TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30033139
Length (bp)1906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30033139) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30033139) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30033139) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30033139) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033139

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033139SMESG000079607.1 SMESG000072955.1 SMESG000049847.1 SMESG000049844.1 SMESG000049832.1 SMESG000049812.1 SMESG000049806.1 SMESG000049805.1 SMESG000049772.1 SMESG000049767.1 SMESG000049756.1 SMESG000049745.1 SMESG000049740.1 SMESG000049739.1 SMESG000049695.1 SMESG000049688.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000049601.1 SMESG000049567.1 SMESG000049548.1 SMESG000040301.1 SMESG000040257.1 SMESG000032755.1 SMESG000032715.1 SMESG000022696.1 SMESG000022691.1 SMESG000022676.1 SMESG000022665.1 SMESG000022640.1 SMESG000022619.1 SMESG000022612.1 dd_Smed_v4_490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30033139SMESG000079607.1 SMESG000072955.1 SMESG000049847.1 SMESG000049844.1 SMESG000049832.1 SMESG000049812.1 SMESG000049806.1 SMESG000049805.1 SMESG000049772.1 SMESG000049767.1 SMESG000049756.1 SMESG000049745.1 SMESG000049740.1 SMESG000049739.1 SMESG000049695.1 SMESG000049688.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000049601.1 SMESG000049567.1 SMESG000049548.1 SMESG000040301.1 SMESG000040257.1 SMESG000032755.1 SMESG000032715.1 SMESG000022696.1 SMESG000022691.1 SMESG000022676.1 SMESG000022665.1 SMESG000022640.1 SMESG000022619.1 SMESG000022612.1 dd_Smed_v4_490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033139SMESG000079607.1 SMESG000072955.1 SMESG000049847.1 SMESG000049844.1 SMESG000049832.1 SMESG000049812.1 SMESG000049806.1 SMESG000049805.1 SMESG000049772.1 SMESG000049767.1 SMESG000049756.1 SMESG000049745.1 SMESG000049740.1 SMESG000049739.1 SMESG000049695.1 SMESG000049688.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000049601.1 SMESG000049567.1 SMESG000049548.1 SMESG000040301.1 SMESG000040257.1 SMESG000032755.1 SMESG000032715.1 SMESG000022696.1 SMESG000022691.1 SMESG000022676.1 SMESG000022665.1 SMESG000022640.1 SMESG000022619.1 SMESG000022612.1 dd_Smed_v4_490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033139SMESG000079607.1 SMESG000072955.1 SMESG000049847.1 SMESG000049844.1 SMESG000049832.1 SMESG000049812.1 SMESG000049806.1 SMESG000049805.1 SMESG000049772.1 SMESG000049767.1 SMESG000049756.1 SMESG000049745.1 SMESG000049740.1 SMESG000049739.1 SMESG000049695.1 SMESG000049688.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000049601.1 SMESG000049567.1 SMESG000049548.1 SMESG000040301.1 SMESG000040257.1 SMESG000032755.1 SMESG000032715.1 SMESG000022696.1 SMESG000022691.1 SMESG000022676.1 SMESG000022665.1 SMESG000022640.1 SMESG000022619.1 SMESG000022612.1 dd_Smed_v4_490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30033139SMESG000079607.1 SMESG000049847.1 SMESG000049832.1 SMESG000049756.1 SMESG000040301.1 SMESG000022640.1 SMESG000072592.1 SMESG000049745.1 SMESG000049740.1 SMESG000049695.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049601.1 SMESG000049567.1 SMESG000040257.1 SMESG000022691.1 SMESG000022676.1 SMESG000049548.1 SMESG000049895.1 SMESG000049844.1 SMESG000049812.1 SMESG000022696.1 SMESG000022690.1 SMESG000022619.1 SMESG000072955.1 SMESG000049806.1 SMESG000049805.1 SMESG000032755.1 SMESG000032715.1 SMESG000022665.1 SMESG000000563.1 SMESG000000371.1 SMESG000049772.1 SMESG000049767.1 SMESG000049739.1 SMESG000049688.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000022612.1 SMESG000029699.1 SMESG000000559.1 SMESG000000302.1 SMESG000049565.1 SMESG000065603.1 SMESG000000411.1 SMESG000000372.1 dd_Smed_v6_490_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033139SMESG000079607.1 SMESG000049847.1 SMESG000049832.1 SMESG000049756.1 SMESG000040301.1 SMESG000022640.1 SMESG000072592.1 SMESG000049745.1 SMESG000049740.1 SMESG000049695.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049601.1 SMESG000049567.1 SMESG000040257.1 SMESG000022691.1 SMESG000022676.1 SMESG000049548.1 SMESG000049895.1 SMESG000049844.1 SMESG000049812.1 SMESG000022696.1 SMESG000022690.1 SMESG000022619.1 SMESG000072955.1 SMESG000049806.1 SMESG000049805.1 SMESG000032755.1 SMESG000032715.1 SMESG000022665.1 SMESG000000563.1 SMESG000000371.1 SMESG000049772.1 SMESG000049767.1 SMESG000049739.1 SMESG000049688.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000022612.1 SMESG000029699.1 SMESG000000559.1 SMESG000000302.1 SMESG000049565.1 SMESG000065603.1 SMESG000000411.1 SMESG000000372.1 dd_Smed_v6_490_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30033139SMESG000079607.1 SMESG000049847.1 SMESG000049832.1 SMESG000049756.1 SMESG000040301.1 SMESG000022640.1 SMESG000072592.1 SMESG000049745.1 SMESG000049740.1 SMESG000049695.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049601.1 SMESG000049567.1 SMESG000040257.1 SMESG000022691.1 SMESG000022676.1 SMESG000049548.1 SMESG000049895.1 SMESG000049844.1 SMESG000049812.1 SMESG000022696.1 SMESG000022690.1 SMESG000022619.1 SMESG000072955.1 SMESG000049806.1 SMESG000049805.1 SMESG000032755.1 SMESG000032715.1 SMESG000022665.1 SMESG000000563.1 SMESG000000371.1 SMESG000049772.1 SMESG000049767.1 SMESG000049739.1 SMESG000049688.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000022612.1 SMESG000029699.1 SMESG000000559.1 SMESG000000302.1 SMESG000049565.1 SMESG000065603.1 SMESG000000411.1 SMESG000000372.1 dd_Smed_v6_490_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033139SMESG000079607.1 SMESG000049847.1 SMESG000049832.1 SMESG000049756.1 SMESG000040301.1 SMESG000022640.1 SMESG000072592.1 SMESG000049745.1 SMESG000049740.1 SMESG000049695.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049601.1 SMESG000049567.1 SMESG000040257.1 SMESG000022691.1 SMESG000022676.1 SMESG000049548.1 SMESG000049895.1 SMESG000049844.1 SMESG000049812.1 SMESG000022696.1 SMESG000022690.1 SMESG000022619.1 SMESG000072955.1 SMESG000049806.1 SMESG000049805.1 SMESG000032755.1 SMESG000032715.1 SMESG000022665.1 SMESG000000563.1 SMESG000000371.1 SMESG000049772.1 SMESG000049767.1 SMESG000049739.1 SMESG000049688.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000022612.1 SMESG000029699.1 SMESG000000559.1 SMESG000000302.1 SMESG000049565.1 SMESG000065603.1 SMESG000000411.1 SMESG000000372.1 dd_Smed_v6_490_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033139SMESG000079607.1 SMESG000072955.1 SMESG000049847.1 SMESG000049844.1 SMESG000049832.1 SMESG000049812.1 SMESG000049806.1 SMESG000049805.1 SMESG000049772.1 SMESG000049767.1 SMESG000049756.1 SMESG000049745.1 SMESG000049740.1 SMESG000049739.1 SMESG000049695.1 SMESG000049688.1 SMESG000049683.1 SMESG000049676.1 SMESG000049665.1 SMESG000049663.1 SMESG000049647.1 SMESG000049621.1 SMESG000049614.1 SMESG000049601.1 SMESG000049567.1 SMESG000049548.1 SMESG000040301.1 SMESG000040257.1 SMESG000032755.1 SMESG000032715.1 SMESG000022696.1 SMESG000022691.1 SMESG000022676.1 SMESG000022665.1 SMESG000022640.1 SMESG000022619.1 SMESG000022612.1 dd_Smed_v4_490_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 106.301 bits (264), Expect = 2.027e-23
Identity = 101/409 (24.69%), Postives = 187/409 (45.72%), Query Frame = 3
Query:  291 QVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL-IKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            QV MI        D P       V+V CP + C ++T L  ++  H++ C   P +C F  +GC + +  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG++     LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:  183 QVPMIALQKHEDTDCPC------VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQVARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 106.301 bits (264), Expect = 2.027e-23
Identity = 101/409 (24.69%), Postives = 187/409 (45.72%), Query Frame = 3
