+ +  N                                 + A+D N   P+H+AC  G  E+V++LI  +  +DA +   S P+HFA   G  E+V+IL+ E+ NIE
Sbjct: 1038 SALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIE 1261          

HSP 21 Score: 132.88 bits (333), Expect = 3.279e-28
Identity = 64/158 (40.51%), Postives = 99/158 (62.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A+ NGH   V +L++    IEA  + +  P+H AC+NGH  VV +LI    +IE   +D   P+H ACQN H E+V++L+K K N++A  +    P+H AC +G+ E+V++LI  +  +DA +   S P+H A   GH E+V+IL+ E+ NIE
Sbjct: 1533 TPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIE 1690          

HSP 22 Score: 132.88 bits (333), Expect = 4.128e-28
Identity = 65/163 (39.88%), Postives = 99/163 (60.74%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            + +P+H A QNGH + V +L+K    I+A  +    P+H ACQNGH  VV +LI E  +I+   + K  P+H ACQN H E+V++L+  K N+EA +++   P+H AC  G+ E+VK+LI  +  +DA +   + P+H A   GH E+V+I L +  NI   D
Sbjct: 1597 NWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALD 1759          

HSP 23 Score: 130.568 bits (327), Expect = 2.047e-27
Identity = 59/160 (36.88%), Postives = 102/160 (63.75%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            + +P+H A Q+GH + V +L++    IEA ++++  P+H A  NGH  VV +LI E  +IE   ++   P+H AC+N H E+V++L++ K N+EA  ++   P+H AC +G+ E+V++L+  +  +DA +     P+H A   GH E+V+IL+ E+ NI+
Sbjct: 1498 NWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANID 1657          

HSP 24 Score: 127.872 bits (320), Expect = 1.645e-26
Identity = 66/191 (34.55%), Postives = 113/191 (59.16%), Query Frame = 2
Query:  515 EKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLVEE----LGIQCFDG 1072
            EK  +    ++    +H AC  GH  +VE+L+ +   I+A  +    P+H ACQNGH E+V++L+  K + +   E K TP+H AC  G+ +V+ +L+     +E  ++ +  P+H+AC  GH  +V+ILI +  NIEA  ++NW+PL L+ + G  ++VE+L   +R K+ I++L ++    L + C DG
Sbjct: 1322 EKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEIL---IREKVNIEALNQDNWTPLHLACQDG 1509          

HSP 25 Score: 127.872 bits (320), Expect = 1.660e-26
Identity = 62/158 (39.24%), Postives = 98/158 (62.03%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A   GH +AV +L+     I+A D+    P+H ACQNGH  VV +L+ E  +I+   + K  P+H ACQN H E+V++L+  K N++A  +    P+H AC +G+ E+V++LI  +  ++A +     P+HFA   GH E+V+IL+ E+ NIE
Sbjct: 1302 TPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIE 1459          

HSP 26 Score: 127.487 bits (319), Expect = 2.106e-26
Identity = 60/161 (37.27%), Postives = 100/161 (62.11%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
             + +P+H A +NGH + V +L++    IEA  + +  P+H ACQNGH  VV +L+ E  +I+   + K  P+H ACQN H E+V++L+  K N++A  +    P+H AC +G+ E+V++L+  +  ++A +     P+H A   GH E+VKIL+ E+ NI+
Sbjct: 1563 ENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANID 1723          

HSP 27 Score: 119.783 bits (299), Expect = 5.080e-24
Identity = 55/162 (33.95%), Postives = 100/162 (61.73%), Query Frame = 2
Query:  518 KDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            K  ++   Q +   +H+AC  GH  +VE+L+ +   I A +++   P+H +C++GH E+V++L+  K + E  +++  TP+H AC  G+ +V+ +L+     +E  ++ +  P+H A + GH  +V+ILI +  NIEA  +ENW+PL LA + G  ++VE+L
Sbjct: 1422 KANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEIL 1583          

HSP 28 Score: 116.316 bits (290), Expect = 6.837e-23
Identity = 59/189 (31.22%), Postives = 107/189 (56.61%), Query Frame = 2
Query:  518 KDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE----LGIQCFDG 1072
            K  +    ++    +H+AC  G   +VE+L+ +   I A +++   P+H ACQNGH E+V++L+    + +   E+K TP+H AC  G+ + + +L+     ++  D++   P+H AC  GH  +V+IL+ +  NI+A  ++ ++PL LA Q G  ++VE+L     +  ID+L E+    L + C +G
Sbjct: 1224 KANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIG--EKANIDALTEKKSTPLHLACQNG 1410          

HSP 29 Score: 116.316 bits (290), Expect = 7.142e-23
Identity = 59/158 (37.34%), Postives = 94/158 (59.49%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+A  +G  + V +L+     I+A  K    P+H+ACQNG   VV +LI E  +IE  ++    P+H ACQN H E+V++L+K   N++A  ++   P+H AC  G+ E V++LI  +  +DA       P+H A   GH E+V+IL+ E+ NI+
Sbjct: 1203 TPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANID 1360          

HSP 30 Score: 116.316 bits (290), Expect = 7.527e-23
Identity = 56/149 (37.58%), Postives = 91/149 (61.07%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H +   GH  IVE+LL     +NAAD N   P+H AC +G  E+V++L+  K + +   +NK TP+H+AC  G  +V+ +L+     +E  ++ +  P+H AC  GH  +V+ILI +N NI+A T+  ++PL LA  +G  + V++L
Sbjct: 1171 ALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQIL 1319          

HSP 31 Score: 113.235 bits (282), Expect = 5.908e-22
Identity = 60/176 (34.09%), Postives = 100/176 (56.82%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE----LGIQCFDG 1072
             +H+AC  G   +VE+L+     I+A  KN   P+H ACQNG  E+V++L+  K + E  +++  TP+H AC  G+ +V+ +L+  N  ++   +    P+H AC  GH   V+ILI +  NI+A  +  ++PL  A Q G +++VE+L     +  ID+L E+    L + C +G
Sbjct: 1204 PLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEIL--VKEKANIDALAEKKFTPLHLACQNG 1377          

HSP 32 Score: 112.849 bits (281), Expect = 7.810e-22
Identity = 61/167 (36.53%), Postives = 95/167 (56.89%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI---SNQCCLDAESLTGSRPIHFASFYGHDEIVKIL-------LSERCNI 480
            +P+H A QNGH + V +L+     I+A  +    P+H ACQNGH  VV +L+ E  +IE  ++D   P+H AC+  H E+VK+L+  K N++A  +    P+H AC  G+ E+V++ +   +N   LD E  T   P++ AS  GH E+ KI+        S+RC +
Sbjct: 1632 TPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCT---PLNLASQNGHTEVEKIMKEKAKFHASKRCTV 1795          

HSP 33 Score: 99.7525 bits (247), Expect = 1.076e-17
Identity = 50/152 (32.89%), Postives = 81/152 (53.29%), Query Frame = 2
Query:  548 SGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             G  +H A   G +  V+ L+     +NA        +H +  +GH  IV+LL+    +    D N+ TP+H+AC  G  +V+ +L+     ++   K+   P+H+AC  G   +V+ILI +  NIEA  + NW+PL LA Q G  ++VE+L
Sbjct: 1135 DGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEIL 1286          

HSP 34 Score: 91.6633 bits (226), Expect = 3.193e-15
Identity = 42/120 (35.00%), Postives = 71/120 (59.17%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLL 360
            +  +P+H A QNGH + V +L+     IEA ++ +  P+H AC+ GH  VV++LI E  +I+   + K  P+H ACQ  H E+V++ L+   N+ A D     P++ A  +G+ E+ K++
Sbjct: 1662 KKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIM 1781          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 4.216e-57
Identity = 60/160 (37.50%), Postives = 99/160 (61.88%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
             ++P+H A+QNGH+  V LL+ +   ++        P+H A +NG+L VV+LLI  G +++    +   P+H A +N H+E+VKLL+ ++ N++     G  P+H A  +G++E+VKLLI N+  +D +   G  P+HFAS  GH E+VK L+  R N++
Sbjct:   19 GRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVD 178          

HSP 2 Score: 112.464 bits (280), Expect = 4.216e-57
Identity = 53/157 (33.76%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  542 QDSG-RAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            QD G   +H A   GHL +V++L+     ++        P+H A QNGH E+VK L+  + + +   +   TP+H A   G+ +V+ +L+ N   V+        P+H A   GHL +VK LI    N++    E W+PL +ASQ G  ++V+LL D
Sbjct:  181 QDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLID 337          

HSP 3 Score: 133.65 bits (335), Expect = 7.360e-56
Identity = 57/158 (36.08%), Postives = 99/158 (62.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+A+QNGH++ V LL+++   +         P+H+A +NGHL VV+LLI    +++    +   P++ A  N H+E+VKLL+ ++ N++ +   G  P++ A  +G++E+VKLLI N+  +D     G  P+H AS  GH E+VK+L+  R N++
Sbjct:  395 TPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVD 552          

HSP 4 Score: 115.546 bits (288), Expect = 7.360e-56
Identity = 55/173 (31.79%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  518 KDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            K  V     +    +H A   GHL +V++L+     ++        P+H A QNGH E+VKLL+  + + +       TP+H A   G+ +V+ +L+ N   V+        P+H+A   GHL +VK+LI    N++    E W+PL +ASQ G  ++V+LL D   R  +D+
Sbjct:  581 KANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLID--NRANVDT 751          

HSP 5 Score: 136.732 bits (343), Expect = 3.272e-55
Identity = 59/160 (36.88%), Postives = 96/160 (60.00%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
               +P+H+A+QNGH++ V  L+ +   ++        P+H A +NGHL VV+LLI    +++        P+H A QN H+E+VK L+ ++ N++ +   G  P+H A  +G++E+VKLLI N+  +D     G  P+HFAS  GH E+VK+L+  R N+
Sbjct:  216 EGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANV 375          

HSP 6 Score: 110.153 bits (274), Expect = 3.272e-55
Identity = 50/160 (31.25%), Postives = 86/160 (53.75%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
             +H+A   GHL +V++L+     +         P+H A +NGH E+VKLL+  + + +       TP++ A   G+ +V+ +L+ N   V+    +   P++ A   GHL +VK+LI    N++    E W+PL +ASQ G  ++V+LL D   R  +D+
Sbjct:  396 PLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLID--NRANVDT 553          

HSP 7 Score: 131.724 bits (330), Expect = 1.554e-54
Identity = 60/169 (35.50%), Postives = 104/169 (61.54%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH----------NNA-IEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+A+QNGH++ V LL+ +          N A ++        P+H+A QNGHL VV+LLI    ++     +   P+HFA +N H+E+VKLL++++ N++ +   G  P++ A  +G++E+VKLLI+N+  +D     G  P++ AS  GH E+VK+L+  + N++
Sbjct:  351 TPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVD 519          

HSP 8 Score: 112.849 bits (281), Expect = 1.554e-54
Identity = 57/180 (31.67%), Postives = 91/180 (50.56%), Query Frame = 2
Query:  518 KDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL------SDTLRRKIIDSL 1039
            K  V     +    +H A   GHL +V++L+     ++        P++ A +NGH E+VKLL+  K + +  D    TP+H A   G+ +V+ +L+ N   V+        P+H+A   GHL +VK+LI    N++    E W+PL +ASQ G  ++V+LL       DT + K I  L
Sbjct:  515 KANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPL 694          

HSP 9 Score: 137.502 bits (345), Expect = 2.822e-54
Identity = 57/161 (35.40%), Postives = 98/161 (60.87%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
               +P+H A+QNGH++ V LL+++   ++        P+H+A QNGHL VV+ LI    +++    +   P+H A +N H+E+VKLL++++ N++     G  P+H A  +G++E+VK LI N+  +D     G  P+H AS  GH E+VK+L+  + N++
Sbjct:  183 EGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVD 343          

HSP 10 Score: 105.916 bits (263), Expect = 2.822e-54
Identity = 50/162 (30.86%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  557 AIHYACCRGHL-----------NIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
             +H+A   GHL           N+V++L+     ++        P+H A QNGH E+VKLL+  + +         TP+H+A   G+ +V+ +L+ N   V+    +   P++ A   GHL +VK+LI+   N++    E W+PL +AS+ G  ++V+LL D
Sbjct:  352 PLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLID 513          

HSP 11 Score: 134.42 bits (337), Expect = 1.914e-53
Identity = 58/163 (35.58%), Postives = 98/163 (60.12%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
               +P+H AA+NG+++ V LL+ +   ++        P+H A +NGHL VV+LLI    +++        P+H A QN H+E+VKLL++++ N++     G  P+H+A  +G++E+VK LI N+  +D     G  P+H AS  GH E+VK+L+  R N++ +
Sbjct:   51 EGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTK 213          

HSP 12 Score: 106.686 bits (265), Expect = 1.914e-53
Identity = 52/173 (30.06%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVE 1045
            V     +    +H+A   GHL +V+ L+     ++        P+H A +NGH E+VKLL+  + + + +     TP+H A   G+ +V+  L+ N   V+    +   P+H A   GHL +VK+LI    N++    +  +PL  ASQ G  ++V+LL D  R  ++  L+E
Sbjct:  210 VDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDN-RANVVKLLIE 381          

HSP 13 Score: 127.487 bits (319), Expect = 9.473e-53
Identity = 56/146 (38.36%), Postives = 90/146 (61.64%), Query Frame = 1
Query:   52 VSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            V  L+ HN  I+  +   R P+H A QNGHL VV+LLI  G +++    +   P+H A +N ++E+VKLL+ +  N++ +   G  P+H A  +G++E+VKLLI N+  +D +   G  P+H AS  GH E+VK+L+  R N++ +
Sbjct:    2 VKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTK 147          

HSP 14 Score: 111.309 bits (277), Expect = 9.473e-53
Identity = 52/170 (30.59%), Postives = 87/170 (51.18%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            V     +    +H+A   GHL +V+ L+     ++        P+H A QNGH E+VKLL+  + + + +     TP+H+A   G+ +V+  L+ N   V+    +   P+H A   GHL +VK+LI    N++      W+PL +ASQ G  ++V+ L D   R  +D+
Sbjct:  144 VDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLID--NRANVDT 311          

HSP 15 Score: 142.51 bits (358), Expect = 1.932e-52
Identity = 62/161 (38.51%), Postives = 99/161 (61.49%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
               +P+H AA+NGH++ V LL+ +   ++        P+H A QNGHL VV+LLI    +++    +   P+HFA QN H+E+VK L+ ++ N++ +   G  P+H A  +G++E+VKLLI N+  +D +   G  P+HFAS  GH E+VK L+  R N++
Sbjct:   84 EGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVD 244          

HSP 16 Score: 94.7449 bits (234), Expect = 1.932e-52
Identity = 50/166 (30.12%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  542 QDSG-RAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHL-----------HIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            QD G   +H A   GHL +V++L+     ++        P+H A QNGH E+VK L+  + + +       TP+H A   G+ +V+ +L+ N   V+        P+H+A   GHL           ++VK+LI    N++    +  +PL  ASQ G  ++V+LL
Sbjct:  247 QDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLL 412          

HSP 17 Score: 129.798 bits (325), Expect = 3.843e-52
Identity = 56/164 (34.15%), Postives = 101/164 (61.59%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
               +P+H+A++NGH++ V LL+++   ++        P++ A  NGHL VV+LLI+   +++    +   P++ A +N H+E+VKLL+ +K N++ +   G  P+H A  +G++E+VKLLI N+  +D     G  P++ AS  GH E+VK+L+  + N++  D
Sbjct:  425 EGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTD 588          

HSP 18 Score: 106.686 bits (265), Expect = 3.843e-52
Identity = 51/164 (31.10%), Postives = 88/164 (53.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
             +H+A   GHL +V++L+     ++        P+H A QNGH E+VKLL+  + + +      +TP+H+A   G+ +V+ +L+ N   V+    +   P+H A   GHL +VK+LI    N++    +  +PL +AS  G  ++V+LL D   R  +D+   E
Sbjct:  627 PLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLID--NRANVDTTQNE 788          

HSP 19 Score: 111.309 bits (277), Expect = 6.879e-43
Identity = 48/149 (32.21%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   GHL +V++L+     ++        P+H A QNGH E+VK L+  + + +   +   TP+H A   G+ +V+ +L+ N   V+    +   P+H+A   GHL +VK LI    N++    E W+PL LA++ G  ++V+LL
Sbjct:  121 PLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLL 269          

HSP 20 Score: 94.3597 bits (233), Expect = 6.879e-43
Identity = 41/114 (35.96%), Postives = 67/114 (58.77%), Query Frame = 1
Query:  148 VVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            +V+ LI    +I+  +   R P+H A QN H+++VKLL+ +  N++     G  P+H A  +G +E+VKLLI N   +D     G  P+H A+  GH E+VK+L+  R N++ +
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTK 114          

HSP 21 Score: 144.821 bits (364), Expect = 2.901e-32
Identity = 61/161 (37.89%), Postives = 103/161 (63.98%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
               +P+H A+QNGH++ V LL+++   ++        P+H+A QNGHL VV+LLI    +++    +   P+H A QN H+E+VKLL++++ N++ +   G+ P+H+A  +G++E+VKLLI N+  +D     G  P+H AS  GH E+VK+L+  R N++
Sbjct:  590 EGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVD 750          

HSP 22 Score: 142.51 bits (358), Expect = 1.463e-31
Identity = 62/158 (39.24%), Postives = 100/158 (63.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P++ A++NGH++ V LL+ +   ++  D     P+H A QNGHL VV+LLI    +++        P+HFA QN H+E+VKLL+ ++ N++ +   G  P+H A  +G++E+VKLLI N+  +D     G  P+HFAS  GH E+VK+L+  R N++
Sbjct:  560 TPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVD 717          

HSP 23 Score: 141.739 bits (356), Expect = 2.956e-31
Identity = 61/158 (38.61%), Postives = 99/158 (62.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+A+QNGH++ V LL+ +   ++        P+H A QNGHL VV+LLI    +++        P+HFA QN H+E+VKLL+ ++ N++ +   G  P+H A  +G++E+VKLLI N+  +D     G  P++ AS  GH E+VK+L+  R N++
Sbjct:  626 TPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVD 783          

