Mitochondrial enolase superfamily member 1

Overview
NameMitochondrial enolase superfamily member 1
Smed IDSMED30033140
Length (bp)1438
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial enolase superfamily member 1 (SMED30033140) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial enolase superfamily member 1 (SMED30033140) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial enolase superfamily member 1 (SMED30033140) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial enolase superfamily member 1 (SMED30033140) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033140

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30033140SMESG000069768.1 SmedASXL_008289SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30033140SMESG000069768.1 dd_Smed_v4_2923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033140SMESG000069768.1 dd_Smed_v4_2923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033140SMESG000069768.1 Contig18960uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033140SMESG000069768.1 Contig18960newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033140SMESG000069768.1 Contig40097uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033140SMESG000069768.1 Contig40097newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
goblet cellSMED30033140SMESG000069768.1 dd_Smed_v6_2923_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Human
Match: ENOSF1 (enolase superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:30365])

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 232/432 (53.70%), Postives = 318/432 (73.61%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            +  + + D+RFPT L  HG+DAMHTDP YSAAY++++T+ E  I G G +FT+G+G EVV+  + AL   + NK L +IV +F  F+  L ++ QLRW+GPEKGV+HLA AAV+NA+WDLW++ E KP+WKL+VDM P  L+S +DF YI D LT+E+ALEIL+K +  KK+ E +++  G+P+Y TS  WLGY D T++++C +AL  G+  FK+KVG DL+ D RR Q+ RD+IG ++ LM+DANQ W VPE++ WM +LA +KP WIEEPTS DDILGH  I+ AL P  I +ATGE CHNR++FKQ L++  +   QIDSCRL   NE + VLLMA K  +PVCPHAGGVGLCELVQH    DYI +S S E R+ EY DHLHEH++ PV+++  +Y  PK PG++ +  EE++K ++YP+G++W+KL
Sbjct:    6 ISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKL 437          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Human
Match: ENOSF1 (enolase superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:30365])

HSP 1 Score: 480.715 bits (1236), Expect = 7.560e-167
Identity = 217/413 (52.54%), Postives = 297/413 (71.91%), Query Frame = 3
Query:  135 SDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            +DAMHTDP YSAAY++++T+ E  I G G +FT+G+G EVV+  + AL   + NK L +IV +F  F+  L ++ QLRW+GPEKGV+HLA AAV+NA+WDLW++ E KP+WKL+VDM P  L+S +DF YI D LT+E+ALEIL+K +  KK+ E +++  G+P+Y TS  WLGY D T++++C +AL  G+  FK+KVG DL+ D RR Q+ RD+IG ++ LM+DANQ W VPE++ WM +LA +KP WIEEPTS DDILGH              AT   CHNR++FKQ L++  +   QIDSCRL   NE + VLLMA K  +PVCPHAGGVGLCELVQH    DYI +S S E R+ EY DHLHEH++ PV+++  +Y  PK PG++ +  EE++K ++YP+G++W+KL
Sbjct:   73 ADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGH--------------ATISKCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKL 471          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Human
Match: ENOSF1 (enolase superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:30365])

HSP 1 Score: 425.246 bits (1092), Expect = 9.066e-147
Identity = 188/340 (55.29%), Postives = 254/340 (74.71%), Query Frame = 3
Query:  348 ESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            E  L+ +GPEKGV+HLA AAV+NA+WDLW++ E KP+WKL+VDM P  L+S +DF YI D LT+E+ALEIL+K +  KK+ E +++  G+P+Y TS  WLGY D T++++C +AL  G+  FK+KVG DL+ D RR Q+ RD+IG ++ LM+DANQ W VPE++ WM +LA +KP WIEEPTS DDILGH  I+ AL P  I +ATGE CHNR++FKQ L++  +   QIDSCRL   NE + VLLMA K  +PVCPHAGGVGLCELVQH    DYI +S S E R+ EY DHLHEH++ PV+++  +Y  PK PG++ +  EE++K ++YP+G++W+KL
Sbjct:   16 EKALKLIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKL 355          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Human
Match: ENOSF1 (enolase superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:30365])

HSP 1 Score: 319.701 bits (818), Expect = 2.143e-105
Identity = 140/259 (54.05%), Postives = 190/259 (73.36%), Query Frame = 3
Query:  591 ENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            E +++  G+P+Y TS  WLGY D T++++C +AL  G+  FK+KVG DL+ D RR Q+ RD+IG ++ LM+DANQ W VPE++ WM +LA +KP WIEEPTS DDILGH  I+ AL P  I +ATGE CHNR++FKQ L++  +   QIDSCRL   NE + VLLMA K  +PVCPHAGGVGLCELVQH    DYI +S S E R+ EY DHLHEH++ PV+++  +Y  PK PG++ +  EE++K ++YP+G++W+KL
Sbjct:  103 EKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKL 361          

HSP 2 Score: 73.1738 bits (178), Expect = 2.025e-13
Identity = 31/59 (52.54%), Postives = 44/59 (74.58%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEV 248
            +  + + D+RFPT L  HG+DAMHTDP YSAAY++++T+ E  I G G +FT+G+G EV
Sbjct:    6 ISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEV 64          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Human
Match: ENOSF1 (enolase superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:30365])

HSP 1 Score: 167.933 bits (424), Expect = 3.230e-49
Identity = 73/136 (53.68%), Postives = 102/136 (75.00%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDM 479
            +  + + D+RFPT L  HG+DAMHTDP YSAAY++++T+ E  I G G +FT+G+G EVV+  + AL   + NK L +IV +F  F+  L ++ QLRW+GPEKGV+HLA AAV+NA+WDLW++ E KP+WKL+VDM
Sbjct:    6 ISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVDM 141          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Zebrafish
Match: enosf1 (enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-060929-780])

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 234/441 (53.06%), Postives = 320/441 (72.56%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQ-EISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            M  I + ++ + D+RFPT LE+HGSDAMHTDP YS AY++L+T++ E+ GYG +FT+GRG E+V+  ++AL  L+  K+L EI  +F  F+  L ++ Q+RW+GPEKGVIHLA AAV+NA+WDLW+R+E KPLWKL+VDM P  LIS +DF Y+ D LT++EAL+IL K +  +K  E +++K+G+P+Y TS  WLGY D+ + ++C EAL  G+  FK+KVG DL+ D RR  + R +IG +  LM+DANQ W V E+I W+ +LA ++P WIEEPT  DDILGH  I+ AL P  I VA+GE CHNR+MFKQFL++  +   QIDSCR+   NE +  +LMAAK  VPVCPHAGGVGLCELVQH    DYI +S S   RM E+ DHLHEH++ P ++RN  Y  PK PGF+ + +EE++K ++YP G++WR +  + K
Sbjct:    1 MLAIKIINVSVRDVRFPTSLEQHGSDAMHTDPDYSVAYVVLETDKAELKGYGLTFTVGRGTEIVVCAVKALSTLVVGKTLEEITSDFRGFYRLLSSDGQMRWIGPEKGVIHLATAAVLNAVWDLWARVERKPLWKLLVDMDPAKLISCIDFRYLTDALTEQEALDILVKGKKDQKSREEQMLKEGYPAYTTSCAWLGYTDQQLTQLCNEALAQGWTKFKVKVGADLQDDIRRCSLIRKLIGPNNTLMIDANQRWDVNEAITWVTKLAEFQPLWIEEPTCPDDILGHASISKALAPLGIGVASGEQCHNRVMFKQFLQASALQFVQIDSCRVGSVNENLATILMAAKFNVPVCPHAGGVGLCELVQHLILFDYISVSASLSNRMCEFVDHLHEHFKSPTVIRNAKYIPPKDPGFSCEMLEESVKKHQYPEGEVWRAIEKQQK 441          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Zebrafish
Match: enosf1 (enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-060929-780])