Query:  291 QVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL-IKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            QV MI        D P       V+V CP + C ++T L  ++  H++ C   P +C F  +GC + +  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG++     LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:  183 QVPMIALQKHEDTDCPC------VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQVARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 88.1965 bits (217), Expect = 1.069e-17
Identity = 114/510 (22.35%), Postives = 214/510 (41.96%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTN-------------DK----------------FCPGEAEYCQVQ------MINFINDATEDHPINLRIS---KVIVKCPR--------------QNCEIKTELIKMEEHMN-NCDKRPISCPFNTFGCAI-----NEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C  ++       CG RFC  C+   LS++             DK                +C  E+  C  Q      +++  ND   +    +R     KV+ K  R               +C+ +  +I +++H + +C    +SCP     C++     +E  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG++     LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:   52 KCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHK---CSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQVARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 504          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 88.1965 bits (217), Expect = 1.069e-17
Identity = 114/510 (22.35%), Postives = 214/510 (41.96%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTN-------------DK----------------FCPGEAEYCQVQ------MINFINDATEDHPINLRIS---KVIVKCPR--------------QNCEIKTELIKMEEHMN-NCDKRPISCPFNTFGCAI-----NEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C  ++       CG RFC  C+   LS++             DK                +C  E+  C  Q      +++  ND   +    +R     KV+ K  R               +C+ +  +I +++H + +C    +SCP     C++     +E  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG++     LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:   52 KCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHK---CSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQVARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 504          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 80.8777 bits (198), Expect = 1.813e-15
Identity = 103/467 (22.06%), Postives = 198/467 (42.40%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKC--PRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCA----INEVASDEMNAHLNES--------NYCHSNL-LIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C  ++       CG RFC  C+   LS++   C      CQ  ++   +   +D+     I  + + C    + C  +  L  +  H+ N       C F    C       +V   ++  H+ ++        ++C S + +IA+      Q+  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG++     LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:   52 KCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIVK--DKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKN------DCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIAL------QVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQVARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 446          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 60.077 bits (144), Expect = 2.936e-9
Identity = 31/82 (37.80%), Postives = 46/82 (56.10%), Query Frame = 3
Query: 1137 WEIDKISEQRRNE-------MIYSKPFYSGPFGYKM--CLAVFIRGDNGDIYVDFH--LIRGDFDNNLEWPFKYEVAVDVID 1349
            W+IDK+ +QR NE        I+S PF S  FGYKM  C  +F  G +    +  +  L++G+FD  LEWPF   + + ++D
Sbjct:  267 WKIDKL-QQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLD 347          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 50.0618 bits (118), Expect = 3.181e-6
Identity = 25/88 (28.41%), Postives = 48/88 (54.55%), Query Frame = 3
Query: 1098 FGYENLLKSGFFEWEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFH-----LIRGDFDNNLEWPFKYEVAVDVI 1346
            +G ++  +       + K ++ + +  IYS+PFYS  +GYKM       GD G  + ++      L++G++D+ LEWPF+ +V   ++
Sbjct:  156 YGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGD-GLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSIL 242          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 97.0561 bits (240), Expect = 1.182e-20
Identity = 86/373 (23.06%), Postives = 169/373 (45.31%), Query Frame = 3
Query:  387 CEIKTELIKMEEHMNN-CDKRPISCPFNTFGCAINEVASDEMNAHLNESN----YCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIE---INSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM---------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            C +K  L ++++H    C   P++CP +   C+ + +   E+++H ++       C           LN++M    +       RM  +    LE   K+E++  E++   K   SL   + E+ ++  + R++   +E +  ++Q  M    +   E   E+E+   E+  L    R+M  ++ET   ++  +R  +  ++   +NS   S  L     +QQL  + +L      +++R  +     + L  + F    I KI + +R +          +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L+WPFK +V + ++D   G         +   P  + +R+P  + N
Sbjct:  182 CSLKMALTELQKHKETVCPAFPVACPNH---CSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLNQEMREHESSFASEHLRMMAVRNTTLEA--KVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLM----SSHSEKLLEVEMELRELRPL----RAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASL--EQQLTRHDDL---MSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMD--QGPARKHLGDAFKPDPSSSSFRRPTGEMN 534          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 83.5741 bits (205), Expect = 2.379e-16
Identity = 101/457 (22.10%), Postives = 183/457 (40.04%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLN-----EEMVVLKNEYRSMSSQMETNAEAINQI---RMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNE------MIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   +  A   PCG RFC  CI + +    + CP + E    + +   N A  +      I  + VKC    C  K EL ++E+H++ C        F T  C   +       +HL+E    H    I    +        + +N E          +  E       L ++ LA+  +   L+  +   +      R+++   EL  A   Q+  +M  R        + LN          L ++ R  S++   + +   ++   R  +  +E    +Q   +++ C     Q N+  E+ +    +   +ST   E     G + W ++  S   RN+      +++S PFY+G  GYK+CL + ++  +       I +  H ++G+FD+ L WP +  + + V+D   G   H   V  +  PD   +++P   RN
Sbjct:   60 EFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKRE------ILSLTVKCSNFGCSEKMELRQLEKHLSQCR-------FATAPCP--QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEM-----ELIRDQLALHCDTDCLKAPVA-CTFSTFGCREKMTRNEL--AQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRR--KLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ--HHIEVMETK-PDLQAFQRPTVMRN 488          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 83.5741 bits (205), Expect = 2.379e-16
Identity = 101/457 (22.10%), Postives = 183/457 (40.04%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLN-----EEMVVLKNEYRSMSSQMETNAEAINQI---RMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNE------MIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   +  A   PCG RFC  CI + +    + CP + E    + +   N A  +      I  + VKC    C  K EL ++E+H++ C        F T  C   +       +HL+E    H    I    +        + +N E          +  E       L ++ LA+  +   L+  +   +      R+++   EL  A   Q+  +M  R        + LN          L ++ R  S++   + +   ++   R  +  +E    +Q   +++ C     Q N+  E+ +    +   +ST   E     G + W ++  S   RN+      +++S PFY+G  GYK+CL + ++  +       I +  H ++G+FD+ L WP +  + + V+D   G   H   V  +  PD   +++P   RN
Sbjct:   60 EFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKRE------ILSLTVKCSNFGCSEKMELRQLEKHLSQCR-------FATAPCP--QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEM-----ELIRDQLALHCDTDCLKAPVA-CTFSTFGCREKMTRNEL--AQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRR--KLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ--HHIEVMETK-PDLQAFQRPTVMRN 488          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 83.5741 bits (205), Expect = 2.379e-16