HSP 24 Score: 140.969 bits (354), Expect = 4.201e-31
Identity = 60/161 (37.27%), Postives = 102/161 (63.35%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
               +P+H A+QNGH++ V LL+ +   ++        P++ A +NGHL VV+LLI    +++  D +   P+H A QN H+E+VKLL++++ N++ +   G+ P+H+A  +G++E+VKLLI N+  +D     G  P+H AS  GH E+VK+L+  R N++
Sbjct:  524 EGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVD 684          

HSP 25 Score: 140.198 bits (352), Expect = 7.213e-31
Identity = 60/161 (37.27%), Postives = 98/161 (60.87%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
               +P+H+A+QNGH++ V  L+ +   ++        P+H A QNGHL VV+LLI    +++    +   P+HFA QN H+E+VK L+ ++ N++ +   G  P+H A  +G++E+VKLLI N+  +D +   G  P+H AS  GH E+VK L+  R N++
Sbjct:  150 EGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVD 310          

HSP 26 Score: 139.813 bits (351), Expect = 1.152e-30
Identity = 58/160 (36.25%), Postives = 100/160 (62.50%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQ 489
            +P+H A+QNGH++ V LL+++   ++        P+H+A QNGHL VV+ LI    +++    +   P+H A QN H+E+VKLL++++ N++     G  P+H+A  +G++E+VK LI N+  +D     G  P+H A+  GH E+VK+L+  R N++ +
Sbjct:  120 TPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTK 279          

HSP 27 Score: 136.346 bits (342), Expect = 1.362e-29
Identity = 60/161 (37.27%), Postives = 99/161 (61.49%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
               +P++ A++NGH++ V LL+ +   ++        P+H A QNGHL VV+LLI    +++        P++ A +N H+E+VKLL+ +K N++ +D  G  P+H A  +G++E+VKLLI N+  +D     G  P+HFAS  GH E+VK+L+  R N++
Sbjct:  491 EGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVD 651          

HSP 28 Score: 129.413 bits (324), Expect = 2.701e-27
Identity = 56/161 (34.78%), Postives = 98/161 (60.87%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
               +P++ A+ NGH++ V LL+ +   ++        P++ A +NGHL VV+LLI    +++    +   P+H A QN H+E+VKLL+ ++ N++ +   G+ P++ A  +G++E+VKLLI N+  +D     G  P+H AS  GH E+VK+L+  R N++
Sbjct:  458 EGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVD 618          

HSP 29 Score: 115.546 bits (288), Expect = 6.374e-23
Identity = 56/170 (32.94%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  542 QDSG-RAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            QD G   +H A   GHL +V++L+     ++        P+H A QNGH E+VKLL+  + + + +     TP+H+A   G+ +V+  L+ N   V+    +   P+H A   GHL +VK+LI    N++    E W+PL  ASQ G  ++V+ L D   R  +D+  +E
Sbjct:   82 QDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLID--NRANVDTTQDE 249          

HSP 30 Score: 114.39 bits (285), Expect = 1.593e-22
Identity = 48/134 (35.82%), Postives = 83/134 (61.94%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTG 402
               +P+H A+QNGH++ V LL+++   ++        P+H+A QNGHL VV+LLI    +++    +   P+H A QN H+E+VKLL+ ++ N++ +   G+ P++ A  +G++E+VKLLI N+  +D     G
Sbjct:  656 EGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQNEG 789          

HSP 31 Score: 110.538 bits (275), Expect = 2.367e-21
Identity = 48/149 (32.21%), Postives = 82/149 (55.03%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
             +H A   G+L +V++L+     ++        P+H A +NGH E+VKLL+  + + + +     TP+H A   G+ +V+ +L+ N   V+    +   P+H+A   GHL +VK LI    N++    E W+PL +ASQ G  ++V+LL
Sbjct:   55 PLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLL 203          

HSP 32 Score: 109.383 bits (272), Expect = 6.551e-21
Identity = 52/164 (31.71%), Postives = 88/164 (53.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
             ++ A   GHL +V++L+     ++  D     P+H A QNGH E+VKLL+  + + +      +TP+H+A   G+ +V+ +L+ N   V+    +   P+H A   GHL +VK+LI    N++    +  +PL  ASQ G  ++V+LL D   R  +D+   E
Sbjct:  561 PLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLID--NRANVDTTQNE 722          

HSP 33 Score: 107.071 bits (266), Expect = 2.985e-20
Identity = 53/169 (31.36%), Postives = 88/169 (52.07%), Query Frame = 2
Query:  545 DSGRA-IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            + GR  +H A   GHL +V++L+     ++        P+H A +NG+ E+VKLL+    + +   +   TP+H A   G+ +V+ +L+ N   V+        P+H A   GHL +VK+LI    N++    E W+PL  ASQ G  ++V+ L D   R  +D+  +E
Sbjct:   17 NGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLID--NRANVDTTQDE 183          

HSP 34 Score: 105.531 bits (262), Expect = 9.734e-20
Identity = 52/174 (29.89%), Postives = 89/174 (51.15%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            V     +    ++ A   GHL +V++L+     ++        P+H A QNGH E+VKLL+  + + +      +TP++ A   G+ +V+ +L+ N   V+  D +   P+H A   GHL +VK+LI    N++    +  +PL  ASQ G  ++V+LL D   R  +D+   E
Sbjct:  485 VDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLID--NRANVDTTQNE 656          

HSP 35 Score: 103.605 bits (257), Expect = 3.615e-19
Identity = 53/177 (29.94%), Postives = 88/177 (49.72%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL------SDTLRRKIIDSL 1039
            V     +    ++ A   GHL +V++L+     ++        P++ A +NGH E+VKLL+  K + +       TP+H A   G+ +V+ +L+ N   V+        P++ A   GHL +VK+LI    N++    E W+PL +ASQ G  ++V+LL       DT + K I  L
Sbjct:  452 VDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPL 628          

HSP 36 Score: 103.605 bits (257), Expect = 4.085e-19
Identity = 47/137 (34.31%), Postives = 77/137 (56.20%), Query Frame = 2
Query:  593 IVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +V+ L+  +  I+ A+   R P+H A QNGH ++VKLL+    + +   +   TP+H A   GY +V+ +L+ N   V+    +   P+H A   GHL +VK+LI    N++      W+PL +ASQ G  ++V+LL
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLL 137          

HSP 37 Score: 96.6709 bits (239), Expect = 6.437e-17
Identity = 46/161 (28.57%), Postives = 84/161 (52.17%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V     +    +H+A   GHL +V++L+     ++        P++ A  NGH E+VKLL++ + + +       TP++ A   G+ +V+ +L+ N   V+    +   P+H A   GHL +VK+LI    N++    +  +PL +AS+ G  ++V+LL D
Sbjct:  419 VGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLID 579          

HSP 38 Score: 73.559 bits (179), Expect = 1.082e-9
Identity = 35/115 (30.43%), Postives = 62/115 (53.91%), Query Frame = 2
Query:  692 IVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            +VK L+ +  + +  +    TP+H A   G+  V+ +L+ N   V+    +   P+H A   G+L +VK+LI    N++    E W+PL LA++ G  ++V+LL D   R  +D+
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLID--NRANVDT 113          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2J7R1I3 (ANK_REP_REGION domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G05487 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 7.537e-57
Identity = 67/163 (41.10%), Postives = 101/163 (61.96%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            ++P+H AA+ GHV+ V  LL    +++ PDK  R P+H+A + GH+  VR L+S G S++I DKDKR P+HFA +N H+E+V  LL    ++E  DK+   P+H     G VE+V+ L+S    +D        P+HFA+  GH E+V  LLS   ++E++DK
Sbjct:  247 RTPLHLAAEFGHVEVVRELLSGGASVDIPDKDKRTPLHFAAETGHVEGVRELLSGGASVDIPDKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDK 409          

HSP 2 Score: 106.301 bits (264), Expect = 7.537e-57
Identity = 53/170 (31.18%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            V    +D    +H+A   GH+ +V  L +    +  ADK+   P+H A  +GH E+V+ L+S      V D+ K TP+H+A   G+ +V+  L+     V+V DKD   P+++A   GH+ +V+ L+S   ++    K   +PL  A++ G +++V ELLS      + D
Sbjct:  437 VDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVAD 606          

HSP 3 Score: 139.813 bits (351), Expect = 2.746e-56
Identity = 63/163 (38.65%), Postives = 104/163 (63.80%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            ++P+H+AA+NGH++ VS LL   +++E  DK    P+H    +G++ VVR L+S G S++I DKDKR P+HFA ++ HVE+V+ L     ++  +DK+   P+H A   G+VE+V+ L+SN   ++        P+HFA+  GH E+V  L+S   ++++ DK
Sbjct:  379 RTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADK 541          

HSP 4 Score: 110.538 bits (275), Expect = 2.746e-56
Identity = 54/170 (31.76%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            V    +D    +++A   GH+ +V  LL+    +N ADK  R P+H A ++G  E+V+ L+S     +V D+ K TP+H+A    + +V+  LL N   V++ DKD   P+H A   GH+ + + L+    ++       W+PL LA++ G   +V ELLS      + D
Sbjct:  536 VDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITDGAGWTPLHLAAESGHVGVVRELLSKGASLHVAD 705          

HSP 5 Score: 137.887 bits (346), Expect = 4.840e-54
Identity = 61/163 (37.42%), Postives = 103/163 (63.19%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            ++P+H+AA+ GHV+ V  LL    +++ PDK  R P+H+A +NGHL VV  L+S G S+EI DKDK  P+H    + +VE+V+ LL    +++ +DK+   P+H+A  +G++E+V  L+S    ++ E      P+H  +  G+ E+V+ LLS   ++++ DK
Sbjct:  280 RTPLHFAAETGHVEGVRELLSGGASVDIPDKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADK 442          

HSP 6 Score: 105.145 bits (261), Expect = 4.840e-54
Identity = 56/178 (31.46%), Postives = 93/178 (52.25%), Query Frame = 2
Query:  503 KIEKEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            K++     V    +D    +H A   GH+ +V  LL+    +N ADK  R P+H A ++GH E+V  L+S     +V D++K TP+++A   G+ +V+  LL N   V V DK    P+H+A   G   +V+ L+S   +++   K   +PL  A++    ++V ELL++     I D
Sbjct:  462 KLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIAD 639          

HSP 7 Score: 137.502 bits (345), Expect = 1.364e-53
Identity = 62/163 (38.04%), Postives = 103/163 (63.19%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            ++P+H AA++GHV+ V  LL  +  +   D+F+R P+H A + GH+ VVR L+S G S++I DKDKR P+HFA +  HVE V+ LL    +++  DK+   P+H+A  +G++E+V  L+S    ++ E      P+H  +  G+ E+V+ LLS   ++++ DK
Sbjct:  214 RTPLHLAAESGHVEVVRELLSKDAGMNVTDEFERTPLHLAAEFGHVEVVRELLSGGASVDIPDKDKRTPLHFAAETGHVEGVRELLSGGASVDIPDKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADK 376          

HSP 8 Score: 103.605 bits (257), Expect = 1.364e-53
Identity = 53/170 (31.18%), Postives = 91/170 (53.53%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            V+   +D    +H     G++ +V  LL+    ++ ADK+ R P+H A ++GH E+V+ L S      + D++K TP+H A   G+ +V+  LL N   V V DK    P+H+A   GH  +V  L+S   +++   K+  +PL  A++ G  ++V +LLS+     + D
Sbjct:  404 VEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVAD 573          

HSP 9 Score: 140.584 bits (353), Expect = 2.242e-53
Identity = 64/163 (39.26%), Postives = 100/163 (61.35%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            ++P+H+AA+NGH++ VS LL   +++E  DK    P+H    +G++ VVR L+S G S++I DKDKR P+HFA +N H+E+V  LL    ++E  DK+   P+H     G VE+V+ L+S    +D        P+HFA+  GH E+V+ L S   ++ + DK
Sbjct:  313 RTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADK 475          

HSP 10 Score: 100.138 bits (248), Expect = 2.242e-53
Identity = 52/166 (31.33%), Postives = 90/166 (54.22%), Query Frame = 2
Query:  545 DSGR--AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            D G+   +H+A   GH  +V  L++    ++ ADK+ R P++ A ++GH E+V+ L+S      V D+ K TP+H+A   G  +V+  LL     V+V DK    P+H+A    H+ +V+ L++   +++   K+  +PL LA+  G  ++  ELL +     I D
Sbjct:  507 DKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITD 672          

HSP 11 Score: 126.716 bits (317), Expect = 3.943e-47
Identity = 60/162 (37.04%), Postives = 96/162 (59.26%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H  A +G+V+ V  LL    +++  DK  R P+H+A ++GH+ VVR L S G S+ I DKDK  P+H A  + HVE+V+ LL +  ++  +DK    P+H+A   G+ E+V  L+S    +D        P++FA+  GH E+V+ LLS   ++ + DK
Sbjct:  413 TPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADK 574          

HSP 12 Score: 93.2041 bits (230), Expect = 3.943e-47
Identity = 46/155 (29.68%), Postives = 82/155 (52.90%), Query Frame = 2
Query:  545 DSGR--AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            D G+   +H+A   G   +V  LL+    ++ ADK  R P+H A ++ H E+V+ L++     ++ D++  TP+H A   G+ +V   LL N   V + D     P+H A   GH+ +V+ L+S+  ++    +   +PL LAS +G  +++  L
Sbjct:  573 DKGKRTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITDGAGWTPLHLAAESGHVGVVRELLSKGASLHVADEGGRTPLLLASMRGHVEVIREL 727          

HSP 13 Score: 119.013 bits (297), Expect = 4.589e-43
Identity = 57/170 (33.53%), Postives = 93/170 (54.71%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            V+   +D    +H     G++ +V  LL+    ++ ADK+ R P+H A +NGH E+V  L+S     E+ D++K TP+H     GY +V+  LL     V++ DKD   P+H+A   GH+ +V+ L S   ++    K+ W+PL LA+  G  ++V ELLS+     + D
Sbjct:  338 VEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVAD 507          

HSP 14 Score: 87.0409 bits (214), Expect = 4.589e-43
Identity = 52/165 (31.52%), Postives = 89/165 (53.94%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGH--LNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            Q+P+H AA+ G V+ VS+LL   + +E      +  I+   +  H   +++   +S+G  +     DKR P+H A ++ HVE+V+ LL     +  +D+    P+H A   G+VE+V+ L+S    +D        P+HFA+  GH E V+ LLS   ++++ DK
Sbjct:  153 QTPLHLAAKCGQVEIVSMLLTEVHQLE--KGLFQLNINSEGELEHEDTDLMSRFLSKGAGV-----DKRTPLHLAAESGHVEVVRELLSKDAGMNVTDEFERTPLHLAAEFGHVEVVRELLSGGASVDIPDKDKRTPLHFAAETGHVEGVRELLSGGASVDIPDK 310          

HSP 15 Score: 120.939 bits (302), Expect = 1.033e-42
Identity = 59/165 (35.76%), Postives = 91/165 (55.15%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            +D    +H+A   GH+  V  LL+    ++  DK+ R P+H A +NGH E+V  L+S     E+ D++K TP+H     GY +V+  LL     V++ DKD   P+H+A   GHL +V  L+S   ++E   K+ W+PL L +  G+ ++V ELLS      I D
Sbjct:  277 KDKRTPLHFAAETGHVEGVRELLSGGASVDIPDKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIAD 441          

HSP 16 Score: 83.9593 bits (206), Expect = 1.033e-42
Identity = 59/211 (27.96%), Postives = 98/211 (46.45%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSK-------CNLE-----ASDKNGL------RPIHYACFHGNVEIVKLLISN---------QCCLDAE-------------------SLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            + Q   H AA  GHV+ +  LL +  +++  +K  R P+H A +NGH+ VVR L+ +G ++ I DK  + P+H A +  H ++V+ LL          C  E     A+  NG+       P+H A   G VEIV +L++          Q  +++E                    +    P+H A+  GH E+V+ LLS+   + + D+
Sbjct:   34 KKQKNNHSAAPCGHVEVIRELLSNGASVDIAEKDGRTPLHLAAENGHIQVVRELLRKGANLHIADKYGKMPLHLAAEFGHADVVRQLLSRGTKVLNCVCQSETPLHLAAKWNGVCDCQLQTPLHLAAKCGQVEIVSMLLTEVHQLEKGLFQLNINSEGELEHEDTDLMSRFLSKGAGVDKRTPLHLAAESGHVEVVRELLSKDAGMNVTDE 244          

HSP 17 Score: 112.464 bits (280), Expect = 1.669e-42
Identity = 56/164 (34.15%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            D    +H A   GH+ +V  LL++   +N  D+  R P+H A + GH E+V+ L+S     ++ D++K TP+H+A   G+ + +  LL     V++ DKD   P+H+A   GHL +V  L+S   ++E   K+ W+PL L +  G+ ++V ELLS      I D
Sbjct:  212 DKRTPLHLAAESGHVEVVRELLSKDAGMNVTDEFERTPLHLAAEFGHVEVVRELLSGGASVDIPDKDKRTPLHFAAETGHVEGVRELLSGGASVDIPDKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIAD 375          

HSP 18 Score: 91.6633 bits (226), Expect = 1.669e-42
Identity = 56/178 (31.46%), Postives = 90/178 (50.56%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISN-----QCCLDAES-------LTG------SRPIHFASFYGHDEIVKILLSERCNIE 483
              +P+H AA++GH   +         +E  D   +   H A   GH+ V+R L+S G S++I +KD R P+H A +N H+++V+ LL+   NL  +DK G  P+H A   G+ ++V+ L+S       C   +E+         G        P+H A+  G  EIV +LL+E   +E
Sbjct:    2 GWTPLHLAAKSGHQAVIGEFEGGLFNLEVLDGKKQKNNHSAAPCGHVEVIRELLSNGASVDIAEKDGRTPLHLAAENGHIQVVRELLRKGANLHIADKYGKMPLHLAAEFGHADVVRQLLSRGTKVLNCVCQSETPLHLAAKWNGVCDCQLQTPLHLAAKCGQVEIVSMLLTEVHQLE 179          