HSP 1 Score: 504.212 bits (1297), Expect = 5.638e-177
Identity = 226/441 (51.25%), Postives = 311/441 (70.52%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQ-EISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            M  I + ++ + D+RFPT LE+HGSDAMHTDP YS AY++L+T++ E+ GYG +FT+GRG E+V+  ++AL  L+  K+L EI  +F  F+  L ++ Q+RW+GPEKGVIHLA AAV+NA+WDLW+R+E K          P  LIS +DF Y+ D LT++EAL+IL K +  +K  E +++K+G+P+Y TS  WLGY D+ + ++C EAL  G+  FK+KVG DL+ D RR  + R +IG +  LM+DANQ W V E+I W+ +LA ++P WIEEPT  DDILGH  I+ AL P  I VA+GE CHNR+MFKQFL++  +   QIDSCR+   NE +  +LMAAK  VPVCPHAGGVGLCELVQH    DYI +S S   RM E+ DHLHEH++ P ++RN  Y  PK PGF+ + +EE++K ++YP G++WR +  + K
Sbjct:    1 MLAIKIINVSVRDVRFPTSLEQHGSDAMHTDPDYSVAYVVLETDKAELKGYGLTFTVGRGTEIVVCAVKALSTLVVGKTLEEITSDFRGFYRLLSSDGQMRWIGPEKGVIHLATAAVLNAVWDLWARVERK---------DPAKLISCIDFRYLTDALTEQEALDILVKGKKDQKSREEQMLKEGYPAYTTSCAWLGYTDQQLTQLCNEALAQGWTKFKVKVGADLQDDIRRCSLIRKLIGPNNTLMIDANQRWDVNEAITWVTKLAEFQPLWIEEPTCPDDILGHASISKALAPLGIGVASGEQCHNRVMFKQFLQASALQFVQIDSCRVGSVNENLATILMAAKFNVPVCPHAGGVGLCELVQHLILFDYISVSASLSNRMCEFVDHLHEHFKSPTVIRNAKYIPPKDPGFSCEMLEESVKKHQYPEGEVWRAIEKQQK 432          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Zebrafish
Match: enosf1 (enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-060929-780])

HSP 1 Score: 360.147 bits (923), Expect = 3.045e-122
Identity = 162/308 (52.60%), Postives = 224/308 (72.73%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQ-EISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHN 983
            M  I + ++ + D+RFPT LE+HGSDAMHTDP YS AY++L+T++ E+ GYG +FT+GRG E+V+  ++AL  L+  K+L EI  +F  F+  L ++ Q+RW+GPEKGVIHLA AAV+NA+WDLW+R+E KPLWKL+VDM P  LIS +DF Y+ D LT++EAL+IL K +  +K  E +++K+G+P+Y TS  WLGY D+ + ++C EAL  G+  FK+KVG DL+ D RR  + R +IG +  LM+DANQ W V E+I W+ +LA ++P WIEEPT  DDILGH  I+ AL P  I VA+GE  H 
Sbjct:    1 MLAIKIINVSVRDVRFPTSLEQHGSDAMHTDPDYSVAYVVLETDKAELKGYGLTFTVGRGTEIVVCAVKALSTLVVGKTLEEITSDFRGFYRLLSSDGQMRWIGPEKGVIHLATAAVLNAVWDLWARVERKPLWKLLVDMDPAKLISCIDFRYLTDALTEQEALDILVKGKKDQKSREEQMLKEGYPAYTTSCAWLGYTDQQLTQLCNEALAQGWTKFKVKVGADLQDDIRRCSLIRKLIGPNNTLMIDANQRWDVNEAITWVTKLAEFQPLWIEEPTCPDDILGHASISKALAPLGIGVASGEQQHQ 308          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Zebrafish
Match: enosf1 (enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-060929-780])

HSP 1 Score: 248.825 bits (634), Expect = 3.470e-80
Identity = 108/205 (52.68%), Postives = 155/205 (75.61%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQ-EISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIRE 674
            M  I + ++ + D+RFPT LE+HGSDAMHTDP YS AY++L+T++ E+ GYG +FT+GRG E+V+  ++AL  L+  K+L EI  +F  F+  L ++ Q+RW+GPEKGVIHLA AAV+NA+WDLW+R+E KPLWKL+VDM P  LIS +DF Y+ D LT++EAL+IL K +  +K  E +++K+G+P+Y TS  WLGY D+ + +
Sbjct:    1 MLAIKIINVSVRDVRFPTSLEQHGSDAMHTDPDYSVAYVVLETDKAELKGYGLTFTVGRGTEIVVCAVKALSTLVVGKTLEEITSDFRGFYRLLSSDGQMRWIGPEKGVIHLATAAVLNAVWDLWARVERKPLWKLLVDMDPAKLISCIDFRYLTDALTEQEALDILVKGKKDQKSREEQMLKEGYPAYTTSCAWLGYTDQQLTQ 205          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Xenopus
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:100127818])

HSP 1 Score: 516.924 bits (1330), Expect = 0.000e+0
Identity = 235/442 (53.17%), Postives = 318/442 (71.95%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            M T  + S+ + D+RFPT L++HGSDAMHTDP YSAAYI+++T+    + G+G +FT+G+G E+V+  + AL   +  K+L +IV NF  F+  L ++ QLRW+GPEKG + LA AAV+NA+WDLW++ E KPLWKL+VDM P  L+S +DF YI D LT+EEALEIL+  +  ++  E  +++ G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ R +IG D ++M+DANQ W V E+I W+K+LA YKP WIEEPTS DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++  +   QIDSCRL   NE + VLLM+ K  VPVCPHAGGVGLCELVQH    DYI +SGS + RM EY DHLHEH+  PVI+    Y  PK PG++ +  +E++  Y++P+G+IW+KL  E K
Sbjct:    1 MITGTITSLHVTDVRFPTSLDQHGSDAMHTDPDYSAAYIVIETDAADGLKGHGLTFTLGKGTEIVVCAVRALSRHVIGKALGDIVNNFRDFYRQLTSDGQLRWIGPEKGAVQLATAAVLNAVWDLWAKKEKKPLWKLLVDMDPHQLVSCIDFRYITDALTEEEALEILQNGKQGQRDREEHMLRSGYPAYTTSCAWLGYSDEQLKKLCSDALKEGWTRFKVKVGADLKDDIRRCELIRGMIGPDNIMMLDANQRWDVQEAISWVKDLAKYKPLWIEEPTSPDDILGHATISKALSPLNIGVATGEQCHNRVMFKQFLQANALQYLQIDSCRLGSVNENLSVLLMSKKFNVPVCPHAGGVGLCELVQHLILFDYISVSGSLDNRMCEYVDHLHEHFMYPVIISRAAYMPPKDPGYSTEMKDESVLQYQFPDGEIWQKLILEKK 442          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Xenopus
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:100127818])

HSP 1 Score: 491.115 bits (1263), Expect = 1.148e-171
Identity = 227/442 (51.36%), Postives = 309/442 (69.91%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            M T  + S+ + D+RFPT L++HGSDAMHTDP YSAAYI+++T+    + G+G +FT+G+G E+V+  + AL   +  K+L +IV NF  F+  L ++ QLRW+GPEKG + LA AAV+NA+WDLW++ E K          P  L+S +DF YI D LT+EEALEIL+  +  ++  E  +++ G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ R +IG D ++M+DANQ W V E+I W+K+LA YKP WIEEPTS DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++  +   QIDSCRL   NE + VLLM+ K  VPVCPHAGGVGLCELVQH    DYI +SGS + RM EY DHLHEH+  PVI+    Y  PK PG++ +  +E++  Y++P+G+IW+KL  E K
Sbjct:    1 MITGTITSLHVTDVRFPTSLDQHGSDAMHTDPDYSAAYIVIETDAADGLKGHGLTFTLGKGTEIVVCAVRALSRHVIGKALGDIVNNFRDFYRQLTSDGQLRWIGPEKGAVQLATAAVLNAVWDLWAKKEKK---------DPHQLVSCIDFRYITDALTEEEALEILQNGKQGQRDREEHMLRSGYPAYTTSCAWLGYSDEQLKKLCSDALKEGWTRFKVKVGADLKDDIRRCELIRGMIGPDNIMMLDANQRWDVQEAISWVKDLAKYKPLWIEEPTSPDDILGHATISKALSPLNIGVATGEQCHNRVMFKQFLQANALQYLQIDSCRLGSVNENLSVLLMSKKFNVPVCPHAGGVGLCELVQHLILFDYISVSGSLDNRMCEYVDHLHEHFMYPVIISRAAYMPPKDPGYSTEMKDESVLQYQFPDGEIWQKLILEKK 433          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Xenopus
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:100127818])