Identity = 101/457 (22.10%), Postives = 183/457 (40.04%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLN-----EEMVVLKNEYRSMSSQMETNAEAINQI---RMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNE------MIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   +  A   PCG RFC  CI + +    + CP + E    + +   N A  +      I  + VKC    C  K EL ++E+H++ C        F T  C   +       +HL+E    H    I    +        + +N E          +  E       L ++ LA+  +   L+  +   +      R+++   EL  A   Q+  +M  R        + LN          L ++ R  S++   + +   ++   R  +  +E    +Q   +++ C     Q N+  E+ +    +   +ST   E     G + W ++  S   RN+      +++S PFY+G  GYK+CL + ++  +       I +  H ++G+FD+ L WP +  + + V+D   G   H   V  +  PD   +++P   RN
Sbjct:   60 EFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKRE------ILSLTVKCSNFGCSEKMELRQLEKHLSQCR-------FATAPCP--QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEM-----ELIRDQLALHCDTDCLKAPVA-CTFSTFGCREKMTRNEL--AQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRR--KLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ--HHIEVMETK-PDLQAFQRPTVMRN 488          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 83.5741 bits (205), Expect = 2.462e-16
Identity = 94/376 (25.00%), Postives = 167/376 (44.41%), Query Frame = 3
Query:  411 KMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKEL-ENTRKIENLNKEILAVKKNNQ---SLRDEMTELSKENRKFRQQIDTI----ELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAIN-QIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQR------RNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANG-NIIHSRSVKYSDCPDDAGWRKPASDRN-DPICIYYNPIS 1475
            K  +H+  C K    C F+  GC +  V  ++++ H    +Y H NLL+  I  +   +ES+  +++EL       +  EL ++ R++E    ++     + Q   +L             F      +    ELQ  + + K+ E+  R QE   ++      + VL  E    ++ ME    A N Q R+  ++IEI     ++ ++Q      L+    +EME    E+    S   Y+     G F W+I   S++R      R   ++S  FY+  +GYKMCL +++ GD       + + F ++RG  D  L+WPF  +V + ++D  N  +II +     S     + +++P SD N    C  + P+S
Sbjct:  201 KYVDHIKLCTKFRTPCRFHVVGCDMT-VEKEKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQSLELASH----KIHELHQSLRELELKMGQLCGAGASVQGACALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVVELSRRCQELELKVNTFENIVCVLNREMERSATTME----AYNRQHRLDQDKIEI----LNNKVRQLERTVGLRDLSIVEMEAKMREM----SAATYD-----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDIS----SSSFQRPVSDMNIASGCPLFCPLS 550          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 93.5893 bits (231), Expect = 2.396e-19
Identity = 100/430 (23.26%), Postives = 177/430 (41.16%), Query Frame = 3
Query:  225 SDCIEQ---YLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL-IKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENME-------LRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSAN---LQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            SD IE+   Y  T  KFC       QV ++        D P       V++ CP   C +K+ L  ++  H+  C   P +C F  +GC      + ++ AH   S   H NL+    N L  ++  + NE+ E       L  +M   E +   +  ++ N    I+ +++  +   D++ +L KE R  RQ  D  +   +N   LQ ++ ++E                 V+ KN        +ET     +Q+ + +  I +                   A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V++ ++D          + K    P+ + ++KP  + N
Sbjct:  158 SDHIEKTCKYRETPCKFCRN-----QVPLVEMQKHEDVDCP------SVVISCPHM-CSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGT-NQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLE-----------------VMAKNAASWNPGVLETQINRHDQM-LSVHDIRL-------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMN 522          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 82.0333 bits (201), Expect = 9.564e-16
Identity = 109/512 (21.29%), Postives = 194/512 (37.89%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLS-------------TNDK----------------FCPGEAEYCQ--VQMINFINDATEDHPINLRISKVIVKCPRQNCEIKT---------------------------ELIKMEEHMN-NCDKRPISCPFNTFGCAI-----NEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENME-------LRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSAN---LQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C+ ++       CG RFC  C+   LS             T DK                FC  E   C+  + + N +     D           + CPR +C+ K                             L++M++H + +C    ISCP     C++     +E  + ++ AH   S   H NL+    N L  ++  + NE+ E       L  +M   E +   +  ++ N    I+ +++  +   D++ +L KE R  RQ  D  +   +N   LQ ++ ++E                 V+ KN        +ET     +Q+ + +  I +                   A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V++ ++D          + K    P+ + ++KP  + N
Sbjct:   47 KCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEE------LSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHM---CSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLE-----------------VMAKNAASWNPGVLETQINRHDQM-LSVHDIRL-------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMN 497          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 78.1814 bits (191), Expect = 1.841e-14
Identity = 101/487 (20.74%), Postives = 193/487 (39.63%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISC-----PFNTFG------------------CAINEVASDEMN-------AHLNESNYCHSNLL---IAMINNLNRQMESM--MNENMELRQRMGRME-AKEL-ENTRKIENLNKEILAVKKNNQSLRDEMTELSK-ENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEID------KISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   + +A   PCG RFC  CI + +      CP + E      + F ++  +   ++LR     VKCP Q C    EL  +E H+  CD   + C      F  +                   CA+     D++N       A++    YC +NL+   +    +++  M  +  M       ++M R + A+ L E T+    +  + L    ++ +    M ++S  +  +F     ++    ++      +     +     IE L   +V   ++ R + ++MET    +N+++  I  ++                     N+  EME         Q   G         F W I+      K  E+ R  +I+S+ FY+G  GYK+CL + ++  +       I +  H ++G++D+ L WP +  + + ++D + G  +  +       P+   +++P   RN
Sbjct:   61 EFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQL-FPDNFAKREILSLR-----VKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCALAMALEDKLNHDQTCPLAYVT-CEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEFTQAHMRMMAQTLRSFSSSVTPTSHMPDISFCDPSQFEPAPPSVATVHSSHTPSQNDCTQETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLD---------------------NRLGEMES--------QQCSG--------IFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 70.8626 bits (172), Expect = 3.278e-12
Identity = 101/479 (21.09%), Postives = 195/479 (40.71%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINF-INDATEDHPINLRISKVIVKCPRQ-NCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESN--------YCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILA----VKKNNQS-LRDEMTELSKENRKFRQQIDTI----ELQSANLQQKMGEMEAREQE--NAGEIELLN-EEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEI--------NSQQQSDALK-----------QNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGDNGD----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C  ++       CG RFC  CI   +  +      E   C + M N   ++  +D+     +  ++V C     C++K  L + +EH+  C      C  +  GC  +++   E+  HL            YC   +     NN  +   S      +L + +      EL+ T    N    ++     VK++  + LRD M  +   N K  +Q+ ++    +L+   +QQ    ++  E+E    G+    N   +   K     +   M    + I  +  +  R+++        +++Q+   L+           Q  +   L +N  ++M       R ++ T  Y     +G   W+I     ++R  M      I+S+ FY+   GY++C   ++ GD       + + F +++G+FD+ L WPFK +V + ++D + G   H   V  +D P+ + +++P S+ N
Sbjct:   43 KCASCHLVLHNPHQTGCGHRFCEKCISNLIELS------ETPQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSND--GCH-DQMIRKELKGHLESECKLRQEACIYCKQTMSFNHENNYKKIFFSF-----QLDKHLCECPEAELQCT--FSNYGCNVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGT-SY-----NGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQS-GKKNHITDVFRAD-PNSSSFKRPDSEMN 497          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 68.1662 bits (165), Expect = 1.862e-11
Identity = 51/242 (21.07%), Postives = 109/242 (45.04%), Query Frame = 3
Query:  708 NNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKS---------------GFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSAN 1358
            N++ L  E   L++   K    I     +  +L  +MG +   +   A   + L+++    +N    ++ ++E ++ A  ++  Q+      +Q++ +AL                      ++RQ++ T G + L+ +               G F W+I +  ++R++ +      ++S PFY+  +GYKMCL +++ GD    N  + + F +++G+ D  L WPF  +V + ++D  N