HSP 19 Score: 127.872 bits (320), Expect = 8.926e-41
Identity = 58/163 (35.58%), Postives = 100/163 (61.35%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            ++P+H+AA++GHV+ V  L     ++   DK    P+H A  +GH+ VVR L+S G S+ + DK KR P+HFA ++ H E+V  L+    +++ +DK+   P+++A   G+VE+V+ L+SN   ++        P+HFA+  G  E+V+ LLS   ++++ DK
Sbjct:  445 RTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVADK 607          

HSP 20 Score: 70.8626 bits (172), Expect = 8.926e-41
Identity = 34/123 (27.64%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  545 DSGR--AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILI 907
            D G+   +H+A    H+ +V  LL     ++ ADK+ + P+H A  +GH E+ + L+       + D    TP+H A   G+  V+  LL     + V D+    P+  A   GH+ +++ L+
Sbjct:  606 DKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITDGAGWTPLHLAAESGHVGVVRELLSKGASLHVADEGGRTPLLLASMRGHVEVIRELV 728          

HSP 21 Score: 133.265 bits (334), Expect = 4.691e-37
Identity = 61/165 (36.97%), Postives = 102/165 (61.82%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVK 504
            +P+H AA +GHV+ V  LL +  ++   DK  R P+H+A ++GH  VV  L+S G S+++ DKDKR P++FA ++ HVE+V+ LL +  ++  +DK    P+H+A   G  E+V+ L+S    +D        P+HFA+   H E+V+ LL+   ++++ DK +K
Sbjct:  479 TPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMK 643          

HSP 22 Score: 52.7582 bits (125), Expect = 4.691e-37
Identity = 26/94 (27.66%), Postives = 43/94 (45.74%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLL 808
            V    +D    +H A   GH+ +   LL     ++  D     P+H A ++GH  +V+ L+S      V DE   TP+  A   G+ +V+  L+
Sbjct:  635 VDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITDGAGWTPLHLAAESGHVGVVRELLSKGASLHVADEGGRTPLLLASMRGHVEVIRELV 728          

HSP 23 Score: 132.88 bits (333), Expect = 1.869e-28
Identity = 62/182 (34.07%), Postives = 111/182 (60.99%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKVVKD*KRKGLRKMLLSGLR 552
            ++P+++AA++GHV+ V  LL +  ++   DK  R P+H+A ++G   VVR L+S G S+++ DK KR P+HFA +++HVE+V+ LL +  +++ +DK+   P+H A   G+VE+ + L+ N   +      G  P+H A+  GH  +V+ LLS+  ++ + D+        G   +LL+ +R
Sbjct:  544 RTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITDGAGWTPLHLAAESGHVGVVRELLSKGASLHVADE-------GGRTPLLLASMR 718          

HSP 24 Score: 127.872 bits (320), Expect = 6.485e-27
Identity = 54/162 (33.33%), Postives = 99/162 (61.11%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            ++P+H+AA++GH + V  L+   ++++  DK  R P+++A ++GH+ VVR L+S G S+ + DK KR P+HFA ++   E+V+ LL    +++ +DK    P+H+A    +VE+V+ L++N   +D        P+H A+  GH E+ + LL    ++ + D
Sbjct:  511 RTPLHFAAESGHTEVVCELMSGGSSVDVADKDKRTPLYFAAKSGHVEVVRDLLSNGASVNVADKGKRTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITD 672          

HSP 25 Score: 127.102 bits (318), Expect = 1.349e-26
Identity = 60/162 (37.04%), Postives = 96/162 (59.26%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H  A +G+V+ V  LL    +++  DK  R P+H+A +NGHL VV  L+S G S+EI DKDK  P+H    + +VE+V+ LL    +++ +DK+   P+H+A   G+VE+V+ L S    +         P+H A+  GH E+V+ LLS   ++ + DK
Sbjct:  347 TPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADK 508          

HSP 26 Score: 118.242 bits (295), Expect = 7.966e-24
Identity = 52/152 (34.21%), Postives = 90/152 (59.21%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            ++P+H+AA++G  + V  LL    +++  DK  R P+H+A ++ H+ VVR L++ G S++I DKD + P+H A  + HVE+ + LL +  ++  +D  G  P+H A   G+V +V+ L+S    L      G  P+  AS  GH E+++ L+
Sbjct:  577 RTPLHFAAESGLAEVVRELLSGGASVDVADKGKRTPLHFAAESSHVEVVRELLNNGASVDIADKDMKTPLHLAAGSGHVEVTRELLGNGASVSITDGAGWTPLHLAAESGHVGVVRELLSKGASLHVADEGGRTPLLLASMRGHVEVIRELV 728          

HSP 27 Score: 104.76 bits (260), Expect = 1.603e-19
Identity = 50/150 (33.33%), Postives = 87/150 (58.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLS 1006
            +H A   GH+ +V  LL+    ++  DK+ R P+H A + GH E V+ L+S     ++ D++K TP+H+A   G+ +V++ LL     VE+ DKD   P+H     G++ +V+ L+S   +++   K+  +PL  A++ G  ++V ELLS
Sbjct:  250 LHLAAEFGHVEVVRELLSGGASVDIPDKDKRTPLHFAAETGHVEGVRELLSGGASVDIPDKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLS 399          

HSP 28 Score: 100.523 bits (249), Expect = 3.121e-18
Identity = 49/161 (30.43%), Postives = 86/161 (53.42%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLS 1006
            V    +D    +H+A   GHL +V  LL+    +   DK+   P+H    +G+ E+V+ L+S     ++ D++K TP+H+A   G+ +V+  L      V + DKD   P+H A   GH+ +V+ L+S   ++    K   +PL  A++ G +++V EL+S
Sbjct:  371 VDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKLQSGGASVGIADKDKWTPLHLAAGSGHVEVVRELLSNGASVNVADKGKRTPLHFAAESGHTEVVCELMS 531          

HSP 29 Score: 99.7525 bits (247), Expect = 5.756e-18
Identity = 46/154 (29.87%), Postives = 85/154 (55.19%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +D    +H+A   GHL +V  LL+    +   DK+   P+H    +G+ E+V+ L+S     ++ D++K TP+H+A   G+ +V++ LL     VE+ DKD   P+H     G++ +V+ L+S   +++   K+  +PL  A++ G  ++V  L
Sbjct:  310 KDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAENGHLEVVSELLSGGSSVEIEDKDKWTPLHLTAGSGYVEVVRELLSGGASVDIADKDKRTPLHFAAESGHVEVVRKL 463          

HSP 30 Score: 67.781 bits (164), Expect = 6.580e-8
Identity = 36/138 (26.09%), Postives = 67/138 (48.55%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            +H A   GH  ++         +   D   ++  H A   GH E+++ L+S     ++ +++  TP+H A   G+  V+  LL     + + DK    P+H A  FGH  +V+ L+S+   +  C  ++ +PL LA++
Sbjct:    6 LHLAAKSGHQAVIGEFEGGLFNLEVLDGKKQKNNHSAAPCGHVEVIRELLSNGASVDIAEKDGRTPLHLAAENGHIQVVRELLRKGANLHIADKYGKMPLHLAAEFGHADVVRQLLSRGTKVLNCVCQSETPLHLAAK 143          

HSP 31 Score: 65.855 bits (159), Expect = 2.355e-7
Identity = 56/216 (25.93%), Postives = 92/216 (42.59%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYK-------CDKEVR-----------DENKLTPIHYACFYGYFDVMTVLLINNFKVEVG---------------DKD------------DGR-PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLSDTLRRKIID 1033
            V    +D    +H A   GH+ +V  LL +   ++ ADK  + P+H A + GH ++V+ L+S         C  E             D    TP+H A   G  +++++LL    ++E G               D D            D R P+H A   GH+ +V+ L+S++  +    +   +PL LA++ G  ++V ELLS      I D
Sbjct:   61 VDIAEKDGRTPLHLAAENGHIQVVRELLRKGANLHIADKYGKMPLHLAAEFGHADVVRQLLSRGTKVLNCVCQSETPLHLAAKWNGVCDCQLQTPLHLAAKCGQVEIVSMLLTEVHQLEKGLFQLNINSEGELEHEDTDLMSRFLSKGAGVDKRTPLHLAAESGHVEVVRELLSKDAGMNVTDEFERTPLHLAAEFGHVEVVRELLSGGASVDIPD 276          

HSP 32 Score: 62.003 bits (149), Expect = 4.174e-6
Identity = 37/118 (31.36%), Postives = 61/118 (51.69%), Query Frame = 2
Query:  656 PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV-ELLS 1006
            P+H A ++GH  ++        + EV D  K    H A   G+ +V+  LL N   V++ +KD   P+H A   GH+ +V+ L+ +  N+    K    PL LA++ G + +V +LLS
Sbjct:    5 PLHLAAKSGHQAVIGEFEGGLFNLEVLDGKKQKNNHSAAPCGHVEVIRELLSNGASVDIAEKDGRTPLHLAAENGHIQVVRELLRKGANLHIADKYGKMPLHLAAEFGHADVVRQLLS 122          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: Q16FR1 (AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014668 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 8.191e-56
Identity = 59/158 (37.34%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA+QNGH+D V LL+ +   ++        P+H A +NGHL+VV+LLI    +++    +   P+H+A +N ++E+VKLL+ ++ N++ +   G  P+HYA  +G +++VKLLI N+  +D     G  P+H+AS  G+ E+VK+L+  R N++
Sbjct:   67 TPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVD 224          

HSP 2 Score: 110.153 bits (274), Expect = 8.191e-56
Identity = 58/181 (32.04%), Postives = 95/181 (52.49%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCS--HYLCKS 1096
            +HYA   G L++V++L+     ++        P+H+A +NG+ E+VKLL+  + + +       TP+HYA   G  DV+ +L+ N   V+    +   P+HYA   G+L +VK+LI    N++    E W+PL  ASQ G   +V+LL D   R  +D+   E       GC+  HY  ++
Sbjct:  234 LHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLID--NRANVDTTQNE-------GCTPLHYASRN 405          

HSP 3 Score: 134.035 bits (336), Expect = 2.350e-54
Identity = 58/158 (36.71%), Postives = 101/158 (63.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H AA  G+++ V LL+ HN  I+  D     P+HYA +NG+L +V+LLI    +++    +   P+H+A QN H+++VKLL+ ++ N++ +   G  P+H A  +G++++VKLLI N+  +D     G  P+H+AS  G+ E+VK+L+  R N++
Sbjct:    1 TPLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVD 158          

HSP 4 Score: 109.768 bits (273), Expect = 2.350e-54
Identity = 58/181 (32.04%), Postives = 95/181 (52.49%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCS--HYLCKS 1096
            +HYA   G L++V++L+     ++        P+H+A QNG+ E+VKLL+  + + +       TP+HYA   G  DV+ +L+ N   V+    +   P+HYA   G+L +VK+LI    N++    E W+PL  AS+ G   +V+LL D   R  +D+   E       GC+  HY  ++
Sbjct:  168 LHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLID--NRANVDTTQNE-------GCTPLHYASRN 339          

HSP 5 Score: 140.584 bits (353), Expect = 1.594e-53
Identity = 59/158 (37.34%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA++NG+++ V LL+ +   ++        P+HYA QNGH++VV+LLI    +++    +   P+H A +N H+++VKLL+ +K N++ +   G  P+HYA  +GN+E+VKLLI N+  +D     G  P+H+AS  G  ++VK+L+  R N++
Sbjct:   34 TPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVD 191          

HSP 6 Score: 100.523 bits (249), Expect = 1.594e-53
Identity = 50/159 (31.45%), Postives = 86/159 (54.09%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            +HYA   G+L +V++L+     ++ A      P+H+A QNG  ++VKLL+  + + +       TP+HYA   G  +++ +L+ N   V+    +   P+HYA   G L +VK+LI    N++    E  +PL  AS+ G  ++V+LL D   R  +D+
Sbjct:  201 LHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLID--NRANVDT 357          

HSP 7 Score: 135.961 bits (341), Expect = 1.610e-51
Identity = 57/158 (36.08%), Postives = 100/158 (63.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H AA+NGH+D V LL+ +   ++        P+HYA +NG+L +V+LLI    +++    +   P+H+A +N  +++VKLL+ ++ N++ +   G  P+HYA  +GN+E+VKLLI N+  +D     G  P+H+AS  G  ++VK+L+  R N++
Sbjct:  100 TPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVD 257          

HSP 8 Score: 98.2117 bits (243), Expect = 1.610e-51
Identity = 49/159 (30.82%), Postives = 86/159 (54.09%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            +HYA   G+L +V++L+     ++ A      P+H+A +NG  ++VKLL+  + + +       TP+HYA   G  +++ +L+ N   V+    +   P+HYA   G L +VK+LI    N++    E  +PL  AS+ G  ++V+LL D   R  +D+
Sbjct:  267 LHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLID--NRANVDT 423          

HSP 9 Score: 130.568 bits (327), Expect = 2.169e-51
Identity = 57/158 (36.08%), Postives = 93/158 (58.86%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HY++QNGH+  V LL+++   ++        P+HYA QNGHL VV+ LI  G +++  +       H   QN  + +VKLL+ ++ N++ +D  G  P+HYA  +G++E+VK LI N    D ++  GS   H AS  G  E+VK+L+    N++
Sbjct:  483 TPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVD 640          

HSP 10 Score: 103.219 bits (256), Expect = 2.169e-51
Identity = 48/150 (32.00%), Postives = 78/150 (52.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +HYA   GHL +V++L+     ++  +       H   QNG  E+VKLL+  + + +  D    TP+HYA   G+ +V+ +L+ N   V+  +       H A   G L +VK+LI    N++    E W+PL  AS+ G  ++V+LL D
Sbjct:  650 LHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLID 799          

HSP 11 Score: 130.568 bits (327), Expect = 1.545e-50
Identity = 56/158 (35.44%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA++NG+++ V LL+ +   ++        P+HYA +NG L+VV+LLI    +++    +   P+H+A +N ++E+VKLL+ ++ N++ +   G  P+HYA  +G +++VKLLI N+  +D     G  P+H+AS  G+ E+VK+L+  R N++
Sbjct:  265 TPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVD 422          

HSP 12 Score: 100.523 bits (249), Expect = 1.545e-50
Identity = 48/150 (32.00%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +HYA   G+L +V++L+     ++ A      P+H++ QNGH ++VKLL+  K + +       TP+HYA   G+ +V+  L+ N   V+  +       H     G L +VK+LI    N++    E W+PL  ASQ G  ++V+ L D
Sbjct:  452 LHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLID 601          

HSP 13 Score: 132.494 bits (332), Expect = 1.948e-50
Identity = 57/158 (36.08%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA++NG+++ V LL+ +   ++        P+HYA +NG L+VV+LLI    +++    +   P+H+A QN ++E+VKLL+ ++ N++ +   G  P+HYA  +G +++VKLLI N+  +D     G  P+H+AS  G+ E+VK+L+  R N++
Sbjct:  133 TPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVD 290          

HSP 14 Score: 98.5969 bits (244), Expect = 1.948e-50
Identity = 45/140 (32.14%), Postives = 76/140 (54.29%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKG 979
            +HYA   G L++V++L+     ++        P+H+A +NG+ E+VKLL+  + + +       TP+HYA   G  DV+ +L+ N   V+    +   P+HYA   G+L +VK+LI    N++    E W+PL  AS+  
Sbjct:  300 LHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNA 439          

HSP 15 Score: 135.576 bits (340), Expect = 3.535e-47
Identity = 57/158 (36.08%), Postives = 100/158 (63.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA+QNG +D V LL+ +   ++        P+HYA +NG+L +V+LLI    +++    +   P+H+A +N  +++VKLL+ ++ N++ +   G  P+HYA  +GN+E+VKLLI N+  +D     G  P+H+AS  G  ++VK+L+  R N++
Sbjct:  232 TPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVD 389          

HSP 16 Score: 84.3445 bits (207), Expect = 3.535e-47
Identity = 50/183 (27.32%), Postives = 86/183 (46.99%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAA-----------DKNYR---------RPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            +HYA   G+L +V++L+     ++ A            +N            P+H+A +NG+ E+VKLL+  + + +       TP+HY+   G+  V+ +L+ N   V+    +   P+HYA   GHL +VK LI    N++       +   + SQ G   +V+LL D   R  +D+   E
Sbjct:  399 LHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLID--NRANVDTTDNE 579          

HSP 17 Score: 125.176 bits (313), Expect = 4.069e-47
Identity = 60/178 (33.71%), Postives = 103/178 (57.87%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTG-------SR-------------PIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA++NG +D V LL+ +   ++        P+HYA +NG+L +V+LLI    +++    +   P+H+A QN  +++VKLL+ ++ N++ +   G  P+HYA  +GN+E+VKLLI N+  +D     G       SR             P+H+AS  G+ E+VK+L+  R N++
Sbjct:  298 TPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVD 475          

HSP 18 Score: 94.7449 bits (234), Expect = 4.069e-47
Identity = 48/166 (28.92%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            + K  V     +    +HYA   GHL +V+ L+     ++  +       H   QNG   +VKLL+  + + +  D    TP+HYA   G+ +V+  L+ N    +  +       H A   G L +VK+LI    N++    E W+PL  AS+ G  ++V+LL D
Sbjct:  502 ENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLID 667          

HSP 19 Score: 124.79 bits (312), Expect = 2.536e-46
Identity = 55/161 (34.16%), Postives = 95/161 (59.01%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +P+HYA++NG+++ V LL+++   ++        P+HY+ QNGHL VV+LLI    +++    +   P+H+A QN H+E+VK L+ +  N++  +  G    H    +G + +VKLLI N+  +D     G  P+H+AS  GH E+VK L+    N + ++
Sbjct:  450 TPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKN 610          