HSP 1 Score: 474.552 bits (1220), Expect = 1.788e-165
Identity = 220/415 (53.01%), Postives = 293/415 (70.60%), Query Frame = 3
Query:  144 MHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            MHTDP YSAAYI+++T+    + G+G +FT+G+G E+V+  + AL   +  K+L +IV NF  F+  L ++ QLRW+GPEKG + LA AAV+NA+WDLW++ E KPLWKL+VDM P  L+S +DF YI D LT+EEALE +       + L+    K G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ R +IG D ++M+DANQ W V E+I W+K+LA YKP WIEEPTS DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++  +   QIDSCRL   NE + VLLM+ K  VPVCPHAGGVGLCELVQH    DYI +SGS + RM EY DHLHEH+  PVI+    Y  PK PG++ +  +E++  Y++P+G+IW+KL  E K
Sbjct:    1 MHTDPDYSAAYIVIETDAADGLKGHGLTFTLGKGTEIVVCAVRALSRHVIGKALGDIVNNFRDFYRQLTSDGQLRWIGPEKGAVQLATAAVLNAVWDLWAKKEKKPLWKLLVDMDPHQLVSCIDFRYITDALTEEEALERILCKADAGRLLQRS--KSGYPAYTTSCAWLGYSDEQLKKLCSDALKEGWTRFKVKVGADLKDDIRRCELIRGMIGPDNIMMLDANQRWDVQEAISWVKDLAKYKPLWIEEPTSPDDILGHATISKALSPLNIGVATGEQCHNRVMFKQFLQANALQYLQIDSCRLGSVNENLSVLLMSKKFNVPVCPHAGGVGLCELVQHLILFDYISVSGSLDNRMCEYVDHLHEHFMYPVIISRAAYMPPKDPGYSTEMKDESVLQYQFPDGEIWQKLILEKK 413          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Xenopus
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:100127818])

HSP 1 Score: 459.914 bits (1182), Expect = 1.823e-159
Identity = 218/445 (48.99%), Postives = 303/445 (68.09%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENL---ISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            M T  + S+ + D+RFPT L++HGSDAMHTDP YSAAYI+++T+    + G+G +FT+G+G E+V+  + AL   +  K+L +IV NF  F+  L ++ QLRW+GPEKG + LA AAV+NA+WDLW++ E K    + V + P+     ++++   YIE  L K +A  +L+++             +G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ R +IG D ++M+DANQ W V E+I W+K+LA YKP WIEEPTS DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++  +   QIDSCRL   NE + VLLM+ K  VPVCPHAGGVGLCELVQH    DYI +SGS + RM EY DHLHEH+  PVI+    Y  PK PG++ +  +E++  Y++P+G+IW+KL  E K
Sbjct:    1 MITGTITSLHVTDVRFPTSLDQHGSDAMHTDPDYSAAYIVIETDAADGLKGHGLTFTLGKGTEIVVCAVRALSRHVIGKALGDIVNNFRDFYRQLTSDGQLRWIGPEKGAVQLATAAVLNAVWDLWAKKEKKV--GICVKLVPKESGTGVTLIIRIYIERILCKADAGRLLQRS-------------NGYPAYTTSCAWLGYSDEQLKKLCSDALKEGWTRFKVKVGADLKDDIRRCELIRGMIGPDNIMMLDANQRWDVQEAISWVKDLAKYKPLWIEEPTSPDDILGHATISKALSPLNIGVATGEQCHNRVMFKQFLQANALQYLQIDSCRLGSVNENLSVLLMSKKFNVPVCPHAGGVGLCELVQHLILFDYISVSGSLDNRMCEYVDHLHEHFMYPVIISRAAYMPPKDPGYSTEMKDESVLQYQFPDGEIWQKLILEKK 430          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Xenopus
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:100127818])