Sbjct:  203 NDKCLEHENKSLAEHLAKVWDYIQHGRKEQNDLSVRMGSLSV-QGSPAPPFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLR----AAQEKVEAL--------------------TTKVRQLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNN 419          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 105.145 bits (261), Expect = 3.122e-23
Identity = 108/441 (24.49%), Postives = 197/441 (44.67%), Query Frame = 3
Query:  225 SDCIEQYLSTN-----DKFCPGEAEYC-----QVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL-IKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            +DC E+ L  +     +K C      C     QV MI        D P       V+V CP + C ++T L  ++  H++ C   P +C F  +GC + +  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG+      LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:  150 ADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPC------VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQAARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 89.3521 bits (220), Expect = 3.548e-18
Identity = 115/510 (22.55%), Postives = 214/510 (41.96%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTN-------------DK----------------FCPGEAEYCQVQ------MINFINDATEDHPINLRIS---KVIVKCPR--------------QNCEIKTELIKMEEHMN-NCDKRPISCPFNTFGCAI-----NEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C+ ++       CG RFC  C+   LS++             DK                +C  E   C  Q      +++  N+   +    LR     KV+ K  R               +C+ +  +IK+++H + +C    +SCP     C++     +E  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG+      LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:   51 KCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHK---CSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQAARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 89.3521 bits (220), Expect = 3.548e-18
Identity = 115/510 (22.55%), Postives = 214/510 (41.96%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTN-------------DK----------------FCPGEAEYCQVQ------MINFINDATEDHPINLRIS---KVIVKCPR--------------QNCEIKTELIKMEEHMN-NCDKRPISCPFNTFGCAI-----NEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C+ ++       CG RFC  C+   LS++             DK                +C  E   C  Q      +++  N+   +    LR     KV+ K  R               +C+ +  +IK+++H + +C    +SCP     C++     +E  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG+      LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:   51 KCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHK---CSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQAARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 75.8702 bits (185), Expect = 6.417e-14
Identity = 102/490 (20.82%), Postives = 194/490 (39.59%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEH---------------------------MNNCDKRPISCPFNTFGCAINEVASDEMNAHLNES-------NYCHSNLLI-AMINNLNRQMESM----MNENMELRQRMGRME-AKEL-ENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEID------KISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   + +A   PCG RFC  CI + +      CP + E      I   N    D+     I  + VKCP + C  K EL  +E+H                           + +C +R +SC      CA++ +A +E   H            YC + L+   M N+ +    +             ++M R   A+ L ENT+    L+  +LA   +N +L     + +  +R  R +         N ++ + ++E+R              +V   ++ R ++++MET +  + +++  I  +E       D + +            +E ++C                  +G + W+I       K  E+ R  +I+S  FY+G  GYK+C+ + ++          I +  H ++G++D++L WPF+  + + ++D +   I  +        P+   +++P   RN
Sbjct:   59 EFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSC----VNCAVS-MAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQ----LHMRLLAQAVHNVNLALRPCDAASPSRGCRPE-------DPNYEETIKQLESR--------------LVRQDHQIRELTAKMETQSMYVGELKRTIRTLE-------DKVAE------------MEAQQC------------------NGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRN 475          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 74.7146 bits (182), Expect = 1.522e-13
Identity = 76/369 (20.60%), Postives = 157/369 (42.55%), Query Frame = 3
Query:  366 VKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGDNGD----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            V CP + C       ++ EH+  C +    CPF  +GC +                    NLL      L   M  ++ +N +L QR+  +    LE  +K+   +  I          +D  + L      +R+ + +   +SA L+ ++ ++          ++++N++   L  + RS+   +++  + I Q+    +R+ +   + S     +    + Q NKN E        +Q+      E    SG   W++     ++R  +      ++S+PFY+   GY++C   ++ GD       + + F ++RG+FD+ L+WPF+  V + ++D + G   H      +D P+ + +++P  + N
Sbjct:  193 VSCPNR-CVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGK---------------RGNLLEHERAALQDHMLLVLEKNYQLEQRVNAL-LSSLERKKKMAAADSAIQHATNPMSRFQDIFSFL------YRKALTSHTDKSAWLEAQVRQL----------LQIVNQQPSRL--DLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKH-DAHINIHKAQLNKNEE------RFKQL------EGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQS-GKKNHIVETFKAD-PNSSSFKRPDGEMN 511          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 9.736e-23
Identity = 101/409 (24.69%), Postives = 187/409 (45.72%), Query Frame = 3
Query:  291 QVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL-IKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            QV MI        D P       V+V CP + C ++T L  ++  H++ C   P +C F  +GC + +  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG++     LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:  183 QVPMIALQKHEDTDCPC------VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQVARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 2.184e-22
Identity = 108/441 (24.49%), Postives = 197/441 (44.67%), Query Frame = 3
Query:  225 SDCIEQYLSTN-----DKFCPGEAEYC-----QVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL-IKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            +DC E+ L  +     +K C      C     QV MI        D P       V+V CP + C ++T L  ++  H++ C   P +C F  +GC + +  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG+      LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:  150 ADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPC------VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQAARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.302e-16
Identity = 106/489 (21.68%), Postives = 189/489 (38.65%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHM---------------------------NNCDKRPISCPFNTFGCAINEVASDEMNAHLNESN--YCHSNLLIAMINNLNRQMESMMNENMELRQRMG---RMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFR----QQIDTIELQSANLQQKMGEME---AREQENAGE-IELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEI------DKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   + +A   PCG RFC  CI + L      CP + E      I   N    D+     I  + VKCP Q C    EL  +E H+                           + C +R I C       A  +++  E+   L      YC +NL+   + + +  M+  M     +    G   +M+  +L   R +++  +    ++   Q+LR   T  +            Q + + L  A             ++E  N  E IE L   +V   ++ R + ++MET    +N+++  I  +E                     +K L+++             G+     +G F W+I       K  E+ +  +I+S  FY+G  GYK+CL + ++  +       I +  H ++G++D+ L WP    + + ++D + G II  +       PD   +++P + RN
Sbjct:   61 EFDPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCPVDNE------ILMENQLFPDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQCQFASVECSQCQGSFPKSRLEKHMEHECGRRKIFCDNCGLAMAYEDMSGHELICPLAYVTCEYCQTNLIREQMPS-HYSMDCTMAPIPCMYYEFGCTEKMQRNDL--ARHLQDFTQA--HMRMMFQTLRSFSTTPTSHISDISFCDPNQFEPVPLSVAPAHPSHMPSHQDCSQETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLE---------------------DKLLDVD-------------GHHC---NGVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLLAFQRPTTQRN 501          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.186e-15