HSP 20 Score: 92.4337 bits (228), Expect = 2.536e-46
Identity = 44/151 (29.14%), Postives = 78/151 (51.66%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            + H A   G L +V++L+     ++  +     P+H+A +NGH E+VKLL+    + + ++    T  H     G  +V+ +L+ N   V+  D +   P+HYA   GHL +VK+LI    N++       +   +AS+ G  ++V+LL D
Sbjct:  616 SFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLID 766          

HSP 21 Score: 123.635 bits (309), Expect = 6.792e-46
Identity = 55/161 (34.16%), Postives = 92/161 (57.14%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +P+HYA QNGH++ V  L+ +   ++  +       H   QNG L +V+LLI    +++  D +   P+H+A QN H+E+VK L+ +  N +  +  G    H A  +G +E+VKLLI N   +D  +  G  P+H+AS  GH E+VK+L+    N++ ++
Sbjct:  516 TPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKN 676          

HSP 22 Score: 92.0485 bits (227), Expect = 6.792e-46
Identity = 44/151 (29.14%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            + H     G L +V++L+     ++  D     P+H+A +NGH E+VKLL+    + + ++    T  H A   G  +V+ +L+ N   V+  + +   P+HYA   GHL +VK+LI    N++       +   + SQ G  ++V+LL D
Sbjct:  682 SFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLID 832          

HSP 23 Score: 126.331 bits (316), Expect = 2.662e-45
Identity = 58/164 (35.37%), Postives = 92/164 (56.10%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            R  +  H  +QNG +  V LL+ +   ++  D     P+HYA QNGHL VV+ LI  G + +  +       H A +N  +E+VKLL+ +  N++ ++  G  P+HYA  +G++E+VKLLI N   +D ++  GS   H  S  G  E+VK+L+  R N++  D
Sbjct:  546 RGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTD 709          

HSP 24 Score: 87.4261 bits (215), Expect = 2.662e-45
Identity = 44/150 (29.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +HYA   GHL +V++L+     ++  +       H A +NG  E+VKLL+    + +  +    TP+HYA   G+ +V+ +L+ N   V+  +       H     G L +VK+LI    N++    E W+ L  AS  G  ++V+L  D
Sbjct:  716 LHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSID 865          

HSP 25 Score: 118.627 bits (296), Expect = 5.507e-44
Identity = 56/178 (31.46%), Postives = 101/178 (56.74%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLI--------------------SEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA+QNG +D V LL+ +   ++        P+HYA +NG+L +V+LLI                    S   +++    +   P+H+A +N ++E+VKLL++++ N++ +   G  P+HY+  +G++++VKLLI N+  +D     G  P+H+A   GH E+VK L+    N++
Sbjct:  364 TPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVD 541          

HSP 26 Score: 90.5077 bits (223), Expect = 5.507e-44
Identity = 47/164 (28.66%), Postives = 81/164 (49.39%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            + H     G L +V++L+     ++  D     P+H+A QNGH E+VK L+    + + ++    T  H A   G  +V+ +L+ N   V+  + +   P+HYA   GHL +VK+LI    N++       +   + SQ G  ++V+LL D   R  +D+   E
Sbjct:  550 SFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLID--NRANVDTTDNE 711          

HSP 27 Score: 126.716 bits (317), Expect = 7.563e-39
Identity = 55/161 (34.16%), Postives = 95/161 (59.01%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +P+HYA+QNGH++ V  L+ +    +  +       H A +NG L VV+LLI  G +++  + +   P+H+A +N H+E+VKLL+ +  N++  +  G    H    +G +E+VKLLI N+  +D     G  P+H+AS  GH E+VK+L+    N++ ++
Sbjct:  582 TPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKN 742          

HSP 28 Score: 65.0846 bits (157), Expect = 7.563e-39
Identity = 32/117 (27.35%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILI 907
            + H A   G L +V++L+     ++  +     P+H+A +NGH E+VKLL+    + + ++    T  H     G  +V+ +L+ N   V+    +    +H A   GHL +VK+ I
Sbjct:  748 SFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSI 864          

HSP 29 Score: 137.502 bits (345), Expect = 7.294e-30
Identity = 58/158 (36.71%), Postives = 100/158 (63.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA++NG +D V LL+ +   ++        P+HYA QNG+L +V+LLI    +++    +   P+H+A QN  +++VKLL+ ++ N++ +   G  P+HYA  +GN+E+VKLLI N+  +D     G  P+H+AS  G  ++VK+L+  R N++
Sbjct:  166 TPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVD 323          

HSP 30 Score: 134.42 bits (337), Expect = 7.363e-29
Identity = 58/158 (36.71%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+HYA+QNG+++ V LL+ +   ++        P+HYA QNG L+VV+LLI    +++    +   P+H+A +N ++E+VKLL+ ++ N++ +   G  P+HYA  +G +++VKLLI N+  +D     G  P+H+AS  G+ E+VK+L+  R N++
Sbjct:  199 TPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVD 356          

HSP 31 Score: 127.872 bits (320), Expect = 8.346e-27
Identity = 57/161 (35.40%), Postives = 95/161 (59.01%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            R  +  H A++NG ++ V LL+ +   ++  +     P+HYA +NGHL VV+LLI  G +++  +       H   QN  +E+VKLL+ ++ N++ +D  G  P+HYA  +G++E+VKLLI N   +D ++  GS   H AS  G  E+VK+L+    N++
Sbjct:  612 RGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVD 772          

HSP 32 Score: 127.102 bits (318), Expect = 1.696e-26
Identity = 56/161 (34.78%), Postives = 96/161 (59.63%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +P+HYA++NGH++ V LL+ +   ++  +       H   QNG L VV+LLI    +++  D +   P+H+A +N H+E+VKLL+ +  N++  +  G    H A  +G +E+VKLLI N   +D  +  G  P+H+AS  GH E+VK+L+    N++ ++
Sbjct:  648 TPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKN 808          

HSP 33 Score: 124.405 bits (311), Expect = 1.051e-25
Identity = 56/161 (34.78%), Postives = 93/161 (57.76%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            R  +  H  +QNG ++ V LL+ +   ++  D     P+HYA +NGHL VV+LLI  G +++  +       H A +N  +E+VKLL+ +  N++ ++  G  P+HYA  +G++E+VKLLI N   +D ++  GS   H  S  G  E+VK+L+    N++
Sbjct:  678 RGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVD 838          

HSP 34 Score: 111.694 bits (278), Expect = 2.255e-23
Identity = 57/181 (31.49%), Postives = 95/181 (52.49%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCS--HYLCKS 1096
            +HYA   G+L +V++L+     ++        P+H+A QNGH ++VKLL+  + + +       TP+H A   G+ DV+ +L+ N   V+    +   P+HYA   G+L +VK+LI    N++    E W+PL  AS+ G   +V+LL D   R  +D+   E       GC+  HY  ++
Sbjct:   36 LHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLID--NRANVDTTQNE-------GCTPLHYASQN 207          

HSP 35 Score: 28.1054 bits (61), Expect = 2.255e-23
Identity = 11/28 (39.29%), Postives = 19/28 (67.86%), Query Frame = 1
Query:  409 PIHFASFYGHDEIVKILLSERCNIELQD 492
            P+H A+  G+ E+VK+L+    NI+ +D
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKD 29          

HSP 36 Score: 112.464 bits (280), Expect = 6.277e-22
Identity = 59/181 (32.60%), Postives = 96/181 (53.04%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCS--HYLCKS 1096
            +H A   GHL++V++L+     ++ A      P+H+A +NG+ E+VKLL+  + + +       TP+HYA   G  DV+ +L+ N   V+    +   P+HYA   G+L +VK+LI    N++    E W+PL  ASQ G   +V+LL D   R  +D+   E       GC+  HY  ++
Sbjct:  102 LHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLID--NRANVDTTQNE-------GCTPLHYASRN 273          

HSP 37 Score: 110.538 bits (275), Expect = 2.714e-21
Identity = 51/149 (34.23%), Postives = 86/149 (57.72%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKI 456
            +P+HYA++NGH++ V LL+ +   ++  +       H A +NG L VV+LLI  G +++  + +   P+H+A +N H+E+VKLL+ +  N++  +  G    H    +G +E+VKLLI N   +D         +H AS  GH E+VK+
Sbjct:  714 TPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKL 862          

HSP 38 Score: 108.997 bits (271), Expect = 8.473e-21
Identity = 52/159 (32.70%), Postives = 90/159 (56.60%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            +H A  +G++ +V++L+  +  I+  D     P+H+A +NG+ E+VKLL+  + + +       TP+HYA   G+ DV+ +L+ N   V+    +   P+H A   GHL +VK+LI    N++    E W+PL  AS+ G  ++V+LL D   R  +D+
Sbjct:    3 LHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLID--NRANVDT 159          

HSP 39 Score: 106.301 bits (264), Expect = 7.219e-20
Identity = 52/170 (30.59%), Postives = 88/170 (51.76%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            V     +    +HYA   GH+++V++L+     ++        P+H A +NGH ++VKLL+  K + +       TP+HYA   G  +++ +L+ N   V+    +   P+HYA   G L +VK+LI    N++    E  +PL  ASQ G  ++V+LL D   R  +D+
Sbjct:   58 VDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLID--NRANVDT 225          

HSP 40 Score: 98.2117 bits (243), Expect = 2.067e-17
Identity = 51/173 (29.48%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  518 KDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDS 1036
            K  V     +    +HYA   G+L +V++L+     ++ A      P+H+A +NG  ++VKLL+  + + +       TP+HYA   G  +++ +L+ N   V+    +   P+HYA   G L +VK+LI    N++    E  +PL  AS+ G  ++V+LL D   R  +D+
Sbjct:  121 KANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLID--NRANVDT 291          

HSP 41 Score: 95.1301 bits (235), Expect = 2.104e-16
Identity = 46/150 (30.67%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +HYA   GHL +V+ L+      +  +       H A +NG  E+VKLL+    + +  +    TP+HYA   G+ +V+ +L+ N   V+  +       H     G L +VK+LI    N++    E W+PL  AS+ G  ++V+LL D
Sbjct:  584 LHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLID 733          

HSP 42 Score: 86.2705 bits (212), Expect = 1.068e-13
Identity = 39/118 (33.05%), Postives = 67/118 (56.78%), Query Frame = 2
Query:  656 PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            P+H A   G+ E+VKLL+ +  + + +D+   TP+HYA   G  +++ +L+ N   V+    +   P+HYA   GH+ +VK+LI    N++    E  +PL  A++ G   +V+LL D
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLID 119          

HSP 43 Score: 84.3445 bits (207), Expect = 4.260e-13
Identity = 39/121 (32.23%), Postives = 68/121 (56.20%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLI 363
            R  +  H A++NG ++ V LL+ +   ++  +     P+HYA +NGHL VV+LLI  G +++  +       H   QN  +E+VKLL+ +  N++ +       +H A  +G++E+VKL I
Sbjct:  744 RGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSI 864          

HSP 44 Score: 70.4774 bits (171), Expect = 1.084e-8
Identity = 34/99 (34.34%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  752 TPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEE 1048
            TP+H A   G  +++ +L+ +N  ++  D +   P+HYA   G+L +VK+LI    N++    E W+PL  ASQ G   +V+LL D   R  +D+   E
Sbjct:    1 TPLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLID--NRANVDTTQNE 97          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A182GJR2 (Uncharacterized protein OS=Aedes albopictus OX=7160 GN=RP20_CCG011139 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 5.955e-55
Identity = 61/160 (38.12%), Postives = 100/160 (62.50%), Query Frame = 1
Query:    4 SQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            S +P+H+A QNGH + V +L++ N  I++  +    P+H AC+ GH  VV + I E  +IE   ++K  P+H AC N H E+V++L+K K N++A       P+H+ C +G+ E+VK+LI  +  +DA +     P+HFA   GH E+++IL+ E+ NI+
Sbjct: 1371 SLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANID 1530          

HSP 2 Score: 114.005 bits (284), Expect = 5.955e-55
Identity = 55/164 (33.54%), Postives = 92/164 (56.10%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            KEK  +      +   +H+AC  GH  +VE+L+     I+A  +    P+H AC+NGH EIVK L+  K + +       TP+H+AC  G+ +++ +L+  N  ++     +  P+H+AC  GH  +VK L+ +  NI+A T +N +PL  A + G  ++VE+L
Sbjct: 1524 KEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEIL 1687          

HSP 3 Score: 118.627 bits (296), Expect = 1.739e-51
Identity = 59/158 (37.34%), Postives = 92/158 (58.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+  A QNGH     +LL+    I A D     P+H AC +G    V + ++EG +I   D     P+H AC   H E+V++LL+ K N++AS+ N L P+H+AC +G+ E+V++LI     +D+E+     P+H A   GH E+V+I + E+ NIE
Sbjct: 1274 TPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIE 1431          

HSP 4 Score: 115.546 bits (288), Expect = 1.739e-51
Identity = 60/180 (33.33%), Postives = 102/180 (56.67%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLVEE 1048
            +EK  ++   ++    +H AC  GH  +VE+L+ +   I+A       P+H  C+NGH E+VK+L+  K   +   ENK TP+H+AC  G+ +V+ +L+     ++     +  P+H+AC  GH  +V+ILI    NI+A  ++ ++PL  A + G  +IV+ L   +R+K  ID+L  E
Sbjct: 1425 REKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKL---IRKKANIDALTHE 1601          

HSP 5 Score: 114.005 bits (284), Expect = 2.139e-48
Identity = 55/164 (33.54%), Postives = 93/164 (56.71%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            KEK  +      +   +H+ C  GH  +V++L+     I+A  +N   P+H AC+NGH E++++L+  K + +       TP+H+AC  G+ +V+ +L+     ++   +    P+H+AC  GH  IVK LI +  NI+A T EN++PL  A + G  +IVE+L
Sbjct: 1458 KEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEIL 1621          

HSP 6 Score: 109.768 bits (273), Expect = 2.139e-48
Identity = 54/157 (34.39%), Postives = 92/157 (58.60%), Query Frame = 1
Query:   13 PIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            P+H A  +G  +AV + L     I   D     P+H AC  GH  VV++L+ E  +I+  + +   P+HFACQN H E+V++L++   N+++  +N + P+H AC  G+ E+V++ I  +  ++A +     P+H A   GH E+V+IL+ E+ NI+
Sbjct: 1308 PLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANID 1464          

HSP 7 Score: 118.627 bits (296), Expect = 1.886e-46
Identity = 55/158 (34.81%), Postives = 96/158 (60.76%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A + GH + V + ++    IEA  +    P+H AC NGH  VV +LI E  +I+        P+H+ C+N H E+VK+L++ K +++A  +N   P+H+AC +G+ E++++LI  +  +DA +     P+H+A   GH E+V+IL+  + NI+
Sbjct: 1406 TPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANID 1563          

HSP 8 Score: 98.9821 bits (245), Expect = 1.886e-46
Identity = 48/145 (33.10%), Postives = 78/145 (53.79%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIV 994
            +H+AC  GH  IV+ L+ +   I+A       P+H AC+NGH EIV++LV    + +       TP+H+AC  G+ +V+  LL     ++     +  P+H+AC  GH  +V+ILI +  NI+A  +  ++ L  A   G   +V
Sbjct: 1573 LHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNGLEDVV 1717          

HSP 9 Score: 112.079 bits (279), Expect = 4.847e-46
Identity = 52/164 (31.71%), Postives = 94/164 (57.32%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +EK  +     +S   +H+AC  GH  +VE+L+ ++  I++  +N   P+H AC+ GH E+V++ +  K + E   ENK TP+H AC  G+ +V+ +L+     ++     +  P+H+ C  GH  +VKILI    +I+A  +  ++PL  A + G  +++E+L
Sbjct: 1359 REKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEIL 1522          

HSP 10 Score: 103.99 bits (258), Expect = 4.847e-46
Identity = 53/158 (33.54%), Postives = 86/158 (54.43%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            + +H ++  G+   V LLL +   + A D     P+H+ACQNGH  +  +L+ +  +I+  +     P+  ACQN H +I ++LL+ K  + A D    RP+H AC  G  E V++ ++    +       S P+H A  YGH E+V+ILL E+ NI+
Sbjct: 1208 TVLHLSSSKGYCLVVELLLSNGANVNAVDTNKCTPLHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANID 1365          

HSP 11 Score: 130.568 bits (327), Expect = 9.074e-34
Identity = 62/158 (39.24%), Postives = 99/158 (62.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+A +NGH + + +L+K    I+A    +  P+H+AC+NGH  VV +LI    +I+   + K  P+HFAC+N H EIVK L++ K N++A       P+H+AC +G+ EIV++L+     +DA +     P+H+A   GH E+VK LL E+ NI+
Sbjct: 1505 TPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANID 1662          

HSP 12 Score: 44.2838 bits (103), Expect = 9.074e-34
Identity = 19/62 (30.65%), Postives = 34/62 (54.84%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIV 697
            +EK  +      +   +H+AC  GH  +VE+L+ +   I+A+ +N    +H AC NG  ++V
Sbjct: 1656 REKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNGLEDVV 1717          

HSP 13 Score: 129.028 bits (323), Expect = 6.077e-27
Identity = 61/158 (38.61%), Postives = 100/158 (63.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H A  NGH + V +L+K    I+A    +  P+H+ C+NGH  VV++LI    SI+   ++K  P+HFAC+N H E++++L+K K N++A       P+H+AC +G+ E+V++LI  +  +DA +     P+HFA   GH EIVK L+ ++ NI+
Sbjct: 1439 TPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANID 1596          

HSP 14 Score: 125.561 bits (314), Expect = 8.049e-26
Identity = 57/158 (36.08%), Postives = 101/158 (63.92%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+A +NGH + V +L++    I+A  +    P+H+AC+NGH  +V+ LI +  +I+    +   P+H+AC+N H EIV++L++   N++A       P+H+AC +G+ E+VK L+  +  +DA +   S P+H+A   GH E+V+IL+ E+ NI+
Sbjct: 1538 TPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANID 1695          