HSP 1 Score: 436.802 bits (1122), Expect = 2.152e-150
Identity = 210/445 (47.19%), Postives = 297/445 (66.74%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENL---ISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            M T  + S+ + D+RFPT L++HGSDAMHTDP YSAAYI+++T+    + G+G +FT+G+G E+V+  + AL   +  K+L +IV NF  F+  L ++ QLRW+GPEKG + LA AAV+NA+WDLW++ E K    + V + P+     ++++   YIE  L K +A  +L+++             +G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ R +IG D ++M+DANQ W V E+I W+K+LA YKP WIEEPTS DDILGH  I+  +    I +     CHNR+MFKQFL++  +   QIDSCRL   NE + VLLM+ K  VPVCPHAGGVGLCELVQH    DYI +SGS + RM EY DHLHEH+  PVI+    Y  PK PG++ +  +E++  Y++P+G+IW+KL  E K
Sbjct:    1 MITGTITSLHVTDVRFPTSLDQHGSDAMHTDPDYSAAYIVIETDAADGLKGHGLTFTLGKGTEIVVCAVRALSRHVIGKALGDIVNNFRDFYRQLTSDGQLRWIGPEKGAVQLATAAVLNAVWDLWAKKEKKV--GICVKLVPKESGTGVTLIIRIYIERILCKADAGRLLQRS-------------NGYPAYTTSCAWLGYSDEQLKKLCSDALKEGWTRFKVKVGADLKDDIRRCELIRGMIGPDNIMMLDANQRWDVQEAISWVKDLAKYKPLWIEEPTSPDDILGHATISKVVFVITILIL---RCHNRVMFKQFLQANALQYLQIDSCRLGSVNENLSVLLMSKKFNVPVCPHAGGVGLCELVQHLILFDYISVSGSLDNRMCEYVDHLHEHFMYPVIISRAAYMPPKDPGYSTEMKDESVLQYQFPDGEIWQKLILEKK 427          
BLAST of Mitochondrial enolase superfamily member 1 vs. UniProt/SwissProt
Match: sp|Q2KIA9|ENOF1_BOVIN (Mitochondrial enolase superfamily member 1 OS=Bos taurus OX=9913 GN=ENOSF1 PE=2 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 235/432 (54.40%), Postives = 317/432 (73.38%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            +  + +HD+RFPT L  HGSDAMHTDP YSAAY++L+T+ E  + GYG +FT+GRG EVV+  + AL   + NK L EIV +F  F+  L ++ QLRW+GPEKGV+HLA AAV+NA+WDLW++ E KPLWKL+VDM P  L+S +DF YI D LT+EEA EIL++++  KK+ E +++  G+P+Y TS  WLGY D T++++C EAL  G+  FK+KVG DL+ D RR ++ R++IG ++ LM+DANQ W VPE++ WM +LA +KP WIEEPTS DDILGH  I+ AL P  I VATGE CHNR++FKQ L++  +   QIDSCRL   NE + VLLMA K  +PVCPHAGGVGLCELVQH    D+I +S S + RM EY DHLHEH++ PV++R   Y  PK  G++ +  E+++K + YP+G++W+KL
Sbjct:    6 VSRLSVHDVRFPTSLGGHGSDAMHTDPDYSAAYVVLETDAEDGLKGYGITFTLGRGTEVVVCAVNALAPHVLNKDLGEIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPLWKLLVDMDPRTLVSCIDFRYITDVLTEEEACEILRQSQVGKKEREEQMLAHGYPAYTTSCAWLGYPDATLKQLCSEALKDGWTRFKVKVGADLQDDIRRCRLVRNMIGPEKTLMMDANQRWDVPEAVEWMTKLAEFKPLWIEEPTSPDDILGHAAISKALAPLGIGVATGEQCHNRVIFKQLLQAKALKFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDFISVSASLQDRMCEYVDHLHEHFKYPVLIREAAYMPPKDAGYSTEMKEDSVKRHRYPDGEVWKKL 437          
BLAST of Mitochondrial enolase superfamily member 1 vs. UniProt/SwissProt
Match: sp|Q5RAT4|ENOF1_PONAB (Mitochondrial enolase superfamily member 1 OS=Pongo abelii OX=9601 GN=ENOSF1 PE=2 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 0.000e+0
Identity = 233/429 (54.31%), Postives = 316/429 (73.66%), Query Frame = 3
Query:   87 IVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            + + D+RFPT L  HGSDAMHTDP YSAAY++++T+ E  I G G +FT+G+G EVV+  + AL   + NK L +IV +F  F+  L ++ Q RW+GPEKGV+HLA AAV+NA+WDLW++ E KP+WKL+VDM P  L+S +DF YI D LT+E+ALEIL+K +  KK+ E +++  G+P+Y TS  WLGY D T++++C +AL  G+  FK+KVG DL+ D RR Q+ RD+IG ++ LM+DANQ W VPE++ WM +LA +KP WIEEPTS DDILGH  I+ AL P  I +ATGE CHNR++FKQ L++  +   QIDSCRL   NE + VLLMA K  +PVCPHAGGVGLCELVQH    DYI +S S E RM EY DHLHEH++ PV+++  +Y  PK PG++ +  EE++K ++YP+G++W+KL
Sbjct:    9 LSVRDVRFPTSLGGHGSDAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQPRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVDMDPRTLVSCIDFRYITDVLTEEDALEILQKGQVGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDVRRCQIIRDMIGLEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDYISVSASLENRMCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKL 437          
BLAST of Mitochondrial enolase superfamily member 1 vs. UniProt/SwissProt
Match: sp|Q7L5Y1|ENOF1_HUMAN (Mitochondrial enolase superfamily member 1 OS=Homo sapiens OX=9606 GN=ENOSF1 PE=1 SV=1)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 232/432 (53.70%), Postives = 318/432 (73.61%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            +  + + D+RFPT L  HG+DAMHTDP YSAAY++++T+ E  I G G +FT+G+G EVV+  + AL   + NK L +IV +F  F+  L ++ QLRW+GPEKGV+HLA AAV+NA+WDLW++ E KP+WKL+VDM P  L+S +DF YI D LT+E+ALEIL+K +  KK+ E +++  G+P+Y TS  WLGY D T++++C +AL  G+  FK+KVG DL+ D RR Q+ RD+IG ++ LM+DANQ W VPE++ WM +LA +KP WIEEPTS DDILGH  I+ AL P  I +ATGE CHNR++FKQ L++  +   QIDSCRL   NE + VLLMA K  +PVCPHAGGVGLCELVQH    DYI +S S E R+ EY DHLHEH++ PV+++  +Y  PK PG++ +  EE++K ++YP+G++W+KL
Sbjct:    6 ISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKL 437          
BLAST of Mitochondrial enolase superfamily member 1 vs. UniProt/SwissProt
Match: sp|Q6INX4|ENOF1_XENLA (Mitochondrial enolase superfamily member 1 OS=Xenopus laevis OX=8355 GN=enosf1 PE=2 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 2.404e-179
Identity = 232/432 (53.70%), Postives = 311/432 (71.99%), Query Frame = 3
Query:   93 LHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQE--ISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            + D+RFPT L++HGSDAMHTDP YSAAY++++T+    + G+G +FT+G+G EVV+  + AL   +  K+L +IV NF  F+  L ++ QLRW+GPEKG + LA AAV+NA+WDLW++ E KPLWKL+VDM P  L+S +DF YI D LT+EEAL+IL+  +  ++  E  ++  G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ RD+IG D ++M+DANQ W V E+I W+K+LA YKP WIEEPTS DDILGH  I+  L P  I VATGE CHNR+MFKQFL++  +   QIDSCRL   NE + VLLMA K  VPVCPHAGGVGLCELVQH    DYI +SGS + RM EY DHLHEH+  PVI+    Y  PK PG++ +  EE++  Y++P+G +W+KL  E K
Sbjct:   11 ITDVRFPTSLDQHGSDAMHTDPDYSAAYVVIETDAADGLKGHGLTFTLGKGTEVVVCAVRALSRHVIGKALEDIVNNFRDFYRQLTSDGQLRWIGPEKGAVQLATAAVLNAVWDLWAKKEKKPLWKLLVDMDPHQLVSCIDFRYITDALTEEEALKILQNGKQGQRDREEHMLTSGYPAYTTSCAWLGYSDEQLKKLCSDALKEGWTRFKVKVGADLKDDIRRCELIRDMIGPDNIMMLDANQRWDVQEAISWVKDLAKYKPLWIEEPTSPDDILGHATISKELSPVNIGVATGEQCHNRVMFKQFLQAKALQYLQIDSCRLGSVNENLSVLLMAKKFNVPVCPHAGGVGLCELVQHLILFDYICVSGSLDNRMCEYVDHLHEHFTYPVIINRAAYMPPKDPGYSTEMKEESVLQYQFPDGAVWKKLILEKK 442          
BLAST of Mitochondrial enolase superfamily member 1 vs. UniProt/SwissProt
Match: sp|Q0QWS4|LGD1_HYPJE (L-galactonate dehydratase OS=Hypocrea jecorina OX=51453 GN=lgd1 PE=1 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 6.900e-165
Identity = 216/431 (50.12%), Postives = 308/431 (71.46%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEY-KKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDR--LLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPN 1346
            M  + +      D+RFPT L++ GSDAM+    YSAAY IL+T+   SG+G +FTIGRGN++V   I  +   +K K L  +V ++   W  LVN+SQLRW+GPEKGVIHLA+ AV+NA+WDLW++  NKP+W+++ DMTPE  +  +DF YI D +T EEA+ +L++ E  K K++E  +     P+Y TSAGWLGY +  ++++ +E L  G++ FK+KVG  +E D+RR+ + R+I+G+D+  +LMVDANQ+WSVPE+I +MK+L+ YKP++IEEPTS DDI+GH  I +ALKP+ I VATGE C NR+MFKQ + +G +++CQID+CRL G NEV+ VLLMA K GVP+ PH+GGVGL E  QH S IDY+++SG     +LE+ DHLHEH+  P ++++G YQ P   G++ +   E++  YEYP 
Sbjct:    1 MSEVTITGFRSRDVRFPTSLDKTGSDAMNAAGDYSAAYCILETDSAHSGHGMTFTIGRGNDIVCAAINHVADRLKGKKLSSLVADWGKTWRYLVNDSQLRWIGPEKGVIHLALGAVVNAVWDLWAKTLNKPVWRIVADMTPEEYVRCIDFRYITDAITPEEAVAMLREQEAGKAKRIEEALQNRAVPAYTTSAGWLGYGEDKMKQLLRETLAAGYRHFKVKVGGSVEEDRRRLGIAREILGFDKGNVLMVDANQVWSVPEAIDYMKQLSEYKPWFIEEPTSPDDIMGHKAIRDALKPYGIGVATGEMCQNRVMFKQLIMTGAIDICQIDACRLGGVNEVLAVLLMAKKYGVPIVPHSGGVGLPEYTQHLSTIDYVVVSGKLS--VLEFVDHLHEHFLHPSVIKDGYYQTPTEAGYSVEMKPESMDKYEYPG 429          
BLAST of Mitochondrial enolase superfamily member 1 vs. TrEMBL
Match: A0A087UYV6 (Mitochondrial enolase superfamily member 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_16761 PE=4 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 254/430 (59.07%), Postives = 326/430 (75.81%), Query Frame = 3
Query:   93 LHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            + D+RFPT L   GSDAMH DP YS AY+IL T+    GYG +FTIG+G EVV+  ++AL+ L+  ++LM I  NFA+FW  L ++SQLRW+GPEKGVIHLA AAVINA+WDLW+R ENKPLWKL+ DM PE L++ +DF YI D +TKEEALE+L+KNE  KK+ E  ++ DG+P+Y TS GWLGY D  I+++C+E L  GF +FK KVGQ +ESDKRR+ + R+ IG D  LMVDANQ W V E++ WMKEL  Y   WIEEPTS DDILGH  I+ AL+P+ I +ATGE CHNR+MFKQ +++G +  CQIDSCRL G NE++ V LMAAK GVPVCPHAGGVGLCELVQH +  D+I +S S ++RM EY +HLHEH+E PV+++NG+Y +P  PG+++K  E++I  YE+PNG +W KL  E K
Sbjct:   10 VKDVRFPTSLTSDGSDAMHVDPDYSCAYVILSTSDGWKGYGLTFTIGKGTEVVVTAVKALKQLVIGRNLMSIYNNFANFWRELTSDSQLRWIGPEKGVIHLATAAVINALWDLWARRENKPLWKLLTDMEPEKLVNTIDFRYITDAITKEEALEMLRKNEKSKKEREALLLSDGYPAYCTSVGWLGYSDDKIKKLCREKLKEGFTAFKAKVGQSIESDKRRLALIREEIGKDNTLMVDANQKWDVSEAVSWMKELVDYNLLWIEEPTSPDDILGHAAISKALQPYGIGIATGEQCHNRVMFKQMIQAGSLQFCQIDSCRLGGVNEILSVYLMAAKYGVPVCPHAGGVGLCELVQHLAAWDFISLSASLDKRMTEYVEHLHEHFETPVVIKNGHYMLPDTPGYSSKMKEDSITNYEFPNGKVWLKLFEEGK 439          
BLAST of Mitochondrial enolase superfamily member 1 vs. TrEMBL
Match: A0A4Y2BNB7 (Mitochondrial enolase superfamily member 1 OS=Araneus ventricosus OX=182803 GN=ENOSF1 PE=4 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 255/435 (58.62%), Postives = 327/435 (75.17%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            ME  I++ + + D+RFPT L   GSDAMHTDP YS AY+ L ++    GYG +FTIG+G E+V+  ++AL  L+  K +  I  +FA FW  L + SQLRW+GPEKGVIHLA AAV+NA+WDLW+R E KPLWKL+VDMTPE L+S +DF Y+ D +TKEEA+++LKK E  KK+ E +++ +G+P+Y TS GW+GY D+ I+E+CK+ L  GF +FK KVGQ+LE DKRR+ + RD IG D LLMVDANQIW V E+I WMKEL  +   WIEEPTS DDILGH  I+ ALKP  I VATGE C NR+MFKQFL++G +  CQIDSCRL G NE++ V LMAAK GVPVCPHAGGVGLCELVQH +  D+I +SGS E+R++EY +HLHEH+E PVI+R G Y IP   G++ K  E+TI  Y+YP+G+IW+ +
Sbjct:    1 MEAKIIR-LDVKDVRFPTSLTGDGSDAMHTDPDYSCAYVTLTSSDGTYGYGLTFTIGKGTEIVVAAVKALAPLVVGKVVQSIFDDFAKFWRDLTSHSQLRWIGPEKGVIHLATAAVVNALWDLWARTEGKPLWKLLVDMTPEQLVSTIDFRYLTDVITKEEAIDLLKKKEAGKKEREAKLLHEGYPAYCTSVGWIGYSDEKIKELCKQKLKEGFTAFKAKVGQNLEDDKRRLSIIRDEIGNDSLLMVDANQIWDVNEAISWMKELTDFNLLWIEEPTSPDDILGHAVISKALKPHGIGVATGEQCQNRVMFKQFLQAGALQFCQIDSCRLGGVNEILSVYLMAAKFGVPVCPHAGGVGLCELVQHLAAWDFISVSGSLEKRLVEYVEHLHEHFENPVIVRKGRYTIPLRLGYSTKMKEKTISDYQYPDGNIWKTI 434          
BLAST of Mitochondrial enolase superfamily member 1 vs. TrEMBL
Match: A0A482XLK4 (MR_MLE domain-containing protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR002899 PE=4 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 245/433 (56.58%), Postives = 325/433 (75.06%), Query Frame = 3
Query:   72 IILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILK-TNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            +++ S+ + DIRFPT LE HGSDAMH DP YS AY+I+   N ++ GYG +FT+GRG EVV + + +L +L   KSL +I  +FA FW  + +ESQLRW+GPEKGVIHLA AA++NA+WDLW+R+ENKPLWKL+ D+ P+ ++S +DF YI D +TKEEA+ IL+K++  KK+ E E+   G+P+Y T  GWLGY+ + +RE+CK  +D GF++FK+KVG DL+SD+ R +M R+IIG++ +LM DANQ+W V E+I WMK LA +KPYWIEEPTS DD+LGH  IA  L  F IKVATGE C NRIMFKQF++   ++ CQIDSCRL G NE++ V  MA K  VPVCPHAGGVGLCE+VQH    DYI +SG+ + R +EY D  HEH+E+ ++MRN +Y  P  PG++ KF E TI  YEYPNG++WRK+
Sbjct:    6 LVITSLDVKDIRFPTSLEAHGSDAMHGDPDYSCAYVIINLENSDLKGYGLTFTLGRGTEVVTRAVHSLSYLAVGKSLNDIYNDFAGFWRVITSESQLRWIGPEKGVIHLATAAIMNALWDLWARLENKPLWKLLTDLPPDKIVSTVDFRYISDVVTKEEAIRILEKSQKMKKEREEEMRIAGYPAYTTQPGWLGYKPEKVRELCKAYMDKGFRAFKIKVGSDLDSDRERCKMVRNIIGWENILMTDANQVWDVEEAIEWMKNLAEFKPYWIEEPTSPDDVLGHKRIAEGLAEFGIKVATGEMCSNRIMFKQFMQINALHFCQIDSCRLGGVNEILAVYFMAKKLNVPVCPHAGGVGLCEMVQHLQIFDYICLSGTKKDRYIEYVDQEHEHFEDTIVMRNAHYVAPTMPGYSTKFKESTIHDYEYPNGNVWRKI 438          
BLAST of Mitochondrial enolase superfamily member 1 vs. TrEMBL
Match: A0A1S3HDV3 (mitochondrial enolase superfamily member 1 OS=Lingula unguis OX=7574 GN=LOC106154438 PE=4 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 249/436 (57.11%), Postives = 322/436 (73.85%), Query Frame = 3
Query:   69 TIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHE 1376
             + +  I   DIRFPT LE  GSDA+HTDP YS AYI L T+ E  G+G +FTIGRG E+V +   AL   +  K L EI  +FA FW +L N+SQLRWLGPEKGV+HLA  A++NA+WDLW+++E KPLWKL+ DMTPE L+S++DF YI D LT+EEALEILKK +  KK+ E E+I  G+P+Y+TSAGW GY+++  R+ CKEAL  GF  FK KVG  +E+D+RR+ + R+ IGYD+LLM DANQ W V E+I WMK+L  +KP WIEEPTS DD+LGH  IA ALKP+ I VATGEHC NR++FKQ  ++  +  CQID CRL G NEV+ VLLMAAK  VPVCPHAGGVGLC++ QH+S+ DYI +S + E R LEY++HLHE+Y+ PV ++ G+Y +P+ PGF  +  E ++  +EYP G +W+KL  E
Sbjct:    2 AVKITGITARDIRFPTSLEGDGSDAIHTDPDYSCAYITLTTSTEAKGFGHTFTIGRGTEIVCEAAHALGEFVVGKHLQEITADFAGFWRALANDSQLRWLGPEKGVVHLATCAIVNAVWDLWAKVERKPLWKLLADMTPEELVSVIDFRYISDLLTREEALEILKKGQDGKKEREAELISKGYPAYITSAGWSGYDEQKTRQKCKEALAKGFVRFKAKVGTGIEADRRRLAVMREEIGYDKLLMTDANQRWDVSEAIDWMKQLTEFKPLWIEEPTSPDDVLGHATIAKALKPYNIAVATGEHCQNRVVFKQLFQADSIAYCQIDGCRLGGVNEVLAVLLMAAKLNVPVCPHAGGVGLCQVNQHFSYFDYICVSRTLENRFLEYAEHLHENYKFPVEVKGGHYVLPQIPGFQTEMREASLDTHEYPIGPVWQKLFAE 437          
BLAST of Mitochondrial enolase superfamily member 1 vs. TrEMBL
Match: A0A1S3J1U9 (mitochondrial enolase superfamily member 1-like OS=Lingula unguis OX=7574 GN=LOC106169480 PE=4 SV=1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 248/436 (56.88%), Postives = 322/436 (73.85%), Query Frame = 3
Query:   69 TIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHE 1376
             + +  I   DIRFPT LE  GSDA+HTDP YS AYI L T+ E  G+G +FTIGRG E+V +   AL   +  K L EI  +FA FW +L N+SQLRWLGPEKGV+HLA  A++NA+WDLW+++E KPLWKL+ DMTPE L+S++DF YI D LT+EEALEILKK +  KK+ E E+I  G+P+Y+TSAGW GY+++  R+ CKEAL  GF  FK KVG  +E+D+RR+ + R+ IGYD+LLM DANQ W V E+I WMK+L  +KP WIEEPTS DD+LGH  IA ALKP+ I VATGEHC NR++FKQ  ++  +  CQID CRL G NEV+ VLLMAAK  VPVCPHAGGVGLC++ QH+S+ DYI +S + E R LEY++HLHE+Y+ P+ ++ G+Y +P+ PGF  +  E ++  +EYP G +W+KL  E
Sbjct:    2 AVKITGITARDIRFPTSLEGDGSDAIHTDPDYSCAYITLTTSTEAKGFGHTFTIGRGTEIVCEAALALGEFVVGKHLQEITADFAGFWRALANDSQLRWLGPEKGVVHLATCAIVNAVWDLWAKVERKPLWKLLADMTPEELVSVIDFRYISDLLTREEALEILKKGQDGKKEREAELISKGYPAYITSAGWSGYDEQKTRQKCKEALAKGFVRFKAKVGTGIEADRRRLAVMREEIGYDKLLMTDANQRWDVSEAIDWMKQLTEFKPLWIEEPTSPDDVLGHATIAKALKPYNIAVATGEHCQNRVVFKQLFQADSIAYCQIDGCRLGGVNEVLAVLLMAAKLNVPVCPHAGGVGLCQVNQHFSYFDYICVSRTLENRFLEYAEHLHENYKFPIEVKGGHYVLPQIPGFQTEMREASLDTHEYPTGPVWQKLFAE 437          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Cavefish
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:103027104])