Identity = 99/470 (21.06%), Postives = 191/470 (40.64%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISC-----PFNTF--------GCAINEVASDEMNAHLNESNYCHSNLLIAM----INNLNRQMESMMNE---NMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGE-IELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEID------KISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   + +A   PCG RFC  CI + +      CP + E      I   N    D+     I  ++VKCP + C  K EL  +E+H  +C+   + C     PF  F         C   +V+ D   A            L+A     I++ N  + +++ E    + +R++M      +L+                +  Q  R+ +    +EN +   ++    + S +L    G +   E  N  E I  L   +V   ++ R ++++MET +  +++++  I  +E       D + +            +E ++C                  +G + W+I       K  E+ +  +I+S  FY+G  GYK+C+ + ++          I +  H ++G++D++L WPF+  + + ++D +   +  +        PD   +++P   RN
Sbjct:   59 EFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAA------------LVAFEDKEIHDQNCPLANVICEYCNTILIREQMP--NHYDLDCPTAPIPCTFSTFGCHEKMQ--RNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVS--EVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLE-------DKVAE------------IEAQQC------------------NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRN 467          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.207e-15
Identity = 99/470 (21.06%), Postives = 191/470 (40.64%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISC-----PFNTF--------GCAINEVASDEMNAHLNESNYCHSNLLIAM----INNLNRQMESMMNE---NMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGE-IELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEID------KISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   + +A   PCG RFC  CI + +      CP + E      I   N    D+     I  ++VKCP + C  K EL  +E+H  +C+   + C     PF  F         C   +V+ D   A            L+A     I++ N  + +++ E    + +R++M      +L+                +  Q  R+ +    +EN +   ++    + S +L    G +   E  N  E I  L   +V   ++ R ++++MET +  +++++  I  +E       D + +            +E ++C                  +G + W+I       K  E+ +  +I+S  FY+G  GYK+C+ + ++          I +  H ++G++D++L WPF+  + + ++D +   +  +        PD   +++P   RN
Sbjct:   59 EFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAA------------LVAFEDKEIHDQNCPLANVICEYCNTILIREQMP--NHYDLDCPTAPIPCTFSTFGCHEKMQ--RNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVS--EVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLE-------DKVAE------------IEAQQC------------------NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRN 467          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.175e-36
Identity = 116/446 (26.01%), Postives = 210/446 (47.09%), Query Frame = 3
Query:  135 DNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMT-ELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEA-----INQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEK-CANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM-IYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCP-DDAGWRKPASDRND 1445
            D  + ++L C +C  LM  AC + CGC +C  CI  YLS N  +CPG+   C+   +N   D   +  ++ RIS+++VKCP   C   +EL++++EH++ C    + CP  T GC    +  DEM  HL +    H+ L+++  N    +++S +N N E  +               I +L KE+L V+K   +L DE T ++     + R + + I + S ++Q+   EM         E++ L  ++ + + E   M + +E          +  ++ +I  I++N       +  N E+++ + N  + + K C N                   F W I++ S++RR    +YS  F S    YK CL ++I GDN  ++    +++G+ D+ LEWP +  V + +I+  +     +   +Y     +   + +P  +RND
Sbjct:   22 DESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCN----ELKSEINHNNETTK-------------EDISHL-KEVLRVQK---ALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMN-------IDSNNEERERKMNNLIRLNKLCPN---------------VDMDFMWRIEEYSKKRRTVTDVYSDSFQSH--NYKFCLNLYIYGDNLGLWC--VIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERND 420          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.051e-28
Identity = 56/173 (32.37%), Postives = 100/173 (57.80%), Query Frame = 3
Query:  105 KMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQ 623
            +++    FE +  +   LKC +CK L++ AC + CGCRFCS CI +Y+S  + +CPG    C+ + +   ++   D+ +N +I+K+ VKCP + C++  EL+ +EEH+  C  +  +CPF   GC   ++   ++  HL    + HS L+I +I+N+      +  + +ELR+
Sbjct:    8 RLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELRE 180          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2K6N2X0 (TNF receptor-associated factor OS=Rhinopithecus bieti OX=61621 GN=TRAF3 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.921e-25
Identity = 110/453 (24.28%), Postives = 204/453 (45.03%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL-IKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRME----AKELENTRKIENLN---KEILAVKKNNQSLRDEMTELSKENRKFRQ---QIDTIELQSANLQQKMGEMEAREQENAGEIE----LLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            KC  C+ ++       CG RFC  C+   LS++   C      CQ  ++        D P       V+V CP + C ++  L  ++  H++ C   P +C F  +GC + +  + ++ AH   S   H NLL    N+L +++  + NE++E  + +  +     + E+E  R+ E L     +IL +++   S  +++ EL KE R FRQ   + D+++    +LQ ++ E+E+ ++ +AG++     LL  ++        S   QM +    ++ IR+                          A+ +L          Q+  T  Y     +G   W+I     +++  +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G+        +   P+ + ++KP  + N
Sbjct:   52 KCEKCRLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIVKDKKHEDTDCPC------VVVSCPHK-CSVQALLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK-SAGQVARNTGLLESQL--------SRHDQMLS----VHDIRL--------------------------ADMDLRF--------QVLETASY-----NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 438          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A553N2K7 (TNF receptor-associated factor OS=Danionella translucida OX=623744 GN=DNTS_027395 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.769e-22
Identity = 106/448 (23.66%), Postives = 193/448 (43.08%), Query Frame = 3
Query:  162 CRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMN-NCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLI----AMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIE---INSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM---------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            C  C+ ++  A   PCG RFC  CI + LS ++  CP + E           D  +DH +     +  V CP   C+ K     M EH++  C  R I+C F     A+NE    E+++H ++    H              LN++M    +       RM  +    LE   K+E++  E++   K    L   + E+ +++ + +++   +E +  ++Q+ M     +  E            +      R+M  ++E   +++  +R  +  ++   +NS   S+ L     +QQL  + NL      +++R  +     + L  + F    I KI E +R +          +YS+PFY+  FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G         +   P  + +R+P  + N
Sbjct:   56 CESCRLVLCNARQTPCGHRFCESCITELLSKSNPVCPADLE-------PLFED--KDHLVVCPYFE--VPCPLGKCKEKMMRKDMPEHLSRKCKHREITCEFCNHKMALNE---SELSSHQHDCPKAHVTCSFIRYGCSFKGLNKEMREHESSFASEHLRMMVVRNTTLEA--KVEDVKSELVERYKVLPGLSSRLAEVERQHEEMKEKNRQLEQKVLSVQKLMSAHSEKLLEVE--------LELRELRPLRAMREEVEALRDSVESMRSVVSSMDSACVNSTSSSNNLAS--LEQQLLRHDNL---MSVHDVRLAEMDLKLQVLETASFNGTLIWKIREYKRRKQEAVASKTLSLYSQPFYTSYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLILMD--QGPARKHLGDAFKPDPSSSSFRRPTGEMN 472          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0P7UB07 (TNF receptor-associated factor 3-like (Fragment) OS=Scleropages formosus OX=113540 GN=Z043_109866 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 4.804e-22
Identity = 109/452 (24.12%), Postives = 194/452 (42.92%), Query Frame = 3
Query:  162 CRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKC--PRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHL--------NESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALK--QNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM---------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            C  C  ++       CG RFC  CI   LS  D  CP + E        F +    D   N  I  + V C   +  C+ +  L ++ +H+N C    + CP    G    ++   +M  HL            +C   + +  I  LN+ M+   +  +    RM       LE   K+E++  E+    K    L   ++E+     + R++   +E + +++Q+ +    +   E   EIEL   E+  L    RSM  ++E+   ++  IR ++  +E+     S   +  +  EQQ  + +  L +    +EIR       ++ L  + +    I KI + +R +          +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D   G         +   P+ + +R+PA + N