HSP 15 Score: 124.405 bits (311), Expect = 1.671e-25
Identity = 58/158 (36.71%), Postives = 100/158 (63.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +P+H+  +NGH + V +L++   +I+A  +    P+H+AC+NGH  V+ +LI E  +I+        P+H+AC+N H E+V++L++ K N++A  +    P+H+AC +G+ EIVK LI  +  +DA +     P+H+A   GH EIV+IL+ +  NI+
Sbjct: 1472 TPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNID 1629          

HSP 16 Score: 73.559 bits (179), Expect = 1.380e-24
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  581 GHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            G +  +E L+     +NA +      +H +   G+C +V+LL+S   +    D NK TP+H+AC  G+  +  +LL     ++  +  +  P+  AC  GH  I +IL+ +   I A     W PL LA   G  + VE+ 
Sbjct: 1184 GIIKKLERLINDGANVNAPNSTGCTVLHLSSSKGYCLVVELLLSNGANVNAVDTNKCTPLHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIF 1324          

HSP 17 Score: 70.8626 bits (172), Expect = 1.380e-24
Identity = 40/153 (26.14%), Postives = 70/153 (45.75%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H A   GH++ V LLL+    I   +      +HYA  N  + + +LLI +G  +    K K   +H AC +   ++ ++L++     + +   G  P+  A   G+ E+V +LI N       S      +      GHD + K+L+ E
Sbjct: 1012 APLHSAIIYGHINLVQLLLRKGADIHCRNTEGWSALHYAVHNKQITITKLLIDKGTDVNSITKKKWNALHIACNSGDADMTRMLIQKCARDDVTTNKGKTPLDLAAAGGHTEVVIILIENMIETFLLSWKTDDVLWNVVINGHDSLKKMLIRE 1164          

HSP 18 Score: 121.324 bits (303), Expect = 1.656e-24
Identity = 57/161 (35.40%), Postives = 98/161 (60.87%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +  +P+H A   GH + V +LL+    I+A +     P+H+ACQNGH  +V +LI E  +I+   ++K  P+H AC+  H E+V++ ++ K N+EA  +N   P+H AC +G+ E+V++LI  +  +DA +     P+H+    GH E+VKIL+  + +I+
Sbjct: 1337 KYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASID 1497          

HSP 19 Score: 116.701 bits (291), Expect = 5.181e-23
Identity = 58/163 (35.58%), Postives = 99/163 (60.74%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLVE 1045
            +H AC  GH  +V++LL +   I+A++ N   P+H ACQNGH E+V++L+    + +   +NK+TP+H AC  G+ +V+ + +     +E   ++   P+H AC  GH  +V+ILI +  NI+A T +N++PL    + G  ++V++L   +R K  ID+L E
Sbjct: 1342 LHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKIL---IRGKASIDALAE 1501          

HSP 20 Score: 115.931 bits (289), Expect = 8.678e-23
Identity = 62/197 (31.47%), Postives = 109/197 (55.33%), Query Frame = 2
Query:  455 YFCRNAVTSNCRIR**KIEKEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLV 1042
            + CRN      +I    + + K  +    ++    +H+AC  GH  ++E+L+ +   I+A       P+H AC+NGH E+V++L+  K + +   E K TP+H+AC  G+ +++  L+     ++    ++  P+H+AC  GH  IV+IL+ +N NI+A T  N++PL  A + G  ++V+ L   LR K  ID+L 
Sbjct: 1476 WTCRNGHKEVVKI----LIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTL---LREKANIDALT 1665          

HSP 21 Score: 111.309 bits (277), Expect = 2.475e-21
Identity = 56/170 (32.94%), Postives = 99/170 (58.24%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLVEE 1048
            Q+    +H AC +GH  +VE+ + +   I A  +N   P+H AC NGH E+V++L+  K + +       TP+H+ C  G+ +V+ +L+     ++   ++   P+H+AC  GH  +++ILI +  NI+A T +N++PL  A + G  ++VE+L   +R K  ID+L E+
Sbjct: 1402 QNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEIL---IRGKANIDALAEK 1568          

HSP 22 Score: 108.612 bits (270), Expect = 1.963e-20
Identity = 55/164 (33.54%), Postives = 90/164 (54.88%), Query Frame = 2
Query:  512 KEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +EK  +        R +H AC  G    VE+ LA+   I   D  Y  P+H AC  GH E+V++L+  K + +  + N LTP+H+AC  G+ +++ +L+  N  ++   ++   P+H AC  GH  +V+I I +  NIEA  +  ++PL LA   G  ++VE+L
Sbjct: 1293 REKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEIL 1456          

HSP 23 Score: 103.605 bits (257), Expect = 6.601e-19
Identity = 49/147 (33.33%), Postives = 88/147 (59.86%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIV 450
            +P+H+A +NGH + V  L++    I+A    +  P+H+AC+NGH  +V +L+ +  +I+        P+H+AC+N H E+VK LL+ K N++A       P+H+AC +G+ E+V++LI  +  +DA +      +H A   G +++V
Sbjct: 1571 TPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNGLEDVV 1717          

HSP 24 Score: 103.219 bits (256), Expect = 7.918e-19
Identity = 59/173 (34.10%), Postives = 96/173 (55.49%), Query Frame = 2
Query:  569 ACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKI-IDSLVEE----LGIQCFDG 1072
            AC  GH  I E+LL +  +I A D    RP+H AC +G  E V++ ++   +    D    TP+H AC YG+ +V+ +LL     ++  + +   P+H+AC  GH  +V+ILI +N NI++  +   +PL LA +KG  ++VE+    +R K  I++L E     L + C +G
Sbjct: 1279 ACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIF---IREKANIEALAENKFTPLHLACVNG 1448          

HSP 25 Score: 100.138 bits (248), Expect = 8.558e-18
Identity = 49/148 (33.11%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H+AC  GH  I E+LL +   I+A +     P+  ACQNGH +I ++L+  K      D  +  P+H AC  G  + + + L     +   D     P+H AC +GH  +V+IL+ +  NI+A    + +PL  A Q G  ++VE+L
Sbjct: 1243 LHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEIL 1390          

HSP 26 Score: 75.8702 bits (185), Expect = 2.624e-10
Identity = 40/142 (28.17%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  455 YFCRNAVTSNCRIR**KIEKEKDYVKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFG 880
            + CRN      +    K+ ++K  +     ++   +H+AC  GH  IVE+L+ ++  I+A       P+H AC+NGH E+VK L+  K + +       TP+H+AC  G+ +V+ +L+     ++   ++    +H AC  G
Sbjct: 1575 FACRNGHKEIVK----KLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNG 1712          

HSP 27 Score: 66.6254 bits (161), Expect = 2.080e-7
Identity = 31/84 (36.90%), Postives = 51/84 (60.71%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIV 252
            R+ +P+H+A +NGH + V  LL+    I+A    +  P+H+AC+NGH  VV +LI E  +I+   ++K   +H AC N   ++V
Sbjct: 1634 RNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNGLEDVV 1717          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 93.5893 bits (231), Expect = 3.998e-40
Identity = 50/153 (32.68%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   +++   LLL     +    K    P+H A + G++ +VRLL+  G +I+   KD+  P+H A +N HV I+++LL     ++A  KNGL PIH A    +++ V+ L+     +D  +L    P+H A+  GH  + K+LL +
Sbjct:  180 TPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDK 332          

HSP 2 Score: 92.0485 bits (227), Expect = 3.998e-40
Identity = 48/150 (32.00%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC + HL ++++LL  S  + A  ++   P+H A   GH  IVK+L+         +    TP+H A   G+ +V   LL N   V+   KDD   +H A   GH  +VK+L+    N  + T    +PL +A+++G +Q V +L D
Sbjct:  347 LHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLD 496          

HSP 3 Score: 106.686 bits (265), Expect = 6.195e-40
Identity = 56/162 (34.57%), Postives = 89/162 (54.94%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V  LL++N  I+        P+H A   GH  + ++L+ +G        +   P+H AC+ NH+ ++ LLLK   +LEA  ++GL P+H A F G++ IVK+L+      +A ++    P+H AS  GH E+ + LL     ++ + K
Sbjct:  279 SPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAK 440          

HSP 4 Score: 78.1814 bits (191), Expect = 6.195e-40
Identity = 40/159 (25.16%), Postives = 74/159 (46.54%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            V    +D   ++H A   GH  +V++LL      N+       P+H A + GH + V++L+     +    +   TP+H A  YG  DV  +LL          K+   P+H A    +L +V +L+S+  +  +  +  ++PL +AS++   ++   L
Sbjct:  435 VDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSL 593          

HSP 5 Score: 103.605 bits (257), Expect = 3.612e-38
Identity = 55/153 (35.95%), Postives = 80/153 (52.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA+NGHV  + +LL     I+A  K    PIH A Q  H++ VR L+     I+    D   P+H A    H  + K+LL           NG  P+H AC   ++ ++ LL+ +   L+A + +G  P+H ASF GH  IVKILL +
Sbjct:  246 TPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQK 398          

HSP 6 Score: 75.485 bits (184), Expect = 3.612e-38
Identity = 42/148 (28.38%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + E LL  +  ++A  K+ +  +H A + GH E+VKLL+ +K +         TP+H A   G+   + +LL  N +     K    P+H A  +G + + ++L+ +  N  A  K   +PL +A       +V LL
Sbjct:  413 LHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLL 560          

HSP 7 Score: 83.5741 bits (205), Expect = 8.154e-33
Identity = 45/156 (28.85%), Postives = 79/156 (50.64%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H A+  GH++ V +LL+   +  A +     P+H A + GH  V   L+     ++   KD +  +H A +  H E+VKLLL+ K N  ++   G  P+H A   G+ + V++L+         +  G  P+H A+ YG  ++ ++LL    N
Sbjct:  378 TPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGAN 533          

HSP 8 Score: 77.411 bits (189), Expect = 8.154e-33
Identity = 39/148 (26.35%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +L++V +L+++    ++A +N   P+H A +    E+   L+ Y           +TP+H A   G  D++++L+     V +G+K    P+H     GH+ I  IL+ Q  ++ A T+  ++PL +A   G  ++V+ L
Sbjct:  545 LHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFL 692          

HSP 9 Score: 90.1225 bits (222), Expect = 3.303e-30
Identity = 51/159 (32.08%), Postives = 80/159 (50.31%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H A   GH+ I+E+LL Q   I A  KN   PIH A Q  H + V+ L+ Y  + +    + LTP+H A   G+  +  VLL    K      +   P+H AC   HL ++ +L+  + ++EA T+   +PL +AS  G   IV++L
Sbjct:  237 IDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKIL 395          

HSP 10 Score: 62.003 bits (149), Expect = 3.303e-30
Identity = 46/196 (23.47%), Postives = 80/196 (40.82%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDK------------------------------------NGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GHV  V  LL +   +E   K     +H A   G   VV  L++ G ++    +    P++ A Q NH+E+VK LL++  N     +                                     G  P+H A  + N+ + +LL++    ++     G  P+H AS  G+  +V++LL     I+ + K
Sbjct:   47 LHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTK 242          

HSP 11 Score: 77.0258 bits (188), Expect = 3.256e-24
Identity = 41/150 (27.33%), Postives = 80/150 (53.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +LN+ ++LL +   +N   KN   P+H A + G+  +V+LL+      + + +++LTP+H A   G+  ++ +LL     ++   K+   PIH A    H+  V+ L+  N  I+  T ++ +PL +A+  G  ++ ++L D
Sbjct:  182 LHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLD 331          

HSP 12 Score: 55.0694 bits (131), Expect = 3.256e-24
Identity = 35/125 (28.00%), Postives = 62/125 (49.60%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            A ++G+L+     I  G  I   +++    +H A +  HV++V  LL +   LE + K G   +H A   G  ++V  L++    ++A+S  G  P++ A+   H E+VK LL    N  +  +V
Sbjct:   17 AARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEV 141          

HSP 13 Score: 101.679 bits (252), Expect = 1.028e-21
Identity = 49/151 (32.45%), Postives = 86/151 (56.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A++   V+  S LL++  +  A       P+H A Q G  ++V LLIS+  ++ + +K    P+H   Q  HV I  +L+K   ++ A+ + G  P+H AC +GN+++VK L+  Q  ++ ++  G  P+H A+  GH +IV +LL
Sbjct:  576 TPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLL 726          

HSP 14 Score: 98.5969 bits (244), Expect = 8.077e-21
Identity = 49/151 (32.45%), Postives = 87/151 (57.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +  H+  + LLLKH+ ++EA  +    P+H A   GHLN+V++L+ +G S    +     P+H A +  H E+ + LL++   ++A  K+    +H A   G+ E+VKLL+ ++   ++ +  G  P+H A+  GH + V+ILL
Sbjct:  345 TPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILL 495          

HSP 15 Score: 95.5153 bits (236), Expect = 6.716e-20
Identity = 50/163 (30.67%), Postives = 86/163 (52.76%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
             +P+H AA+ GH   V +LL  N       K    P+H A + G ++V  LL+  G +     K+   P+H A  +N++++V LL+    +  ++ +NG  P+H A     VE+   L+      +AESL G  P+H A+  G  ++V +L+S++ N+ L +K
Sbjct:  476 HTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNK 638          

HSP 16 Score: 91.2781 bits (225), Expect = 1.450e-18
Identity = 51/157 (32.48%), Postives = 82/157 (52.23%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNI 480
            +P+H AA+ G VD   LLL+      A  K    P+H A  + +L+VV LL+S+G S     ++   P+H A + N VE+   LL+   +  A    G+ P+H A   G  ++V LLIS Q  ++  + +G  P+H  +  GH  I  IL+ +  ++
Sbjct:  510 TPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASV 666          

HSP 17 Score: 87.8113 bits (216), Expect = 1.703e-17
Identity = 42/150 (28.00%), Postives = 77/150 (51.33%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H AAQ G  D VSLL+     +   +K    P+H   Q GH+ +  +L+ +G S+    +    P+H AC   ++++VK LL+ + N+    + G  P+H A   G+ +IV LL+ +    +  +  G+  +  A   G+  ++ +L
Sbjct:  609 TPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 18 Score: 85.8853 bits (211), Expect = 8.367e-17
Identity = 42/148 (28.38%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  + +   LL      NA       P+H A Q G  ++V LL+S + +  + +++ LTP+H     G+  +  +L+     V    +    P+H AC +G++ +VK L+ Q  N+   T+  ++PL  A+Q+G + IV LL
Sbjct:  578 LHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLL 725          

HSP 19 Score: 78.5666 bits (192), Expect = 1.317e-14
Identity = 42/148 (28.38%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG++ +V +LL +   I+A  K+   P+H A +NGH  I+++L+      + + +N L+PIH A    + D +  LL  N +++    D   P+H A   GH  + K+L+ +           ++PL +A +K   ++++LL
Sbjct:  215 LHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLL 362          

HSP 20 Score: 73.9442 bits (180), Expect = 4.238e-13
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  112 PIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            P+H A    +LNV +LL++ G ++    K+   P+H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V I+++L+     + A++  G  PIH A+   H + V+ LL  + N E+ D
Sbjct:  181 PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDD 305          

HSP 21 Score: 72.7886 bits (177), Expect = 8.196e-13
Identity = 50/201 (24.88%), Postives = 86/201 (42.79%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRK------------------------------------PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +  + +H AA  G    V+ L+ +   + A  +    P++ A Q  HL VV+ L+  G +  I  + K                                      P+H A    ++ + +LLL    N+  + KNG+ P+H A   GNV +V+LL+     +DA++     P+H A+  GH  I++ILL +   I+ + K
Sbjct:   75 KGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTK 275          

HSP 22 Score: 71.633 bits (174), Expect = 1.997e-12
Identity = 39/148 (26.35%), Postives = 65/148 (43.92%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  ++V +L+++   +N  +K+   P+H   Q GH  I  +LV              TP+H AC YG   ++  LL     V    +    P+H A   GH  IV +L+         T    S L +A + G+  ++++L
Sbjct:  611 LHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 23 Score: 67.781 bits (164), Expect = 3.361e-11
Identity = 46/187 (24.60%), Postives = 78/187 (41.71%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENK------------------------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+     +NA  +    P++ A Q  H E+VK L+    ++ +  E K                                     TP+H A  Y   +V  +LL     V    K+   P+H A   G++ +V++L+ +   I+A TK+  +PL  A++ G  +I+E+L D
Sbjct:   79 ALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLD 265          

HSP 24 Score: 66.6254 bits (161), Expect = 6.603e-11
Identity = 37/148 (25.00%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH   V +LL  + +     K    P+H A + G  ++ +LL+    +     +N LTP+H A  +   DV+ +L+          ++   P+H A     + +   L+    +  A + +  +PL LA+Q+G + +V LL
Sbjct:  479 LHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLL 626          

HSP 25 Score: 63.5438 bits (153), Expect = 6.040e-10
Identity = 32/106 (30.19%), Postives = 57/106 (53.77%), Query Frame = 2
Query:  656 PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            P+H A    +  + +LL++   +     +N +TP+H A   G   ++ +LL     ++   KD+  P+H A   GH+ I++IL+ Q   I+A TK   SP+ +A+Q
Sbjct:  181 PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQ 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 100.523 bits (249), Expect = 4.285e-39
Identity = 54/151 (35.76%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+NGHV  + +LL     I+A  K    PIH A Q  H++ VR L+     I+    D   P+H A    H  + K+LL       A   NG  P+H AC   ++  + LL+ +   L+A + +G  P+H A+F GH  IVK LL
Sbjct:  249 TPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL 399          

HSP 2 Score: 81.6481 bits (200), Expect = 4.285e-39
Identity = 43/148 (29.05%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + + LL    +++A  K+ + P+H A + GH E+VKLL+ +K + +       TP+H A   G+     +LL  N +     K    P+H AC +G + + ++L+ +  N  A  K   +PL +A       +V+LL
Sbjct:  416 LHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 563          