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 230/430 (53.49%), Postives = 315/430 (73.26%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            +  + + D+RFPT LE+HGSDAMHTDP YS  Y++++T+  + GYG +FTIGRG E+V+  +EAL  L+  KSL +IV +F SF+  L ++ Q+RW+GPEKGVI LA AA++NAIWD+W+R E KPLWKL+VDM P  LI  +DF Y+ D LT++EALEIL+K +  K+Q E +++K+G+P+Y TS  WLGY D+ + E+C  AL  G+  FK+KVG DL+ D RR  + R +IG ++ LM+DANQ W V E+I W+ +LA ++P WIEEPT  DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++  +   QIDSCR+   NE +  +LMAAK  VPVCPHAGGVGLCELV H S  DYI +S S + RM EY DHLHEH++ P ++RN +Y  PK PG++ +  EE++K +++P+G++W+ +
Sbjct:    6 ITKLSVSDVRFPTSLEQHGSDAMHTDPDYSVVYVVIETDGGLKGYGITFTIGRGTEIVVCAVEALSALVIGKSLEDIVSDFRSFYRLLTSDGQMRWIGPEKGVIQLATAAILNAIWDMWARAEGKPLWKLLVDMEPRQLIRCIDFRYLSDALTEQEALEILEKAKEGKQQREEQMLKEGYPAYTTSCAWLGYSDEQLTELCSAALAEGWTKFKVKVGADLQDDIRRCSLIRKMIGPEKTLMIDANQRWDVAEAITWVTKLAEFRPLWIEEPTCPDDILGHAAISKALAPLGIGVATGEQCHNRVMFKQFLQASALQFVQIDSCRVGSVNENLATILMAAKFKVPVCPHAGGVGLCELVHHLSIFDYISVSASLDNRMCEYVDHLHEHFKSPTLIRNAHYMPPKDPGYSTEMFEESVKKHQFPDGEVWKSI 435          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Cavefish
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:103027104])