Sbjct:   55 CEACHFVLCNPKQTECGHRFCETCILDLLSKRDPVCPVDMEPL------FEDKIFRDVCCNREIMALKVYCRNEKNGCKEQMSLHQVMDHLNVCPYFEVPCPL---GKCKEKMMRKDMPDHLAWKCKYRETTCEFCKHKMALTEIQGLNQDMKDHDSSFVSEHLRMMATRNAALEA--KVEDVKGELQERYKVLPGLNSRLSEMESCLEEMREKSRQVEQKLSSMQKVL----SSHTEKMLEIEL---ELRSL----RSMRDEVESLRNSVENIRSRVTALELGQVGTSSGTQTLKTLEQQMSRHDDMLSV----HEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMD--QGPARKHLGDAFKPDPNSSSFRRPAGEMN 478          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 87.0409 bits (214), Expect = 1.792e-17
Identity = 94/373 (25.20%), Postives = 171/373 (45.84%), Query Frame = 3
Query:  411 KMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKEL-ENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTI----ELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAIN-QIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQR------RNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANG-NIIHSRSVKYSDCPDDAGWRKPASDRN-DPICIYYNPIS 1475
            K  +H+  C K    C F+  GC ++ V  ++++ H    +Y H NLL+  I  +   +ES+  +++EL       + +EL ++ R++E    ++ A      +              F     T+    ELQ  + + K+ E+  R QE   ++      + VL  E    ++ ME    A N Q R+  ++IEI     ++ ++Q      L+    +EME    ++R++ S   Y+     G F W+I   S++R      R   ++S  FY+  +GYKMCL +++ GD       + + F ++RG  D  L+WPF  +V + ++D  N  +II +     S     + +++P SD N    C  + P+S
Sbjct:  201 KYVDHIKLCTKFRTPCRFHVVGCDMS-VEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQSLELASH----KIQELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPTLATSFTPLPTTVGAALELQLHSEKTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTME----AYNRQHRLDQDKIEI----LNNKVRQLERTVGLRDLSIVEME---GKMREM-SAATYD-----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDIS----SSSFQRPVSDMNIASGCPLFCPLS 547          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 80.4925 bits (197), Expect = 1.632e-15
Identity = 104/484 (21.49%), Postives = 194/484 (40.08%), Query Frame = 3
Query:  135 DNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTEL--------------------------IKMEEHMNN-CDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLL---IAMINNLNRQMESMMNENMELR-QRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKE------NRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNE------MIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            D  + S+ +C IC   +  A   PCG RFC+ CI + +    + CP + E      +   N A  +      I  + V+C    C  K EL                           ++EEH+N  C  R I+CP     CA N + +++  A     ++C ++ L   +A   ++    E M+  ++ L  Q   +M  + + +  + + +N  I +   +  S  D     S+       N++ +Q  +T+            E+E+R              +V   ++ R +S + ET +  + ++R ++  +E +              ++LQA +                   Y+     G + W ++  S   RN+      +++S PFY+G  GYK+CL + ++  N       I +  H ++G+FD+ L WP +  + + V+D A G   H   V  +  PD   +++P   RN
Sbjct:   61 DPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNEVLTEDQLFPDNFAKRE------ILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCP----DCAENIIYAEKQLA-----SHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVL-----------ELESR--------------LVRQDHKLRELSIRNETQSTQMTELRKKLASLEES-------------MRELQAQQ-------------------YQ-----GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQ--HHVEVMETK-PDLQAFQRPTVQRN 464          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 78.1814 bits (191), Expect = 8.488e-15
Identity = 85/369 (23.04%), Postives = 163/369 (44.17%), Query Frame = 3
Query:  366 VKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANE-IRQIQSTFGYENLLKSGFFEWEI-DKISEQRRNEMIYSKPFYSGPFGYKMCLAVFI------RGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAG--WRKPASDRN 1442
            V+CP + C    +  K+++H + C ++   C +  +GC +      ++  H  ++ + H  LL+   N+       ++ +  +L+Q     + +  E    + NL +E+              T +S   R   +Q + +            + E ++  +  E +L  EE+V L+    S+  Q+     A+ Q          + ++   AL Q C+      + +++  +C+ +  +Q++ST  Y+     G   W++ D   ++     + S PFY+   GYK+   V++      RG +  +YV   L+RGDFD+ L WPF+  V + V+D + GN  H   V  S  PD A   +R+P S+ N
Sbjct:  195 VQCPNK-CIHLVKRHKLKDHADECPEQETDCIYKKYGCTVRN-KRGQVKVH-EQTEFNHHVLLLLESNS------KLIKQVDQLQQDFAAQQGELKERNLLVSNLKREVSKCD----------TTVSAMQRSVEEQRELV---------SSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQV-----AMTQ----------SLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLEST-SYD-----GKLIWKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYV--MLMRGDFDSLLPWPFRQNVTLAVLDQS-GNRNH---VSLSFTPDLASNNFRRPTSETN 508          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 77.411 bits (189), Expect = 1.750e-14
Identity = 102/463 (22.03%), Postives = 188/463 (40.60%), Query Frame = 3
Query:  117 ENQFESD--NEICSELK-----CRICKCLMIKACNAPCGCRFCSDCIEQYLSTN-DKFC------PGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNES--------NYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNK----EILAVKKNNQSLRD-----EMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQ-----ENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIE------INSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEMI------YSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVID 1349
            EN+F       IC +L      C  C  ++ +A    CG R+C  C+   L  N D  C      PG        M+  ++    D+ IN  I ++ V C  Q C  ++ L   E+H + C+   I C     GC +  V    +  HL +           C S L  A + ++      + +   E  +R       E+  T K  N +K    E+ +   +   L +     +M+      R  +     + L    L+   G+  A ++     ++  E+E + +++  L+   + M + +      + + ++ +  +E      +N  Q  +A+    EQQQ    K+L++          QS    +++   G F W I  +S++ +          YS  FY+  +G+K+C+ +++ GD       I + F +++GD+D  L WPFK +V   +ID
Sbjct:    7 ENEFPCGFPQSICDDLPPVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSES--DSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGCGL-MVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQSVTYFSLFLKDSKQESPKRKETCVFSEIGCTFK-GNPDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPALDLTLNGGELETDSGDTGANDKALSLHDDQAELE-VGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVA--EQQQRLIRKDLQISSLQ------QSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLID 453          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 75.0998 bits (183), Expect = 8.082e-14
Identity = 112/485 (23.09%), Postives = 187/485 (38.56%), Query Frame = 3
Query:  117 ENQFESD--NEICSELK-----CRICKCLMIKACNAPCGCRFCSDCIEQYLSTN-DKFC------PGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHL-----NESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEI-LAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEARE-QENAGEIELLNEEMVVLKN------EYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQN--------------CEQQQLQA---------NKNL--EMEKCANEIRQI------------QSTFGYENLLKSGFFEWEIDKISEQRRNEMI------YSKPFYSGPFGYKMCLAVFIRGDN----GDIYVDFHLIRGDFDNNLEWPFKYEVAVDVID 1349
            EN+F       IC +L      C  C  ++ +A    CG R+C  C+   L  N D  C      PG        M+  ++    D+ IN  I ++ V C  Q C  ++ L   E+H + C+   I C     GC +  V    +  HL     N    C           L +   S   E    +    + ++K+    RK   +  EI    K N   +R+   E+S  +      ++ +     N+Q  +     R  Q  A ++ L N++M  L +      E  + S     N +A++   +  ++ E+   QQ  AL+Q                E+ QL           N NL   +E    E +Q             QS    +++   G F W I  +S++ +          YS  FY+  +G+K+C+ +++ GD       I + F +++GD+D  L WPFK +V   +ID
Sbjct:    7 ENEFPCGFPQSICDDLPPVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSES--DSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGCGL-MVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQKHSCSNGTEKDLSKAEKRKKDSKQESPKRKETCVFSEIGCTFKGNPDKVREH--EVSSTSAHLHLLVEVVR----NVQMSVPPPPERTVQYPALDLHLQNQDMTPLPDITLNGGELETDSGDTGANDKALS---LHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLID 476          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 1.903e-24
Identity = 94/417 (22.54%), Postives = 168/417 (40.29%), Query Frame = 3