HSP 3 Score: 103.219 bits (256), Expect = 6.215e-39
Identity = 55/162 (33.95%), Postives = 87/162 (53.70%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SPIH AAQ  H+D V  LL++N  I+        P+H A   GH  + ++L+ +G        +   P+H AC+ NH+  + LLLK   +LEA  ++GL P+H A F G++ IVK L+      +A ++    P+H A+  GH E+ + LL     ++ + K
Sbjct:  282 SPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAK 443          

HSP 4 Score: 78.5666 bits (192), Expect = 6.215e-39
Identity = 39/150 (26.00%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            V    +D    +H A   GH  +V++LL      ++A      P+H A + GH    ++L+     +    +   TP+H AC YG  DV  +LL          K+   P+H A    +L +VK+L+S+  +  +  +  ++PL +A+++
Sbjct:  438 VDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQ 587          

HSP 5 Score: 91.6633 bits (226), Expect = 8.164e-39
Identity = 49/153 (32.03%), Postives = 82/153 (53.59%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            +P+H AA   ++    LLL     +    K    P+H A + G++ +VRLL+  G  I+   KD+  P+H A +N HV ++++LL     ++A  KNGL PIH A    +++ V+ L+     +D  +L    P+H A+  GH  + K+LL +
Sbjct:  183 TPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDK 335          

HSP 6 Score: 89.3521 bits (220), Expect = 8.164e-39
Identity = 46/150 (30.67%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H AC + H+  +++LL  S  + A  ++   P+H A   GH  IVK L+         +    TP+H A   G+ +V   LL N  +V+   KDD  P+H A   GH  +VK+L+    N ++ T    +PL +A+++G +    +L D
Sbjct:  350 LHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLD 499          

HSP 7 Score: 100.523 bits (249), Expect = 1.192e-34
Identity = 50/151 (33.11%), Postives = 85/151 (56.29%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H A +  H+ ++ LLLKH+ ++EA  +    P+H A   GHLN+V+ L+  G S    +     P+H A +  H E+ + LL++   ++A  K+   P+H A   G+ E+VKLL+ ++   D+ +  G  P+H A+  GH    +ILL
Sbjct:  348 TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILL 498          

HSP 8 Score: 66.6254 bits (161), Expect = 1.192e-34
Identity = 57/239 (23.85%), Postives = 95/239 (39.75%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVS-------------------------------YKCDKEVRDEN--KLTPIHYACFYGYFDVMTVLLINNFKVEVGDK---------------DDGR-----------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL--SDTLRRKIIDSLVEELGI 1057
            +H AC  G +++ E+LL +    NAA KN   P+H A  + + ++VKLLVS                                +C      E+   +TP+H A   G  D++ +L+     V +G+K                +G                         +H AC +G++ +VK L+ Q  ++   T+  ++PL  A+Q+G + IV LL     L  +I  +    LGI
Sbjct:  515 LHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGI 753          

HSP 9 Score: 87.4261 bits (215), Expect = 4.567e-31
Identity = 49/156 (31.41%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  GH     +LL       A       P+H AC+  H+  + LL+    S+E   +    P+H A    H+ IVK LL+   +  AS+     P+H A   G+ E+ + L+ N   +DA++     P+H A+  GH E+VK+LL  + N
Sbjct:  315 TPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKAN 470          

HSP 10 Score: 67.781 bits (164), Expect = 4.567e-31
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH +   +LL  + +     K    P+H AC+ G  ++ +LL+    +     +N LTP+H A  +   DV+ +L+          ++   P+H A     L +   L+    N  + + +  +PL LA+Q+G   +V LL
Sbjct:  482 LHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALL 629          

HSP 11 Score: 85.1149 bits (209), Expect = 5.297e-31
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +    +D    +H A   GH+ ++E+LL Q   I A  KN   PIH A Q  H + V+ L+ Y  + +    + LTP+H A   G+  +  VLL    K      +   P+H AC   H+  + +L+  + ++EA T+   +PL +A+  G   IV+ L
Sbjct:  240 IDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSL 398          

HSP 12 Score: 70.0922 bits (170), Expect = 5.297e-31
Identity = 50/189 (26.46%), Postives = 79/189 (41.80%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLIS-----------------------------NQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +H A++ GHV  V  LL H   +E   K     +H A   G   VV  L+  G ++    +    P++ A Q NH+E+VK LL++  N     ++G  P+  A   G+  +V LLI+                             N    D  S TG  P+H A+ Y +  + ++LL+   N+    K
Sbjct:   24 LHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK 212          

HSP 13 Score: 103.219 bits (256), Expect = 3.015e-22
Identity = 62/197 (31.47%), Postives = 97/197 (49.24%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISN-------------------------------QCCLDA--ESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            Q+P+H AA+ GH + V LLL+H    ++       P+H A + GH +  R+L+          K    P+H AC+   V++ +LLL+   N  A+ KNGL P+H A  H N+++VKLL+S                                QC  +A  ESL G  P+H A+  G  ++V +L+S++ N+ L +KV
Sbjct:  446 QTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKV 642          

HSP 14 Score: 67.0106 bits (162), Expect = 2.639e-21
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQ 973
            A+H A          +LL      +   K    P+H A    +  + +LL++   +     +N +TP+H A   G   ++ +LL    +++   KD+  P+H A   GH+ +++IL+ Q   I+A TK   SP+ +A+Q
Sbjct:  151 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQ 289          

HSP 15 Score: 55.0694 bits (131), Expect = 2.639e-21
Identity = 33/134 (24.63%), Postives = 62/134 (46.27%), Query Frame = 1
Query:   64 LKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLS 465
            +K+  AI   ++     +H A + GH+ +V  L+  G  +E   K     +H A      ++V  L+    N+ A  + G  P++ A    ++E+VK L+ N       +  G  P+  A   GH+ +V +L++
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLIN 140          

HSP 16 Score: 90.1225 bits (222), Expect = 3.220e-18
Identity = 44/156 (28.21%), Postives = 81/156 (51.92%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSE 468
            + ++P+H AA+ GH +    LL++   ++A  K D+ P+H A + GH  +V+LL+    + +        P+H A +  H    ++LL          K G  P+H AC +G V++ +LL+      +A    G  P+H A  + + ++VK+L+S+
Sbjct:  411 KVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 566          

HSP 17 Score: 89.3521 bits (220), Expect = 5.493e-18
Identity = 45/148 (30.41%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GHLNIV+ LL +    NA++     P+H A + GHCE+ + L+      + + ++  TP+H A   G+ +++ +LL +    +        P+H A   GH H  +IL+  N      TK+ ++PL +A + G   + ELL
Sbjct:  383 LHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELL 530          

HSP 18 Score: 86.2705 bits (212), Expect = 4.976e-17
Identity = 46/156 (29.49%), Postives = 85/156 (54.49%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRK-----PIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA+   ++  S LL+      +       P+H A Q G  ++V LLIS+  ++ + +K + +     P+H   Q  HV I  +L+K   ++ ++ + G   +H AC +GN+++VK L+  Q  ++ ++  G  P+H A+  GH +IV +LL
Sbjct:  579 TPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLL 734          

HSP 19 Score: 84.3445 bits (207), Expect = 2.300e-16
Identity = 46/156 (29.49%), Postives = 78/156 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  GH++ V  LL+   +  A +     P+H A + GH  V + L+     ++   KD + P+H A +  H E+VKLLL+ K N +++   G  P+H A   G+    ++L+         +  G  P+H A  YG  ++ ++LL    N
Sbjct:  381 TPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGAN 536          

HSP 20 Score: 83.1889 bits (204), Expect = 4.816e-16
Identity = 56/193 (29.02%), Postives = 91/193 (47.15%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGC-----------------------------SIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            SP++ AAQ  H++ V  LL++  N ++   D F   P+  A Q GH NVV LLI+ G                              + ++  K    P+H A    ++ + +LLL    N+  + KNG+ P+H A   GNV +V+LL+     +DA +     P+H A+  GH  +++ILL +   I+ + K
Sbjct:   88 SPLYMAAQENHLEVVKFLLENGANQSLPTEDGF--TPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTK 278          

HSP 21 Score: 79.7221 bits (195), Expect = 5.425e-15
Identity = 48/174 (27.59%), Postives = 90/174 (51.72%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL---SDTLRRKIIDSLVEELGIQCFDG 1072
            +H A  RG++ +V +LL +  +I+A  K+   P+H A +NGH  ++++L+      + + +N L+PIH A    + D +  LL  N +++    D   P+H A   GH  + K+L+ +     A     ++PL +A +K   + ++LL   S +L   + +S +  L +  F G
Sbjct:  218 LHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASL-EAVTESGLTPLHVAAFMG 390          

HSP 22 Score: 79.337 bits (194), Expect = 8.331e-15
Identity = 46/159 (28.93%), Postives = 87/159 (54.72%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQD 492
            +H AA+N      ++LL+++   +   K    P+H A    +L+V +LL++ G ++    K+   P+H A +  +V +V+LLL     ++A  K+ L P+H A  +G+V ++++L+     + A++  G  PIH A+   H + V+ LL  + N E+ D
Sbjct:  152 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDD 308          

HSP 23 Score: 78.9518 bits (193), Expect = 1.050e-14
Identity = 40/155 (25.81%), Postives = 77/155 (49.68%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDR-----CPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H AAQ G  D V+LL+     +   +K         P+H   Q GH+ +  +L+ +G S+    +     +H AC   ++++VK LL+ + ++    + G  P+H A   G+ +IV LL+ +    +  +  G+ P+  A   G+  ++ +L
Sbjct:  612 TPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 24 Score: 77.7962 bits (190), Expect = 2.434e-14
Identity = 52/201 (25.87%), Postives = 88/201 (43.78%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLD--------------------------------------AESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +P+H A + G VD   LLL+      A  K    P+H A  + +L+VV+LL+S+G S     ++   P+H A + N +E+   LL+   N  +    G+ P+H A   G  ++V LLIS Q  ++                                      + S  G   +H A  YG+ ++VK LL ++ ++  + +V
Sbjct:  513 TPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRV 713          

HSP 25 Score: 77.7962 bits (190), Expect = 2.698e-14
Identity = 42/150 (28.00%), Postives = 80/150 (53.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A    +L++ ++LL +   +N   KN   P+H A + G+  +V+LL+      + R +++LTP+H A   G+  V+ +LL     ++   K+   PIH A    H+  V+ L+  N  I+  T ++ +PL +A+  G  ++ ++L D
Sbjct:  185 LHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLD 334          

HSP 26 Score: 67.3958 bits (163), Expect = 1.957e-11
Identity = 48/190 (25.26%), Postives = 80/190 (42.11%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------------------DENK-------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q     ++ A    HL +V+ LL      +   ++   P+  A Q GH  +V LL++Y    +VR                      D N         TP+H A  Y    V  +LL     V    K+   P+H A   G++ +V++L+ +   I+A TK+  +PL  A++ G  +++E+L D
Sbjct:   79 VNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLD 268          

HSP 27 Score: 21.557 bits (44), Expect = 1.957e-11
Identity = 13/45 (28.89%), Postives = 21/45 (46.67%), Query Frame = 1
Query:  361 ISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            I N   ++  +  G   +H AS  GH ++V  LL    ++E   K
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTK 51          

HSP 28 Score: 63.929 bits (154), Expect = 4.703e-10
Identity = 43/180 (23.89%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVM-----------------------------TVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G   +V  L+     +NA  +    P++ A Q  H E+VK L+    ++ +  E+  TP+  A   G+ +V+                              VLL N+   +V  K    P+H A  + +L + ++L+++  N+    K   +PL +A+++G   +V LL D
Sbjct:   56 ALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLD 235          

HSP 29 Score: 62.3882 bits (150), Expect = 1.428e-9
Identity = 39/153 (25.49%), Postives = 65/153 (42.48%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRR-----PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G  ++V +L+++   +N  +K   +     P+H   Q GH  I  +LV              T +H AC YG   ++  LL     V    +    P+H A   GH  IV +L+         T    SPL +A + G+  ++++L
Sbjct:  614 LHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 30 Score: 58.5362 bits (140), Expect = 1.930e-8
Identity = 36/126 (28.57%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  626 INAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            IN A++N    +H A + GH ++V  L+ +  D E   +   T +H A   G   V+  L+     V    +    P++ A    HL +VK L+    N    T++ ++PL +A Q+G   +V LL
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALL 138          

HSP 31 Score: 53.5286 bits (127), Expect = 6.883e-7
Identity = 32/108 (29.63%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  163 ISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            I  G +I   +++    +H A +  HV++V  LL    +LE + K G   +H A   G  ++V  L+     ++A+S  G  P++ A+   H E+VK LL    N  L
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSL 114          

HSP 32 Score: 53.5286 bits (127), Expect = 7.002e-7
Identity = 28/83 (33.73%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVL 805
            A+H AC  G++ +V+ LL Q   +N   +    P+H A Q GH +IV LL+ +         N  +P+  A   GY  V+ VL
Sbjct:  684 ALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 91.2781 bits (225), Expect = 6.319e-38
Identity = 47/154 (30.52%), Postives = 77/154 (50.00%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++ +H AA+ G  D V  LL++   ++   K D+  +H A + G   +V+LL+ +G            P+H A +  H E   LLL+   +L A+ K G  P+H A  +G +E  KLL+  +   D    TG  P+H A+ Y +  +  +LL
Sbjct:  467 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLL 620          

HSP 2 Score: 87.0409 bits (214), Expect = 6.319e-38
Identity = 46/148 (31.08%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  L I   LL    E NA  +    P+H A Q G  ++V LL++   +  + ++N LTP+H A       V  VLL +  +V+   K    P+H AC +G++ +V  L+     I + TK  ++PL  A+Q+G + I+ +L
Sbjct:  637 LHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 784          

HSP 3 Score: 88.9669 bits (219), Expect = 4.596e-36
Identity = 45/156 (28.85%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+++  +LLL    A++   + D  P+H A + G+ N+V+LL+  G  I+   KD   P+H   ++ H ++V++LL     + +  KNGL P+H A    ++  V+LL+ +   +D  +      +H A+  GH ++ K+++ ++ N
Sbjct:  239 TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN 394          

HSP 4 Score: 82.8037 bits (203), Expect = 4.596e-36
Identity = 46/148 (31.08%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+LL     + A  ++   PIH A   GH  IVK L  +       +    T +H A   G  DV+  LL N  KV++  KDD   +H A   G   IV++L+ +     A T   ++PL LA ++G  +   LL
Sbjct:  406 LHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLL 553          

HSP 5 Score: 98.9821 bits (245), Expect = 7.419e-36
Identity = 51/150 (34.00%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H  A++GH   V +LL     I +  K    P+H A Q  HLN V+LL+     ++    D    +H A    H ++ K+++  K N  A   NG  P+H AC    V++++LL+ +   L A + +G  PIH A+F GH+ IVK L
Sbjct:  305 TPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 454          

HSP 6 Score: 72.0182 bits (175), Expect = 7.419e-36
Identity = 39/150 (26.00%), Postives = 67/150 (44.67%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            V    +D   A+H A   G   IV++LL +    +AA  +   P+H A + GH E   LL+ +        +   TP+H A  YG  +   +LL      +   K    P+H A  + +  +  +L+    +  A  K  ++PL +A++K
Sbjct:  494 VDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKK 643          

HSP 7 Score: 83.5741 bits (205), Expect = 1.068e-32
Identity = 43/153 (28.10%), Postives = 77/153 (50.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLR 1018
            +H A   G +++V +LL ++  +N  +KN   P+H A Q     + ++L+++  + +   +   TP+H AC YG   +++ LL N  K+    K    P+H A   GH HI+ +L+    +    T    + L +A + G+  +V    DTLR
Sbjct:  670 LHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVV----DTLR 818          

HSP 8 Score: 77.0258 bits (188), Expect = 1.068e-32
Identity = 45/152 (29.61%), Postives = 70/152 (46.05%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            Q+ +H A++ G  + V LLL+      A       P+H A + GH     LL+  G S+    K    P+H A +   +E  KLLL+ +   + + K GL P+H A  + N  +  LL+ +     A +  G  P+H A+     EI   LL
Sbjct:  502 QTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLL 653          

HSP 9 Score: 88.9669 bits (219), Expect = 2.357e-32
Identity = 51/154 (33.12%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH + V  L  H  +    +      +H A + G  +VVR L+  G  ++I  KD +  +H A +    EIV+LLL+      A+  +G  P+H A   G+ E   LL+ +   L A +  G  P+H A+ YG  E  K+LL +R
Sbjct:  437 TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR 590          

HSP 10 Score: 70.4774 bits (171), Expect = 2.357e-32
Identity = 38/148 (25.68%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +  +  +LL      +AA KN   P+H A +    EI   L+ +  +        ++P+H A   G  D++++LL  N  V +G+K+   P+H A     + + ++L++    ++A TK  ++PL +A   G  ++V  L
Sbjct:  604 LHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFL 751          

HSP 11 Score: 79.337 bits (194), Expect = 3.439e-31
Identity = 47/186 (25.27%), Postives = 87/186 (46.77%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQC-----------------------------CLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIEL 486
            +H A++ GHV+ V+ LLK   +++A  K     +H A   G  +VVR L++ G ++    ++   P++ A Q NH+E+V+ LL+   +   + ++G  P+  A   G+ ++V LL+ N                                 D ES +G  P+H A+ YG+  +  +LL+    ++ 
Sbjct:   80 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDF 265          

HSP 12 Score: 76.2554 bits (186), Expect = 3.439e-31
Identity = 40/148 (27.03%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  K+   P+H   ++GH ++V++L+        + +N L+P+H A    + + + +LL ++  V+    D    +H A   GH  + K+++ +  N  A     ++PL +A +K   +++ELL
Sbjct:  274 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 421          