HSP 1 Score: 507.679 bits (1306), Expect = 1.841e-178
Identity = 224/430 (52.09%), Postives = 306/430 (71.16%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKL 1367
            +  + + D+RFPT LE+HGSDAMHTDP YS  Y++++T+  + GYG +FTIGRG E+V+  +EAL  L+  KSL +IV +F SF+  L ++ Q+RW+GPEKGVI LA AA++NAIWD+W+R E KPLWKL+VDM P  LI  +DF Y+ D LT++EALE              +++K+G+P+Y TS  WLGY D+ + E+C  AL  G+  FK+KVG DL+ D RR  + R +IG ++ LM+DANQ W V E+I W+ +LA ++P WIEEPT  DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++  +   QIDSCR+   NE +  +LMAAK  VPVCPHAGGVGLCELV H S  DYI +S S + RM EY DHLHEH++ P ++RN +Y  PK PG++ +  EE++K +++P+G++W+ +
Sbjct:    6 ITKLSVSDVRFPTSLEQHGSDAMHTDPDYSVVYVVIETDGGLKGYGITFTIGRGTEIVVCAVEALSALVIGKSLEDIVSDFRSFYRLLTSDGQMRWIGPEKGVIQLATAAILNAIWDMWARAEGKPLWKLLVDMEPRQLIRCIDFRYLSDALTEQEALE-------------EQMLKEGYPAYTTSCAWLGYSDEQLTELCSAALAEGWTKFKVKVGADLQDDIRRCSLIRKMIGPEKTLMIDANQRWDVAEAITWVTKLAEFRPLWIEEPTCPDDILGHAAISKALAPLGIGVATGEQCHNRVMFKQFLQASALQFVQIDSCRVGSVNENLATILMAAKFKVPVCPHAGGVGLCELVHHLSIFDYISVSASLDNRMCEYVDHLHEHFKSPTLIRNAHYMPPKDPGYSTEMFEESVKKHQFPDGEVWKSI 422          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Sea Lamprey
Match: enosf1 (enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-060929-780])