Query:  246 LSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCE-IKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQ-------MESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQR------RNEMIYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            L+ +   CP  AE+C+           E H      ++  + CP  NCE       ++ +HM+ C      C F+  GC   +  S+ +  H   +   H  L+I+  + L  Q       +E   N +  L QR+ ++E          ++L+        NN  L   +  L++ N          +LQS ++ Q+  + +A       +   L  +M  L+   R++ + +        +  M  +R+ ++     D L    E++                  Q+  T GY     SG   W+I   + ++      R   +YS+PFY+ PFGYKMC   ++ GD       + + F ++RG++D  LEWPF+  V + ++D   G      S  ++  P    +R+P  D N
Sbjct:   22 LAAHRASCPHRAEFCKYCSAAVTCSLLERHHKE-ECAQYPLPCP-NNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLE----------QDLSHWSTLTGSNNTRLGSTLEMLTQHNE---------QLQSLHVAQRAPQRDA-------DTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMH-----DGLLDTAERRL-----------------QVLETAGY-----SGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLD--QGAARRHLSDTFTPDPASGSFRRPDGDMN 381          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 3.959e-17
Identity = 82/376 (21.81%), Postives = 157/376 (41.76%), Query Frame = 3
Query:  348 RISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIR-QIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            R  +  + CP +  E      ++  H+  C  +   C F+ FGC         +  H + +   H +L+ A   NL  ++  + ++  E      R  + +L  TR +  L KE+++V    Q+     + L    R    Q + +      LQ+ M     R   +A   +L  +      +E  +  + +E +  ++           ++S     AL ++  Q      +  EM+     +R Q+  T  Y     +G   W+I   + ++++ +      +YS+PFY+ PFGY+MC   ++ GD       + + F ++RG++D  L WPF+  V + ++D   G      S  +   P  + +R+P SD N
Sbjct:   97 RCPRYPIPCPNKCEEQSIAREELVSHLGICPYKQAECFFSQFGCKYKGTLQG-LKEHESGATQQHLSLVTARSANLELKVSMLQSQLAE------RANSADLLGTR-VRELEKELISV---GQTASKNESVLCVVQRMLAVQTERL----LRLQESMQGTTRRADHDALRGDL--DGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDS-----ALSRHDTQLFAHDTRLAEMD-----LRFQVLETASY-----NGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLD--QGAARRQLSDTFKPDPASSSFRRPTSDMN 438          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 64.6994 bits (156), Expect = 3.606e-11
Identity = 36/153 (23.53%), Postives = 67/153 (43.79%), Query Frame = 3
Query: 1107 ENLLKSGFFEWEIDKISEQRRNEM----------------IYSKPFYSGPFGYKMCL-----------------AVFIRGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRNDPICIYYN 1466
            E+ L +G F W +++ S      +                ++S  FY+G  GY++CL                 +V + G    + +  HL++GD+D+ L WPFK  + + V+D    + +H   +  +D P  + +++P+  RN     Y N
Sbjct:  387 ESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDAD-PQLSAFQRPSVHRNPKGFGYMN 538          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 93.9745 bits (232), Expect = 2.838e-20
Identity = 111/476 (23.32%), Postives = 193/476 (40.55%), Query Frame = 3
Query:  162 CRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCP-----------------------------GEAEYCQ----VQMIN-------FI-------NDATEDHPINLRISKVIVK-CPRQ-----NCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNES----NYCHSNLL-----IAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAR-EQEN-AGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANE-IR-QIQSTFGYENLLKSGFFEWEIDKISEQRRN------EMIYSKPFYSGPFGYKMCLAVFIRGDNG--DIYVDFH--LIRGDFDNNLEWPFKYEVAVDVIDSANG 1361
            C  C+  +     A CG RFC  CI+  L +    CP                             G  + CQ    V MI        FI       +D   +  +  +++K + K CP +      C+       + EH+  C   PI CP     C +  +   +++AH  E       C  + L     +  I     Q + ++   + L +  G  +   LE   ++E  + E  + K   +  + E  ++ +       ++  +E   AN +  + E+  R +QEN  GE+ +        +++ +    + + N E +  +   ++R+E+    Q++  K N    QL+++  +   K   E +R QIQ    Y+     G F W+IDK +E+           IYS PFY+  FGYK+C  +F  GD    D Y+     L+RG++D+ L WPF+  + + +ID  NG
Sbjct:   12 CNACRMPLNHPMQAQCGHRFCKHCIDVILISPFPACPRDGQTIQALSVFHDRCALVEMQALPCYCHGRCDGCQWTGPVAMITVHEEVCAFIKVSCIHASDGCGEIMLRFQLAKHVEKECPFRLITCVYCQNDVPERTLIEHLKKCPAFPIECPNE---CGVKRIERKKLSAHTRECPNALTDCRFSPLGCTYKVKKIALREHQNKHVIKHMILLGRTTGEPQPNLLELENQLERFDGENTSFKTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRM--------RDKLKKFKVKTKANKECLLSL---MKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYD-----GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNG 468          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 91.2781 bits (225), Expect = 1.652e-19
Identity = 102/464 (21.98%), Postives = 193/464 (41.59%), Query Frame = 3
Query:  132 SDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQ--NCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLN--------ESNYCHSNLLIA-MINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEI--ELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQ----ANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQR------RNEMIYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            +D  I ++  C  C+ ++  A    CG R+CS CI   LS      P + + C   +     +   D   +  I ++ V C  Q   C  + EL   + H   C+  PISC     G    +++  ++  HL           +YC   +++A M  +  +   S      +  + + R+E      TR+        L   +  ++  + + +     +K  Q+   I     N  Q M   E  + E  G++   + N E     +E   + +       A++++R ++ R+ +  Q+  D +++   Q +L       +NL +      +  +Q T     LL      W+I  ++ +R      R    YS  F++GP GYKMC  +++ GD    N  + + F ++RG+FD  L WPF+ +V + ++D    N+ H       D P  + +++P ++ N
Sbjct:   14 TDTAIAAKHLCAKCRLIVKDAVQTACGHRYCSPCISPLLSRG----PIQCDVCGSTITK--PETFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECG---KKLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKEHHEKTCPSYPVNCPKCSKELIRVEVHSTPFTREPR------LEKGRGCENTLEVLEDHESRIKKLEQRGGGI---GVNGLQSMRISENIDNEAIGDVLRRVANVEAKGADHEVLVVEAH-----SAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLL------WKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLD--QDNVEHVIDAFRPD-PSSSSFQRPRAEMN 445          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 90.8929 bits (224), Expect = 2.734e-19
Identity = 103/516 (19.96%), Postives = 195/516 (37.79%), Query Frame = 3
Query:  159 KCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAE----------------------YCQVQMIN--FINDA--TEDHPINL--------------RISKVIVKCPRQNCEIKTE----------LIKMEEHMNNCDKRPISCP----------------------------FNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQR------RNEMIYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            +C +C   +      PCG RFC  C+E  L    K CP + E                      YC  + +   ++ D    E+H  N               +++K  ++   + CE K               ME+H+  C+K P+ CP                            F   GC       + +  H  +    H NLL+    N  +    M            ++   E E  ++ E + ++  A+   NQ+LR            ++ +++ IE   A  ++++ E++ R Q    E  +  ++  +   E  +      ++        M +ER            +Q+  + QL A  ++++ +   +++ +++T  Y+     G + W+ID+ + +       +   IYS PFY G +GYK C  V+  GD       + + F L+RG+FD  L WPF+ +V   ++D    + +H     +   P  + +++P S+ N
Sbjct:   20 RCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSK-CPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGT-REALETHFRDQASVHVNLLLTATQNEEKARSEMA----------AKLSQMEKERAKQQEQMYEQREALAVANQNLR-----------TYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALER------------RQDRNEHQL-ALHDIQLAEHDLKLQMLEAT-SYD-----GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ---DRVHDIGDTFRPDPTSSSFKRPTSNMN 490          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 82.0333 bits (201), Expect = 1.864e-16
Identity = 101/463 (21.81%), Postives = 192/463 (41.47%), Query Frame = 3
Query:  135 DNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCP------GEAE-----YCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHL--NESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGR-MEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIEL-QSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGDNGD----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDC--PDDAGWRKPASDRN 1442
            D  + S+ +C IC   +      PCG RFC +CI + +      CP       E E     + + +M++FI        +  R+ K       + C  K  L ++EEH+  C     +CP N  G  +     D+  A    N S  C    +   I+ +   ++     +       G  M+ KE++        N+ +       +S +++ +   +E+     ++    L QSAN+Q+              E+++L        +EYR   + +E           ++E ++ +S ++   L           +K + +E      R+I+     E  + +G F W++D   + R   +      I+S PFY+  +GYKMCL + + G +G     + +  H+++GD+D  LEWPF   + + ++D ++  I   R +  +    P+   +++P S RN