HSP 13 Score: 78.9518 bits (193), Expect = 6.598e-31
Identity = 48/164 (29.27%), Postives = 83/164 (50.61%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKH--NNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P++ AAQ  H++ V  LL+H  + +I   D F   P+  A Q GH  VV LL+      +   K +   +H A + +  +   LLL++  N +   K+G  P+H A  +GN+ +  LL++    +D  +     P+H A+  G+  +VK+LL     I+ + K
Sbjct:  144 TPLYMAAQENHLEVVRFLLEHGASQSIATEDGF--TPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTK 301          

HSP 14 Score: 75.8702 bits (185), Expect = 6.598e-31
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLN V++LL     ++    +Y   +H A   GH ++ K++V  K +   +  N  TP+H AC      VM +LL +   ++   +    PIH A F GH +IVK L     +         + L +A++ G + +V  L
Sbjct:  340 LHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 487          

HSP 15 Score: 67.0106 bits (162), Expect = 6.472e-24
Identity = 40/149 (26.85%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            A+H A  +       +LL      +   K+   P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    K++   KD   P+H     GH  +V++L+ +   I + TK   SPL +A+Q      V+LL
Sbjct:  207 ALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 355          

HSP 16 Score: 64.3142 bits (155), Expect = 6.472e-24
Identity = 38/146 (26.03%), Postives = 71/146 (48.63%), Query Frame = 1
Query:   25 AAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            AA+ G+++     LK    I   ++     +H A + GH+ VV  L+  G S++   K     +H A      ++V+ L+ +  N+ A  +NG  P++ A    ++E+V+ L+ +       +  G  P+  A   GHD++V +LL
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLL 195          

HSP 17 Score: 77.7962 bits (190), Expect = 4.107e-22
Identity = 52/190 (27.37%), Postives = 85/190 (44.74%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK-------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q+    ++ A    HL +V  LL      + A ++   P+  A Q GH ++V LL+      +VR          D+ K                    TP+H A  YG  +V T+LL     V+   ++D  P+H A   G+ ++VK+L+ +   I+A TK+  +PL   ++ G  Q+VE+L D
Sbjct:  135 VNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLD 324          

HSP 18 Score: 47.3654 bits (111), Expect = 4.107e-22
Identity = 23/78 (29.49%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  262 LKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            LK+  ++   ++NGL  +H A   G+VE+V  L+     +DA +  G+  +H AS  G  ++V+ L++   N+  Q +
Sbjct:   63 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQ 140          

HSP 19 Score: 100.138 bits (248), Expect = 2.731e-21
Identity = 46/156 (29.49%), Postives = 90/156 (57.69%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA+   ++  + LL+      A  +    P+H A Q G +++V LL+++  ++ + +K+   P+H A Q + V + ++LL     ++A  K G  P+H AC +GN+++V  L+ NQ  +++++ +G  P+H A+  GH  I+ +LL  R +
Sbjct:  635 TPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRAS 790          

HSP 20 Score: 89.3521 bits (220), Expect = 6.750e-18
Identity = 45/150 (30.00%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            SP+H AAQ G VD VSLLL  N  +   +K    P+H A Q   + V  +L++ G  ++   K    P+H AC   ++++V  LL+++  + +  K+G  P+H A   G+  I+ +L+ ++   +  +L G+  +  A   G+  +V  L
Sbjct:  668 SPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 21 Score: 87.8113 bits (216), Expect = 2.100e-17
Identity = 49/162 (30.25%), Postives = 78/162 (48.15%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL H  +  A  K    P+H A +   L +   L+  G       +    P+H A Q   V++V LLL    N+   +KNGL P+H A     V + ++L+++   +DA + TG  P+H A  YG+ ++V  LL  +  I  + K
Sbjct:  602 TPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTK 763          

HSP 22 Score: 84.3445 bits (207), Expect = 2.190e-16
Identity = 46/162 (28.40%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A + GH +  SLLL+H  ++ A  K    P+H A + G +   +LL+ +  + +   K    P+H A   ++  +  LLL    +  A+ KNG  P+H A     +EI   L+      +A +  G  P+H A+  G  ++V +LL++  N+ + +K
Sbjct:  536 TPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNK 697          

HSP 23 Score: 80.1073 bits (196), Expect = 4.332e-15
Identity = 41/149 (27.52%), Postives = 82/149 (55.03%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +H AA+     + +LLL++++  +   K    P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++A  K+GL P+H     G+ ++V++L+     + +++  G  P+H A+   H   V++LL
Sbjct:  208 LHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 356          

HSP 24 Score: 77.411 bits (189), Expect = 3.443e-14
Identity = 44/190 (23.16%), Postives = 89/190 (46.84%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDGR---------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    +    A+H A   G  ++V  L+     +NA  +N   P++ A Q  H E+V+ L+ +   + +  E+  TP+  A   G+  V+++LL N+ K +V          KDD +                     P+H A  +G++++  +L+++   ++   + + +PL +A+++G   +V+LL D
Sbjct:  102 VDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLD 291          

HSP 25 Score: 75.485 bits (184), Expect = 1.343e-13
Identity = 45/148 (30.41%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH     +LL     ++AA K    P+H A + G  E  KLL+  +   +   +  LTP+H A  Y    V  +LL +        K+   P+H A     L I   L+       A T++  SPL LA+Q+G   +V LL
Sbjct:  538 LHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 685          

HSP 26 Score: 69.707 bits (169), Expect = 8.205e-12
Identity = 40/160 (25.00%), Postives = 75/160 (46.88%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +    +D    +H     GH  +VEMLL +   I +  KN   P+H A Q  H   V+LL+ +    +    + LT +H A   G++ V  V++           +   P+H AC    + ++++L+    +++A T+   +P+ +A+  G   IV+ L+
Sbjct:  296 IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLT 455          

HSP 27 Score: 69.3218 bits (168), Expect = 1.016e-11
Identity = 40/175 (22.86%), Postives = 77/175 (44.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            IH A   GH NIV+ L       N  +      +H A + G  ++V+ L+      +++ ++  T +H A   G  +++ +LL               P+H A   GH     +L+    ++ A TK+ ++PL +A++ G  +  +LL   L+++       + G+      +HY
Sbjct:  439 IHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL---LQKRAAPDTAGKTGLTPLHVAAHY 610          

HSP 28 Score: 67.3958 bits (163), Expect = 3.984e-11
Identity = 35/113 (30.97%), Postives = 62/113 (54.87%), Query Frame = 1
Query:  124 ACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            A + G+L      +  G  I IC+++    +H A +  HVE+V  LLK   +++A+ K G   +H A   G  ++V+ L++N   ++A+S  G  P++ A+   H E+V+ LL
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 162          

HSP 29 Score: 66.2402 bits (160), Expect = 8.590e-11
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  545 DSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            DS  +   A   G+L      L    +IN  ++N    +H A + GH E+V  L+      +   +   T +H A   G  DV+  L+ N   V    ++   P++ A    HL +V+ L+    +    T++ ++PL +A Q+G  Q+V LL
Sbjct:   42 DSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLL 194          

HSP 30 Score: 66.2402 bits (160), Expect = 9.847e-11
Identity = 36/150 (24.00%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + + ++ LTP+H     G+  V+ +LL     +    K+   P+H A    HL+ V++L+  +  ++  T +  + L +A+  G  ++ +++ D
Sbjct:  241 LHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVD 390          

HSP 31 Score: 64.6994 bits (156), Expect = 2.813e-10
Identity = 37/151 (24.50%), Postives = 69/151 (45.70%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  LL    +++   K+ +  +H A + G  EIV+LL+           +  TP+H A   G+ +  ++LL +   +    K    P+H A  +G +   K+L+ +    +   K   +PL +A+     ++  LL D
Sbjct:  471 ALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLD 621          

HSP 32 Score: 63.1586 bits (152), Expect = 9.209e-10
Identity = 36/148 (24.32%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G +   ++LL +    + A K    P+H A    +  +  LL+ +        +N  TP+H A      ++ T LL    +     +    P+H A   G + +V +L+++N N+    K   +PL LA+Q+    + E+L
Sbjct:  571 LHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVL 718          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 92.0485 bits (227), Expect = 1.619e-37
Identity = 47/154 (30.52%), Postives = 77/154 (50.00%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++ +H AA+ G  D V  LL++   ++   K D+  +H A + G   +V+LL+ +G            P+H A +  H E   LLL+   +L A+ K G  P+H A  +G +E  KLL+  +   D    TG  P+H A+ Y +  +  +LL
Sbjct:  419 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLL 572          

HSP 2 Score: 84.7297 bits (208), Expect = 1.619e-37
Identity = 46/148 (31.08%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  L I   LL    E NA  +    P+H A Q G  ++V LL++   +  + ++N LTP+H A       V  VLL +  +V+   K    P+H AC +G++ +V  L+     I + TK  ++PL  A+Q+G + I+ +L
Sbjct:  589 LHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 736          

HSP 3 Score: 89.7373 bits (221), Expect = 4.788e-35
Identity = 45/156 (28.85%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+++  +LLL    A++   + D  P+H A + G+ N+V+LL+  G  I+   KD   P+H   ++ H ++V++LL     + +  KNGL P+H A    ++  V+LL+ +   +D  +      +H A+  GH ++ K+++ ++ N
Sbjct:  191 TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN 346          

HSP 4 Score: 78.5666 bits (192), Expect = 4.788e-35
Identity = 46/148 (31.08%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+LL     + A  ++   PIH A   GH  IVK L  +       +    T +H A   G  DV+  LL N  KV++  KDD   +H A   G   IV++L+ +     A T   ++PL LA ++G  +   LL
Sbjct:  358 LHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLL 505          

HSP 5 Score: 81.6481 bits (200), Expect = 2.276e-32
Identity = 43/153 (28.10%), Postives = 77/153 (50.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLR 1018
            +H A   G +++V +LL ++  +N  +KN   P+H A Q     + ++L+++  + +   +   TP+H AC YG   +++ LL N  K+    K    P+H A   GH HI+ +L+    +    T    + L +A + G+  +V    DTLR
Sbjct:  622 LHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVV----DTLR 770          

HSP 6 Score: 77.7962 bits (190), Expect = 2.276e-32
Identity = 45/152 (29.61%), Postives = 70/152 (46.05%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            Q+ +H A++ G  + V LLL+      A       P+H A + GH     LL+  G S+    K    P+H A +   +E  KLLL+ +   + + K GL P+H A  + N  +  LL+ +     A +  G  P+H A+     EI   LL
Sbjct:  454 QTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLL 605          

HSP 7 Score: 100.138 bits (248), Expect = 2.555e-32
Identity = 51/150 (34.00%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H  A++GH   V +LL     I +  K    P+H A Q  HLN V+LL+     ++    D    +H A    H ++ K+++  K N  A   NG  P+H AC    V++++LL+ +   L A + +G  PIH A+F GH+ IVK L
Sbjct:  257 TPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 406          

HSP 8 Score: 59.3066 bits (142), Expect = 2.555e-32
Identity = 37/151 (24.50%), Postives = 69/151 (45.70%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  LL    +++   K+ +  +H A + G  EIV+LL+           +  TP+H A   G+ +  ++LL +   +    K    P+H A  +G +   K+L+ +    +   K   +PL +A+     ++  LL D
Sbjct:  423 ALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLD 573          

HSP 9 Score: 89.7373 bits (221), Expect = 8.730e-32
Identity = 51/154 (33.12%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH + V  L  H  +    +      +H A + G  +VVR L+  G  ++I  KD +  +H A +    EIV+LLL+      A+  +G  P+H A   G+ E   LL+ +   L A +  G  P+H A+ YG  E  K+LL +R
Sbjct:  389 TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR 542          

HSP 10 Score: 67.781 bits (164), Expect = 8.730e-32
Identity = 38/148 (25.68%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +  +  +LL      +AA KN   P+H A +    EI   L+ +  +        ++P+H A   G  D++++LL  N  V +G+K+   P+H A     + + ++L++    ++A TK  ++PL +A   G  ++V  L
Sbjct:  556 LHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFL 703          

HSP 11 Score: 73.559 bits (179), Expect = 1.072e-28
Identity = 52/202 (25.74%), Postives = 83/202 (41.09%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLL----------------------KSKCNLEASDKN---------------GLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +  + +H A+  G  D V  L+ +   + A  +    P++ A Q  HL VVR L+  G S  I  +D   P+  A Q  H ++V LLL                      KS   L  +D N               G  P+H A  +GN+ +  LL++    +D  +     P+H A+  G+  +VK+LL     I+ + K
Sbjct:   52 KGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTK 253          

HSP 12 Score: 73.559 bits (179), Expect = 1.072e-28
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLN V++LL     ++    +Y   +H A   GH ++ K++V  K +   +  N  TP+H AC      VM +LL +   ++   +    PIH A F GH +IVK L     +         + L +A++ G + +V  L
Sbjct:  292 LHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 439          

HSP 13 Score: 77.0258 bits (188), Expect = 9.938e-27
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +H A++ GHV+ V+ LLK   +++A  K     +H A   G  +VVR L++ G ++    ++   P++ A Q NH+E+V+ LL+   +   + ++G  P+  A   G+ ++V LL+ N    D +       +H A+     +   +LL    N +++ KV
Sbjct:   24 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKV 180          

HSP 14 Score: 63.929 bits (154), Expect = 9.938e-27
Identity = 36/150 (24.00%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + + ++ LTP+H     G+  V+ +LL     +    K+   P+H A    HL+ V++L+  +  ++  T +  + L +A+  G  ++ +++ D
Sbjct:  193 LHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVD 342          

HSP 15 Score: 101.293 bits (251), Expect = 1.736e-21
Identity = 46/156 (29.49%), Postives = 90/156 (57.69%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA+   ++  + LL+      A  +    P+H A Q G +++V LL+++  ++ + +K+   P+H A Q + V + ++LL     ++A  K G  P+H AC +GN+++V  L+ NQ  +++++ +G  P+H A+  GH  I+ +LL  R +
Sbjct:  587 TPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRAS 742          

HSP 16 Score: 70.8626 bits (172), Expect = 3.948e-20
Identity = 52/198 (26.26%), Postives = 85/198 (42.93%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK---------------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q+    ++ A    HL +V  LL      + A ++   P+  A Q GH ++V LL+      +VR          D+ K                            TP+H A  YG  +V T+LL     V+   ++D  P+H A   G+ ++VK+L+ +   I+A TK+  +PL   ++ G  Q+VE+L D
Sbjct:   79 VNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLD 276          

HSP 17 Score: 47.7506 bits (112), Expect = 3.948e-20
Identity = 23/78 (29.49%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  262 LKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            LK+  ++   ++NGL  +H A   G+VE+V  L+     +DA +  G+  +H AS  G  ++V+ L++   N+  Q +
Sbjct:    7 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQ 84          

HSP 18 Score: 90.1225 bits (222), Expect = 4.371e-18
Identity = 45/150 (30.00%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            SP+H AAQ G VD VSLLL  N  +   +K    P+H A Q   + V  +L++ G  ++   K    P+H AC   ++++V  LL+++  + +  K+G  P+H A   G+  I+ +L+ ++   +  +L G+  +  A   G+  +V  L
Sbjct:  620 SPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 769          

HSP 19 Score: 88.5817 bits (218), Expect = 1.404e-17
Identity = 49/162 (30.25%), Postives = 78/162 (48.15%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL H  +  A  K    P+H A +   L +   L+  G       +    P+H A Q   V++V LLL    N+   +KNGL P+H A     V + ++L+++   +DA + TG  P+H A  YG+ ++V  LL  +  I  + K
Sbjct:  554 TPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTK 715          

HSP 20 Score: 85.1149 bits (209), Expect = 1.494e-16
Identity = 46/162 (28.40%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A + GH +  SLLL+H  ++ A  K    P+H A + G +   +LL+ +  + +   K    P+H A   ++  +  LLL    +  A+ KNG  P+H A     +EI   L+      +A +  G  P+H A+  G  ++V +LL++  N+ + +K
Sbjct:  488 TPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNK 649          

HSP 21 Score: 73.559 bits (179), Expect = 5.604e-13
Identity = 40/148 (27.03%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  K+   P+H   ++GH ++V++L+        + +N L+P+H A    + + + +LL ++  V+    D    +H A   GH  + K+++ +  N  A     ++PL +A +K   +++ELL
Sbjct:  226 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 373          

HSP 22 Score: 70.4774 bits (171), Expect = 5.795e-12
Identity = 45/148 (30.41%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH     +LL     ++AA K    P+H A + G  E  KLL+  +   +   +  LTP+H A  Y    V  +LL +        K+   P+H A     L I   L+       A T++  SPL LA+Q+G   +V LL
Sbjct:  490 LHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 637          

HSP 23 Score: 68.1662 bits (165), Expect = 2.425e-11
Identity = 40/155 (25.81%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +D    +H     GH  +VEMLL +   I +  KN   P+H A Q  H   V+LL+ +    +    + LT +H A   G++ V  V++           +   P+H AC    + ++++L+    +++A T+   +P+ +A+  G   IV+ L+
Sbjct:  253 KDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLT 407          

HSP 24 Score: 67.0106 bits (162), Expect = 6.241e-11
Identity = 38/145 (26.21%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            +D   A+H A   G   IV++LL +    +AA  +   P+H A + GH E   LL+ +        +   TP+H A  YG  +   +LL      +   K    P+H A  + +  +  +L+    +  A  K  ++PL +A++K
Sbjct:  451 KDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKK 595          

HSP 25 Score: 66.6254 bits (161), Expect = 7.656e-11
Identity = 32/100 (32.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:  163 ISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +  G  I IC+++    +H A +  HVE+V  LLK   +++A+ K G   +H A   G  ++V+ L++N   ++A+S  G  P++ A+   H E+V+ LL
Sbjct:    7 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 106          

HSP 26 Score: 63.5438 bits (153), Expect = 7.622e-10
Identity = 36/132 (27.27%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  608 LAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            L    +IN  ++N    +H A + GH E+V  L+      +   +   T +H A   G  DV+  L+ N   V    ++   P++ A    HL +V+ L+    +    T++ ++PL +A Q+G  Q+V LL
Sbjct:    7 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLL 138          