HSP 1 Score: 246.514 bits (628), Expect = 4.664e-80
Identity = 111/202 (54.95%), Postives = 142/202 (70.30%), Query Frame = 3
Query:  600 IIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQR 1205
            +++ GFP+Y TS  WLGY D  +R+ C EAL  G+  FK+KVG  LE D+RR  + RD+IG DR LM+DANQ W V E++ W ++LA + P WIEEPTS DD+LGH  I+ AL    I VATGE C NR++FKQ L++  +  CQ+D+CRL G  E++ VLLMA K  VPVCPHAGGVGLCEL QH S  D++ +S S E R
Sbjct:    1 LMESGFPAYTTSCAWLGYPDAELRQRCTEALQDGWTRFKVKVGSSLEDDERRCHIIRDVIGPDRTLMLDANQRWDVLEAVEWTQKLARFWPLWIEEPTSPDDVLGHKYISQALSALGIGVATGEQCQNRVVFKQLLQAKALQFCQVDTCRLGGIPEILAVLLMACKFQVPVCPHAGGVGLCELAQHISMFDFLSVSTSLENR 202          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Nematostella
Match: EDO49916 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF96])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 243/437 (55.61%), Postives = 323/437 (73.91%), Query Frame = 3
Query:   78 LQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEIS--GYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            +  +   DIRFPT LE HGSDA+H +P YSA Y+ +KT+      GYG +FTIGRGNE+V+   +A   ++   S+ +I  +F S W  L +E QLRWLGPEKGVIHLA+AA+INA+WDLW+RIE KP+W+L+ DM+PE L+S +DF+Y+ D LTKEEALEILKKN   K++   ++  +G+P+Y TSAGWLGY DK I ++C + L  G+  FKMKVG DL+ D+RR  + R  IG DR L +D+NQ W VPE+I +MK LA +KP WIEEPTS DD+LGH  I+ AL P+ I VATGEHC NR++FKQF+++ G   CQIDSCR+ G NE+I +LLMAAK GVPVCPHAGGVGLCE VQH S  DYI +S S E R+ E++DHLHEH+  PV+  NG+Y++P APG++A+   ++++ YE+P+G +WR+L  E +
Sbjct:    3 ITEVTARDIRFPTSLELHGSDAVHKNPDYSAMYVTIKTDSPGGREGYGLTFTIGRGNEIVMGAAQAYGKMLVGMSVEDIFNDFGSIWRQLAHEEQLRWLGPEKGVIHLALAAIINALWDLWARIEEKPVWRLLSDMSPEKLVSTVDFSYLSDALTKEEALEILKKNAPTKEERIKKLFLEGYPAYTTSAGWLGYTDKQIEDLCNKYLSAGWTRFKMKVGNDLDDDRRRAAIIRKTIGPDRFLAMDSNQRWDVPEAIEYMKGLAEFKPVWIEEPTSPDDVLGHAAISKALAPYGISVATGEHCQNRVIFKQFMQAQGFQYCQIDSCRVGGLNEIIAILLMAAKFGVPVCPHAGGVGLCEYVQHISMFDYICVSASLENRVTEFADHLHEHFVHPVVATNGSYKVPMAPGYSAEMKSQSLEEYEFPDGAVWRRLISEGR 439          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Medaka
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:101157819])

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 238/425 (56.00%), Postives = 317/425 (74.59%), Query Frame = 3
Query:   87 IVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWR 1361
            + + D+RFPT LE+HGSDAMHTDP YSAAY++L+T+  + G+G +FT+G+G E+V+  ++A+  L+  KSL EIV++F  F+  L ++ Q+RWLGPEKGVIHLA AA++NA+WDLW+R+E KPLWKL+VDM+PE L+S +DF YI D LT+EEALE+L K +  K+Q E E++++G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ R +IG D  LM+DANQ W V E+I W+  LA  KP WIEEPTS DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++G +   QIDSCRL   NE + VLLMA K  VPVCPHAGGVGLCELVQH    DYI +S S   RM EY DHLHEH+  PV++ N  Y  PK PG++ + +E ++K ++YP+GD W+
Sbjct:    8 VSVRDVRFPTSLEQHGSDAMHTDPDYSAAYVVLETDGGLRGFGLTFTLGKGTEIVVCAVQAMTGLVVGKSLEEIVRDFRGFYRLLTSDGQMRWLGPEKGVIHLATAALLNAVWDLWARMEGKPLWKLLVDMSPERLVSCIDFRYITDVLTEEEALELLVKAQEGKRQREEEMLREGYPAYTTSCAWLGYSDQQLKQLCTDALKGGWTKFKVKVGADLDDDVRRCRLIRQMIGPDNTLMIDANQRWDVSEAISWVSNLAEVKPLWIEEPTSPDDILGHAAISKALAPLGIGVATGEQCHNRVMFKQFLQAGALQFVQIDSCRLGSVNENLAVLLMAHKFRVPVCPHAGGVGLCELVQHLILFDYICVSASLSNRMCEYVDHLHEHFVCPVVIHNARYMPPKIPGYSCEMLESSVKKHQYPDGDAWK 432          
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Medaka
Match: enosf1 (enolase superfamily member 1 [Source:NCBI gene;Acc:101157819])

HSP 1 Score: 487.263 bits (1253), Expect = 3.424e-170
Identity = 226/409 (55.26%), Postives = 301/409 (73.59%), Query Frame = 3
Query:  135 SDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWR 1361
            S   HTDP YSAAY++L+T+  + G+G +FT+G+G E+V+  ++A+  L+  KSL EIV++F  F+  L ++ Q+RWLGPEKGVIHLA AA++NA+WDLW+R+E KPLWKL+VDM+PE L+S +DF YI D LT+EEALE+L K +  K+Q E E++++G+P+Y TS  WLGY D+ ++++C +AL  G+  FK+KVG DL+ D RR ++ R +IG D  LM+DANQ W V E+I W+  LA  KP WIEEPTS DDILGH  I+ AL P  I VATGE CHNR+MFKQFL++G +   QIDSCRL   NE + VLLMA K  VPVCPHAGGVGLCELVQH    DYI +S S   RM EY DHLHEH+  PV++ N  Y  PK PG++ + +E ++K ++YP+GD W+
Sbjct:   31 SAPQHTDPDYSAAYVVLETDGGLRGFGLTFTLGKGTEIVVCAVQAMTGLVVGKSLEEIVRDFRGFYRLLTSDGQMRWLGPEKGVIHLATAALLNAVWDLWARMEGKPLWKLLVDMSPERLVSCIDFRYITDVLTEEEALELLVKAQEGKRQREEEMLREGYPAYTTSCAWLGYSDQQLKQLCTDALKGGWTKFKVKVGADLDDDVRRCRLIRQMIGPDNTLMIDANQRWDVSEAISWVSNLAEVKPLWIEEPTSPDDILGHAAISKALAPLGIGVATGEQCHNRVMFKQFLQAGALQFVQIDSCRLGSVNENLAVLLMAHKFRVPVCPHAGGVGLCELVQHLILFDYICVSASLSNRMCEYVDHLHEHFVCPVVIHNARYMPPKIPGYSCEMLESSVKKHQYPDGDAWK 439          
BLAST of Mitochondrial enolase superfamily member 1 vs. Planmine SMEST
Match: SMESG000069768.1 (SMESG000069768.1)

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 439/440 (99.77%), Postives = 439/440 (99.77%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTI EICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK
Sbjct:    1 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTISEICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 440          
BLAST of Mitochondrial enolase superfamily member 1 vs. Planmine SMEST
Match: SMESG000069768.1 (SMESG000069768.1)