HSP 27 Score: 62.3882 bits (150), Expect = 1.430e-9
Identity = 40/175 (22.86%), Postives = 77/175 (44.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            IH A   GH NIV+ L       N  +      +H A + G  ++V+ L+      +++ ++  T +H A   G  +++ +LL               P+H A   GH     +L+    ++ A TK+ ++PL +A++ G  +  +LL   L+++       + G+      +HY
Sbjct:  391 IHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL---LQKRAAPDTAGKTGLTPLHVAAHY 562          

HSP 28 Score: 59.6918 bits (143), Expect = 1.139e-8
Identity = 52/243 (21.40%), Postives = 97/243 (39.92%), Query Frame = 2
Query:  509 EKEKDYVKCYY------QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADK---------------------------------NYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDGR-----------------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            EK  DY+K         Q+   A+H A   GH+ +V  LL     ++AA K                                 N   P++ A Q  H E+V+ L+ +   + +  E+  TP+  A   G+  V+++LL N+ K +V          KDD +                             P+H A  +G++++  +L+++   ++   + + +PL +A+++G   +V+LL D
Sbjct:    1 EKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLD 243          

HSP 29 Score: 58.5362 bits (140), Expect = 2.155e-8
Identity = 34/116 (29.31%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  656 PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    K++   KD   P+H     GH  +V++L+ +   I + TK   SPL +A+Q      V+LL
Sbjct:  192 PLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 307          

HSP 30 Score: 57.7658 bits (138), Expect = 4.077e-8
Identity = 36/148 (24.32%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G +   ++LL +    + A K    P+H A    +  +  LL+ +        +N  TP+H A      ++ T LL    +     +    P+H A   G + +V +L+++N N+    K   +PL LA+Q+    + E+L
Sbjct:  523 LHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVL 670          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 90.8929 bits (224), Expect = 3.855e-37
Identity = 47/154 (30.52%), Postives = 77/154 (50.00%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            R ++ +H AA+ G  D V  LL++   ++   K D+  +H A + G   +V+LL+ +G            P+H A +  H E   LLL+   +L A+ K G  P+H A  +G +E  KLL+  +   D    TG  P+H A+ Y +  +  +LL
Sbjct:  439 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLL 592          

HSP 2 Score: 84.7297 bits (208), Expect = 3.855e-37
Identity = 46/148 (31.08%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  L I   LL    E NA  +    P+H A Q G  ++V LL++   +  + ++N LTP+H A       V  VLL +  +V+   K    P+H AC +G++ +V  L+     I + TK  ++PL  A+Q+G + I+ +L
Sbjct:  609 LHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 756          

HSP 3 Score: 88.5817 bits (218), Expect = 1.198e-34
Identity = 45/156 (28.85%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA  G+++  +LLL    A++   + D  P+H A + G+ N+V+LL+  G  I+   KD   P+H   ++ H ++V++LL     + +  KNGL P+H A    ++  V+LL+ +   +D  +      +H A+  GH ++ K+++ ++ N
Sbjct:  211 TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN 366          

HSP 4 Score: 78.5666 bits (192), Expect = 1.198e-34
Identity = 46/148 (31.08%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+LL     + A  ++   PIH A   GH  IVK L  +       +    T +H A   G  DV+  LL N  KV++  KDD   +H A   G   IV++L+ +     A T   ++PL LA ++G  +   LL
Sbjct:  378 LHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLL 525          

HSP 5 Score: 81.6481 bits (200), Expect = 4.826e-32
Identity = 43/153 (28.10%), Postives = 77/153 (50.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLR 1018
            +H A   G +++V +LL ++  +N  +KN   P+H A Q     + ++L+++  + +   +   TP+H AC YG   +++ LL N  K+    K    P+H A   GH HI+ +L+    +    T    + L +A + G+  +V    DTLR
Sbjct:  642 LHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVV----DTLR 790          

HSP 6 Score: 76.6406 bits (187), Expect = 4.826e-32
Identity = 45/152 (29.61%), Postives = 70/152 (46.05%), Query Frame = 1
Query:    7 QSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            Q+ +H A++ G  + V LLL+      A       P+H A + GH     LL+  G S+    K    P+H A +   +E  KLLL+ +   + + K GL P+H A  + N  +  LL+ +     A +  G  P+H A+     EI   LL
Sbjct:  474 QTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLL 625          

HSP 7 Score: 98.5969 bits (244), Expect = 7.290e-32
Identity = 51/150 (34.00%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            +P+H  A++GH   V +LL     I +  K    P+H A Q  HLN V+LL+     ++    D    +H A    H ++ K+++  K N  A   NG  P+H AC    V++++LL+ +   L A + +G  PIH A+F GH+ IVK L
Sbjct:  277 TPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 426          

HSP 8 Score: 59.3066 bits (142), Expect = 7.290e-32
Identity = 37/151 (24.50%), Postives = 69/151 (45.70%), Query Frame = 2
Query:  557 AIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            A+H A   G  ++V  LL    +++   K+ +  +H A + G  EIV+LL+           +  TP+H A   G+ +  ++LL +   +    K    P+H A  +G +   K+L+ +    +   K   +PL +A+     ++  LL D
Sbjct:  443 ALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLD 593          

HSP 9 Score: 88.5817 bits (218), Expect = 2.238e-31
Identity = 51/154 (33.12%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSER 471
            +PIH AA  GH + V  L  H  +    +      +H A + G  +VVR L+  G  ++I  KD +  +H A +    EIV+LLL+      A+  +G  P+H A   G+ E   LL+ +   L A +  G  P+H A+ YG  E  K+LL +R
Sbjct:  409 TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR 562          

HSP 10 Score: 67.781 bits (164), Expect = 2.238e-31
Identity = 38/148 (25.68%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    +  +  +LL      +AA KN   P+H A +    EI   L+ +  +        ++P+H A   G  D++++LL  N  V +G+K+   P+H A     + + ++L++    ++A TK  ++PL +A   G  ++V  L
Sbjct:  576 LHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFL 723          

HSP 11 Score: 73.559 bits (179), Expect = 3.034e-28
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A    HLN V++LL     ++    +Y   +H A   GH ++ K++V  K +   +  N  TP+H AC      VM +LL +   ++   +    PIH A F GH +IVK L     +         + L +A++ G + +V  L
Sbjct:  312 LHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 459          

HSP 12 Score: 72.0182 bits (175), Expect = 3.034e-28
Identity = 52/202 (25.74%), Postives = 83/202 (41.09%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLL----------------------KSKCNLEASDKN---------------GLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +  + +H A+  G  D V  L+ +   + A  +    P++ A Q  HL VVR L+  G S  I  +D   P+  A Q  H ++V LLL                      KS   L  +D N               G  P+H A  +GN+ +  LL++    +D  +     P+H A+  G+  +VK+LL     I+ + K
Sbjct:   72 KGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTK 273          

HSP 13 Score: 75.485 bits (184), Expect = 2.424e-26
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKV 498
            +H A++ GHV+ V+ LLK   +++A  K     +H A   G  +VVR L++ G ++    ++   P++ A Q NH+E+V+ LL+   +   + ++G  P+  A   G+ ++V LL+ N    D +       +H A+     +   +LL    N +++ KV
Sbjct:   44 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKV 200          

HSP 14 Score: 63.929 bits (154), Expect = 2.424e-26
Identity = 36/150 (24.00%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G++N+  +LL +   ++   +N   P+H A + G+  +VKLL+      + + ++ LTP+H     G+  V+ +LL     +    K+   P+H A    HL+ V++L+  +  ++  T +  + L +A+  G  ++ +++ D
Sbjct:  213 LHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVD 362          

HSP 15 Score: 99.7525 bits (247), Expect = 4.526e-21
Identity = 46/156 (29.49%), Postives = 90/156 (57.69%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN 477
            +P+H AA+   ++  + LL+      A  +    P+H A Q G +++V LL+++  ++ + +K+   P+H A Q + V + ++LL     ++A  K G  P+H AC +GN+++V  L+ NQ  +++++ +G  P+H A+  GH  I+ +LL  R +
Sbjct:  607 TPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRAS 762          

HSP 16 Score: 70.8626 bits (172), Expect = 6.602e-20
Identity = 52/198 (26.26%), Postives = 85/198 (42.93%), Query Frame = 2
Query:  527 VKCYYQDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVR----------DENK---------------------------LTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            V    Q+    ++ A    HL +V  LL      + A ++   P+  A Q GH ++V LL+      +VR          D+ K                            TP+H A  YG  +V T+LL     V+   ++D  P+H A   G+ ++VK+L+ +   I+A TK+  +PL   ++ G  Q+VE+L D
Sbjct:   99 VNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLD 296          

HSP 17 Score: 46.9802 bits (110), Expect = 6.602e-20
Identity = 23/78 (29.49%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  262 LKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            LK+  ++   ++NGL  +H A   G+VE+V  L+     +DA +  G+  +H AS  G  ++V+ L++   N+  Q +
Sbjct:   27 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQ 104          

HSP 18 Score: 88.9669 bits (219), Expect = 1.039e-17
Identity = 45/150 (30.00%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKIL 459
            SP+H AAQ G VD VSLLL  N  +   +K    P+H A Q   + V  +L++ G  ++   K    P+H AC   ++++V  LL+++  + +  K+G  P+H A   G+  I+ +L+ ++   +  +L G+  +  A   G+  +V  L
Sbjct:  640 SPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          

HSP 19 Score: 87.4261 bits (215), Expect = 3.093e-17
Identity = 49/162 (30.25%), Postives = 78/162 (48.15%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H AA   +     LLL H  +  A  K    P+H A +   L +   L+  G       +    P+H A Q   V++V LLL    N+   +KNGL P+H A     V + ++L+++   +DA + TG  P+H A  YG+ ++V  LL  +  I  + K
Sbjct:  574 TPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTK 735          

HSP 20 Score: 83.9593 bits (206), Expect = 3.222e-16
Identity = 46/162 (28.40%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +P+H A + GH +  SLLL+H  ++ A  K    P+H A + G +   +LL+ +  + +   K    P+H A   ++  +  LLL    +  A+ KNG  P+H A     +EI   L+      +A +  G  P+H A+  G  ++V +LL++  N+ + +K
Sbjct:  508 TPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNK 669          

HSP 21 Score: 73.559 bits (179), Expect = 5.086e-13
Identity = 40/148 (27.03%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  RG+ N+V++LL +  +I+A  K+   P+H   ++GH ++V++L+        + +N L+P+H A    + + + +LL ++  V+    D    +H A   GH  + K+++ +  N  A     ++PL +A +K   +++ELL
Sbjct:  246 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 393          

HSP 22 Score: 70.4774 bits (171), Expect = 5.288e-12
Identity = 45/148 (30.41%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH     +LL     ++AA K    P+H A + G  E  KLL+  +   +   +  LTP+H A  Y    V  +LL +        K+   P+H A     L I   L+       A T++  SPL LA+Q+G   +V LL
Sbjct:  510 LHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 657          

HSP 23 Score: 68.1662 bits (165), Expect = 2.220e-11
Identity = 40/155 (25.81%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLS 1006
            +D    +H     GH  +VEMLL +   I +  KN   P+H A Q  H   V+LL+ +    +    + LT +H A   G++ V  V++           +   P+H AC    + ++++L+    +++A T+   +P+ +A+  G   IV+ L+
Sbjct:  273 KDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLT 427          

HSP 24 Score: 67.0106 bits (162), Expect = 5.726e-11
Identity = 38/145 (26.21%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  542 QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQK 976
            +D   A+H A   G   IV++LL +    +AA  +   P+H A + GH E   LL+ +        +   TP+H A  YG  +   +LL      +   K    P+H A  + +  +  +L+    +  A  K  ++PL +A++K
Sbjct:  471 KDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKK 615          

HSP 25 Score: 65.4698 bits (158), Expect = 1.594e-10
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 1
Query:    1 RSQSPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            RS +    AA+ G+++     LK    I   ++     +H A + GH+ VV  L+  G S++   K     +H A      ++V+ L+ +  N+ A  +NG  P++ A    ++E+V+ L+ +       +  G  P+  A   GHD++V +LL
Sbjct:    6 RSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLL 159          

HSP 26 Score: 63.5438 bits (153), Expect = 7.032e-10
Identity = 36/132 (27.27%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  608 LAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            L    +IN  ++N    +H A + GH E+V  L+      +   +   T +H A   G  DV+  L+ N   V    ++   P++ A    HL +V+ L+    +    T++ ++PL +A Q+G  Q+V LL
Sbjct:   27 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLL 158          

HSP 27 Score: 62.3882 bits (150), Expect = 1.322e-9
Identity = 40/175 (22.86%), Postives = 77/175 (44.00%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDTLRRKIIDSLVEELGIQCFDGCSHY 1084
            IH A   GH NIV+ L       N  +      +H A + G  ++V+ L+      +++ ++  T +H A   G  +++ +LL               P+H A   GH     +L+    ++ A TK+ ++PL +A++ G  +  +LL   L+++       + G+      +HY
Sbjct:  411 IHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL---LQKRAAPDTAGKTGLTPLHVAAHY 582          

HSP 28 Score: 60.077 bits (144), Expect = 6.733e-9
Identity = 52/244 (21.31%), Postives = 98/244 (40.16%), Query Frame = 2
Query:  506 IEKEKDYVKCYY------QDSGRAIHYACCRGHLNIVEMLLAQSCEINAADK---------------------------------NYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEV--------GDKDDGR-----------------------------PIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +EK  DY+K         Q+   A+H A   GH+ +V  LL     ++AA K                                 N   P++ A Q  H E+V+ L+ +   + +  E+  TP+  A   G+  V+++LL N+ K +V          KDD +                             P+H A  +G++++  +L+++   ++   + + +PL +A+++G   +V+LL D
Sbjct:   20 LEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLD 263          

HSP 29 Score: 58.5362 bits (140), Expect = 2.004e-8
Identity = 34/116 (29.31%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  656 PIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            P+H A   G+  +  LL++     +    N +TP+H A   G  +++ +LL    K++   KD   P+H     GH  +V++L+ +   I + TK   SPL +A+Q      V+LL
Sbjct:  212 PLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 327          

HSP 30 Score: 57.7658 bits (138), Expect = 3.796e-8
Identity = 36/148 (24.32%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   G +   ++LL +    + A K    P+H A    +  +  LL+ +        +N  TP+H A      ++ T LL    +     +    P+H A   G + +V +L+++N N+    K   +PL LA+Q+    + E+L
Sbjct:  543 LHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVL 690          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 2.655e-38
Identity = 48/151 (31.79%), Postives = 86/151 (56.95%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA  G+++  +LLL    A++   +    P+H A + G+ N+V+LL+  G  I+   +D   P+H A ++ H +++++LL+    + A  KNGL P+H A    ++  V+LL+  Q  +D  +L    P+H A+  GH  + K+LL
Sbjct:  214 TPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLL 364          

HSP 2 Score: 83.5741 bits (205), Expect = 2.655e-38
Identity = 43/148 (29.05%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H AC +  + ++E+LL     I+   ++   PIH A   GH  +V+LL+         +    TP+H A   G  +V+  LL +  +V V  ++D  P+H A   G   IV++L+ +  +  A T    +PL  AS++G   +  LL
Sbjct:  381 LHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLL 528          

HSP 3 Score: 90.5077 bits (223), Expect = 3.647e-36
Identity = 47/148 (31.76%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A   GH  + ++LL +  E NA   N   P+H AC+    ++++LL+ +        E+ LTPIH A F G+ +V+ +LL N       +     P+H A   G L +VK L+     +    +E+ +PL +AS+ G ++IV+LL
Sbjct:  348 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 495          

HSP 4 Score: 79.337 bits (194), Expect = 3.647e-36
Identity = 42/164 (25.61%), Postives = 85/164 (51.83%), Query Frame = 1
Query:   16 IHYAAQNGHVDAVSLLLKHNNAIEAPDKF--------DRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIE 483
            +H AA+    +A +LLL+H +  +   K            P+H A   G++NV  LL++ G +++   ++   P+H A +  +  +VKLLL     ++   ++GL P+H A   G+ +++++L+     + A++  G  P+H A+   H   V++LL  +  ++
Sbjct:  175 LHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVD 338          

HSP 5 Score: 95.1301 bits (235), Expect = 1.058e-35
Identity = 50/151 (33.11%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILL 462
            +P+H AA++GH   + +LL+ +  I A  K    P+H A Q  HL  V+LL+     ++    D   P+H A    H  + KLLL       A   NG  P+H AC    +++++LL+ +   +   + +G  PIH ASF GH  +V++LL
Sbjct:  280 TPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLL 430          

HSP 6 Score: 73.559 bits (179), Expect = 1.058e-35
Identity = 40/150 (26.67%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 1009
            +H A   G L +V+ LL     +    +  + P+H A + G  EIV+LL+    D      +  TP+++A   G+ DV ++LL N   +    K    P+H A  +G L +  +L+ +  + +   K   +PL +A+     ++  LL D
Sbjct:  447 LHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLD 596          

HSP 7 Score: 96.2857 bits (238), Expect = 1.218e-34
Identity = 48/162 (29.63%), Postives = 87/162 (53.70%), Query Frame = 1
Query:   10 SPIHYAAQNGHVDAVSLLLKHNNAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNNHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISNQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDK 495
            +PIH A+  GH++ V LLL++  +  A +     P+H A + G L VV+ L+  G  + +  ++ + P+H A +    EIV+LLL+   +  A   +G  P+++A   G+ ++  LL+ N   +   +  G  P+H AS YG  E+  +LL +  + + + K
Sbjct:  412 TPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGK 573          

HSP 8 Score: 68.5514 bits (166), Expect = 1.218e-34
Identity = 39/148 (26.35%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  560 IHYACCRGHLNIVEMLLAQSCEINAADKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELL 1003
            +H A  +  L + ++LL    E N   +    P+H A Q GH ++V LL+       +  +  LT +H A      +V  +L  +   V    K    P+H A  +G++ +V  L+     + A T+  ++PL  A+Q+G + +V  L
Sbjct:  612 LHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNAL 759          

HSP 9 Score: 102.83