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 421/440 (95.68%), Postives = 421/440 (95.68%), Query Frame = 3
Query:   63 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVATGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 1382
            METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTI EICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQI                  KSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK
Sbjct:    1 METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGYGFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLRWLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDFTYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDKTISEICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDANQIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQI------------------KSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPVCPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMRNGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK 422          
The following BLAST results are available for this feature:
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENOSF10.000e+053.70enolase superfamily member 1 [Source:HGNC Symbol;A... [more]
ENOSF17.560e-16752.54enolase superfamily member 1 [Source:HGNC Symbol;A... [more]
ENOSF19.066e-14755.29enolase superfamily member 1 [Source:HGNC Symbol;A... [more]
ENOSF12.143e-10554.05enolase superfamily member 1 [Source:HGNC Symbol;A... [more]
ENOSF13.230e-4953.68enolase superfamily member 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
enosf10.000e+053.06enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-... [more]
enosf15.638e-17751.25enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-... [more]
enosf13.045e-12252.60enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-... [more]
enosf13.470e-8052.68enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enosf10.000e+053.17enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
enosf11.148e-17151.36enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
enosf11.788e-16553.01enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
enosf11.823e-15948.99enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
enosf12.152e-15047.19enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KIA9|ENOF1_BOVIN0.000e+054.40Mitochondrial enolase superfamily member 1 OS=Bos ... [more]
sp|Q5RAT4|ENOF1_PONAB0.000e+054.31Mitochondrial enolase superfamily member 1 OS=Pong... [more]
sp|Q7L5Y1|ENOF1_HUMAN0.000e+053.70Mitochondrial enolase superfamily member 1 OS=Homo... [more]
sp|Q6INX4|ENOF1_XENLA2.404e-17953.70Mitochondrial enolase superfamily member 1 OS=Xeno... [more]
sp|Q0QWS4|LGD1_HYPJE6.900e-16550.12L-galactonate dehydratase OS=Hypocrea jecorina OX=... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087UYV60.000e+059.07Mitochondrial enolase superfamily member 1 (Fragme... [more]
A0A4Y2BNB70.000e+058.62Mitochondrial enolase superfamily member 1 OS=Aran... [more]
A0A482XLK40.000e+056.58MR_MLE domain-containing protein OS=Laodelphax str... [more]
A0A1S3HDV30.000e+057.11mitochondrial enolase superfamily member 1 OS=Ling... [more]
A0A1S3J1U90.000e+056.88mitochondrial enolase superfamily member 1-like OS... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
enosf10.000e+053.49enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
enosf11.841e-17852.09enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
enosf14.664e-8054.95enolase superfamily member 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO499160.000e+055.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
enosf10.000e+056.00enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
enosf13.424e-17055.26enolase superfamily member 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Mitochondrial enolase superfamily member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000069768.10.000e+099.77SMESG000069768.1[more]
SMESG000069768.10.000e+095.68SMESG000069768.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033140 ID=SMED30033140|Name=Mitochondrial enolase superfamily member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1438bp
TCTCTGACCTTTGGAAAGTCGGTTTATTTTCATAAATTCTCAGATTTTAC
AAGTTCAAAAAAATGGAAACAATTATTTTACAGTCCATTGTACTCCATGA
TATTAGATTTCCGACTCATCTCGAGAGGCATGGGTCGGATGCTATGCATA
CAGATCCGTCTTACAGCGCAGCCTATATCATTTTGAAAACAAACCAAGAA
ATCTCAGGTTACGGGTTTTCGTTTACCATTGGCAGAGGAAATGAAGTTGT
ATTAAAATGTATTGAAGCTTTGGAATTCTTGATTAAAAATAAAAGTTTGA
TGGAAATTGTTCAAAATTTTGCAAGCTTTTGGCATTCTCTGGTCAATGAA
AGTCAATTACGATGGCTGGGTCCAGAAAAGGGAGTTATTCACTTAGCTGT
TGCTGCAGTCATAAATGCAATTTGGGATTTGTGGAGTCGAATTGAAAATA
AACCACTATGGAAACTAATTGTTGATATGACTCCAGAAAACCTCATTTCC
ATGTTGGATTTTACTTATATTGAAGATTTCCTAACCAAAGAAGAAGCATT
AGAAATCTTGAAGAAAAACGAATATAAAAAGAAACAATTAGAAAATGAAA
TTATAAAAGATGGATTTCCATCATATGTGACATCTGCGGGGTGGCTGGGG
TACGAAGACAAAACGATAAGAGAAATTTGTAAAGAAGCTTTGGATATCGG
GTTTAAAAGTTTTAAAATGAAAGTAGGGCAGGATTTGGAGTCAGATAAAA
GAAGAATGCAAATGTTCCGGGACATTATTGGATATGATCGGTTATTGATG
GTAGATGCTAATCAAATTTGGTCTGTGCCAGAATCAATCAGATGGATGAA
AGAGCTGGCCGTATATAAACCATATTGGATAGAGGAACCAACTAGTTGTG
ATGATATACTCGGTCATATGGAAATCGCAAATGCATTAAAACCCTTTCAG
ATTAAGGTAGCCACGGGTGAACATTGTCACAACAGAATTATGTTTAAACA
ATTCCTAAAGTCGGGTGGCATGAACGTCTGCCAAATTGACAGTTGTCGAC
TTGCGGGTCCGAATGAGGTGATCTTAGTTTTACTGATGGCAGCCAAAGCT
GGAGTACCGGTTTGTCCACACGCAGGAGGTGTTGGACTATGTGAGTTGGT
ACAGCACTACTCCTTTATTGACTATATCCTTATCAGTGGGTCAACAGAAC
AAAGAATGTTGGAATATTCAGATCATCTTCATGAGCATTATGAGGAGCCA
GTGATAATGAGAAATGGCAACTATCAAATACCAAAGGCTCCAGGATTCAA
TGCTAAATTCATTGAGGAAACAATTAAAGGTTATGAATATCCAAACGGAG
ATATTTGGCGGAAATTGCGCCATGAAACAAAATAAATACATTTTTAGTGT
AGTTTGACAAATTAGCAATGATTGTGTTTGAATAAATT
back to top

protein sequence of SMED30033140-orf-1

>SMED30033140-orf-1 ID=SMED30033140-orf-1|Name=SMED30033140-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=441bp
METIILQSIVLHDIRFPTHLERHGSDAMHTDPSYSAAYIILKTNQEISGY
GFSFTIGRGNEVVLKCIEALEFLIKNKSLMEIVQNFASFWHSLVNESQLR
WLGPEKGVIHLAVAAVINAIWDLWSRIENKPLWKLIVDMTPENLISMLDF
TYIEDFLTKEEALEILKKNEYKKKQLENEIIKDGFPSYVTSAGWLGYEDK
TIREICKEALDIGFKSFKMKVGQDLESDKRRMQMFRDIIGYDRLLMVDAN
QIWSVPESIRWMKELAVYKPYWIEEPTSCDDILGHMEIANALKPFQIKVA
TGEHCHNRIMFKQFLKSGGMNVCQIDSCRLAGPNEVILVLLMAAKAGVPV
CPHAGGVGLCELVQHYSFIDYILISGSTEQRMLEYSDHLHEHYEEPVIMR
NGNYQIPKAPGFNAKFIEETIKGYEYPNGDIWRKLRHETK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016052carbohydrate catabolic process
GO:0009063cellular amino acid catabolic process
Vocabulary: molecular function
TermDefinition
GO:0050023L-fuconate dehydratase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036849Enolase-like_C_sf
IPR034610L-fuconate_dehydratase
IPR013342Mandelate_racemase_C
IPR029065Enolase_C-like
IPR029017Enolase-like_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 159..179
NoneNo IPR availableSFLDSFLDG00179mandelate_racemasecoord: 6..434
e-value: 0.0
score: 652.5
NoneNo IPR availablePANTHERPTHR13794ENOLASE SUPERFAMILY, MANDELATE RACEMASEcoord: 2..439
IPR013342Mandelate racemase/muconate lactonizing enzyme, C-terminalSMARTSM00922MR_MLE_2coord: 199..294
e-value: 5.2E-15
score: 65.9
IPR029017Enolase-like, N-terminalGENE3DG3DSA:3.30.390.10coord: 2..131
e-value: 1.9E-53
score: 181.9
IPR029017Enolase-like, N-terminalSUPERFAMILYSSF54826Enolase N-terminal domain-likecoord: 7..139
IPR029065Enolase C-terminal domain-likePFAMPF13378MR_MLE_Ccoord: 204..412
e-value: 1.9E-50
score: 171.5
IPR036849Enolase-like, C-terminal domain superfamilyGENE3DG3DSA:3.20.20.120coord: 132..437
e-value: 8.4E-103
score: 345.7
IPR036849Enolase-like, C-terminal domain superfamilySUPERFAMILYSSF51604Enolase C-terminal domain-likecoord: 182..433
IPR034610L-fuconate dehydrataseSFLDSFLDF00111L-fuconate_dehydratasecoord: 6..434
e-value: 0.0
score: 652.5
IPR034610L-fuconate dehydratasePANTHERPTHR13794:SF58MITOCHONDRIAL ENOLASE SUPERFAMILY MEMBER 1coord: 2..439