Sbjct:   49 DPPLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSERELYRDNFAKREMMSFI--------VWCRLKK------ERGCTWKGALKELEEHLKGCPCMDTNCP-NECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKVTISKIEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKSSKEQASHGPQEHTPHEAELRREALFQSANMQR--------------EVDMLGSR----GDEYRQFLAYLER----------KVEDVKTSSDRRIAEL----------THKLMRLE-----TREIE----LEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSD-QIDSRRPISETLVAKPNLLAFQRPTSPRN 448          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 72.0182 bits (175), Expect = 2.866e-13
Identity = 103/453 (22.74%), Postives = 185/453 (40.84%), Query Frame = 3
Query:  153 ELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKF-CPGEAEYCQVQMINFINDATEDHPINLRI-----------------------SKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNA-HLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKEL--ENTRKIENLNKEILAVKKNNQSLR-DEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDA 1412
            EL C IC  ++ +     CG  +C  CIE++ +  +   CP + E  +   I F +  T+   ++L +                       S   VKC  + C +K   I ME+H N C  R + C      C ++    DE    H ++          + I    +  ES  +E+ E   +     A E   +N  +I +L+KE+  V++  Q+   D M E++    K  + I                     ++N G+IE L++E  +  N       Q++T  +   ++ +  E I  N  Q +  L   C+ Q         +    ++ ++  + F     +K G  + + D IS     +++ S PFY+  +GYKM L  +  G  GD     + +   +++G++D  LEWPF+ ++ + +I+ +       RS      PDDA
Sbjct:   27 ELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPSQI-FPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCILEGCNVKVPRILMEKHTNTCGWRLLHCK----PCNLSYPKKDEETVQHKDDCPLAFLPCRFSEIGCTFKGRESARDEHCESAVQTHLHIACETIRDNKEQISDLHKELDKVRQELQTKSCDHMKEVNAIREKHDEAI---------------------RDNKGQIEALSKEHGIASNTIHENKEQLDTLKK---ELGIASETIRKNRDQIA-KLSTACKTQYTDGTFVWRICNYKDKYKKAVA-FATNQEVKGGNSDSD-DDIS--MAGDIMVSLPFYTSRYGYKMRLKAYPNG-YGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSE----QWRSETVEIYPDDA 440          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 88.5817 bits (218), Expect = 5.070e-18
Identity = 90/371 (24.26%), Postives = 167/371 (45.01%), Query Frame = 3
Query:  411 KMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMEL-RQRMGRMEAKELENTRKIENLNKEILAVKKN--NQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAIN-QIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGDNGD----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANG-NIIHSRSVKYSDCPDDAGWRKPASDRN-DPICIYYNPIS 1475
            K  +H+  C K    C F+  GC  + V  ++++ H  + +Y H NLL+  I  +   +ES+  + +E+  Q++  +     +   ++  L +   A  +     +L    T L             +ELQ  + + K+ E+  R QE   ++      + +L  E     + ME    A N Q R+  ++IEI     S+ ++Q      L+    +EME    ++    S   Y+     G F W+I   +++R++ M      ++S  FY+  +GYKMCL +++ GD       + + F ++RG  D  L+WPF  +V + ++D  N  +II +     S     + +++P SD N    C  + P+S
Sbjct:  202 KYVDHIKFCSKFKAPCRFHVVGCDTS-VEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQKLHELHQSLRDLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGA------ALELQLQSEKTKVAELSRRCQELELKVSTFENIVCILNRELERSCATME----AYNRQHRLDQDKIEI----LSNKVRQLERTVSLRDLSIVEMEGKMKDM----SAATYD-----GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDIS----SSSFQRPVSDMNIASGCPLFCPLS 544          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 81.6481 bits (200), Expect = 7.336e-16
Identity = 91/411 (22.14%), Postives = 165/411 (40.15%), Query Frame = 3
Query:  267 CPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFI------RGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRNDPICIYY 1463
            CP   E C   +  F     +DH +     +V V CP   C       ++ EH  +C +    C F  FGC++      ++  H  E+  CH  LL+   +    Q    + +   LRQ+  +       +T  + +L +++ +V + +   R +   ++   R   +Q D +     +LQQ    M +   E              L+    S+   M+    A   +R  I  +E N ++ S  L+ +  Q  L      E+E  + + R I                W+I    ++R  E       + S PF++G  GYKM +  ++      RG +  +YV   L+ GDFD  L WPFK  V++ V+D +     + +S  +   P +  + +PA++    + + +
Sbjct:  186 CPHRRESCPHCLQPFQLSVIQDH-VQSSCPEVKVGCP-DGCSTLVPRNRLTEHGESCPEVHTDCSFKMFGCSVKG-KRRKVKLH-EEAAVCHHVLLVLKSSAHLEQQVVFVQKEALLRQQEVQT------DTLLLSDLQEQLGSVLQQS---RSQEHIVATAQRTLSRQEDALSSVQLDLQQVSCGMGSGLDE--------------LRRFKTSLDGVMQ-ELLAAETLREHIATLEENRKRHSGLLELHVAQLALNKQHLQELELTSYDGRLI----------------WKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVV--LMPGDFDALLPWPFKQTVSLSVLDQSGAR--NHQSFNFRPDPTNTCFHQPAAESASNVAVGF 548          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 74.7146 bits (182), Expect = 1.107e-13
Identity = 106/507 (20.91%), Postives = 183/507 (36.09%), Query Frame = 3
Query:  129 ESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNC---------------------------DKRPISCP-------------------FNTFGCAINE--VASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENM-----ELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQ-----QKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNE------MIYSKPFYSGPFGYKMCLAVFIRGDNGD-----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            E D  + S+ +C IC   +  A    CG RFC  CIE+ +    + CP + E      +   N A  +      I  + V+CP  +C  K EL  +E+H+  C                            +RP+SCP                   F +  C   E  +  D+M +H +          IA   ++    E M   N+     E  Q   R  A+ L     +     + L ++    S RD+       N        +    SA+ Q     Q++ EM+AR  +   ++     E+++LK+          T A  + ++R ++  +E                   +  K LE ++                    G F W +   S   R++      + +S  FY+G  GYK+CL + ++          I +  H ++G FD+ L WPF+  + + ++D       H   ++    PD   ++KP + RN
Sbjct:   67 EFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDNEMLSEDQLFPDNFAKRE------ILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPCSQCQQPVRKSYLEEHATVECPRRPMSCPDCVAVFVYEEREMHEQQCPFASVMCQYCEMDLIRDQMESHCDTDC---PKAPIACTFSIFGCKERMQRHNLAQHMQEFTQMHMRYMAEFLRGL-ALNGTAPKPLHLQGGPVSCRDQGAAAPASNCSVAPGALSCSNSSASCQPSEEMQRIREMDARLVKQDHQLR----ELIILKD----------TQAGQLAELRRRVSVLE-------------------ETVKELEAQQ------------------YHGIFIWRLKAFSTHLRSQEAGIPVVEHSPGFYTGRPGYKLCLRLHLQTPTAPRCSNFISLFVHTMQGVFDSQLTWPFQGTIRLAILDQGPEGQHHMEVMETK--PDLQAFQKPINQRN 510          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 69.707 bits (169), Expect = 3.007e-12
Identity = 46/193 (23.83%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  903 RSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKS---GFFEWEIDKISEQRRNEM------IYSKPFYSGPFGYKMCLAVFIRGD----NGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRN 1442
            R +  +ME+    ++ +R ++  +E   +   +           Q N++ +M    +EIR       ++ L  +   G   W+I     ++++ +      +YS+PFY+G FGYKMC  V++ GD       + + F ++RG++D  L WPFK +V + ++D          + K    P  + +R+P ++ N
Sbjct:  232 RQLRDEMESLRGTLDTVRTRLSALEQGGRASLET----------QLNRHDDMLS-VHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPD--PSSSSFRRPVAEMN 411          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 68.5514 bits (166), Expect = 1.203e-11
Identity = 78/379 (20.58%), Postives = 160/379 (42.22%), Query Frame = 3
Query:  456 CPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENME--------LRQRMGRMEAK--ELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKS---------------GFFEWEIDKISEQR------RNEMIYSKPFYSGPFGYKMCLAVFIRGDNGD----IYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANG-NIIHSRSVKYSDCPD--DAGWRKPASDRN-DPICIYYNPIS 1475
            C F+  GC ++ V  ++++ H     Y H NLL+  I  +   ME +  + +E        L++ +  +EA+  +L  T     +     +   ++         +            ++      L   +G         A E++L +E+  V   E     +++E  +     +   + R     ++ +  ++ +  Q +L  +K   +E  +N++RQ++ T G ++L  +               G F W I   +++R      R   ++S  FY+  +GYKMCL +++ GD       + + F ++RG  D  L+WPF  +V + ++D +N  +II +        PD   + +++P S+ N    C  + P+S
Sbjct:  216 CRFHVVGCDMS-VEKEKIHDHERAFAYEHLNLLLHYIMGMKVSMEGLQPQGLETAGHKLVELQKSLRDLEARVSQLSTTSSGPPVQGAAASSSSSSSGPPGPPASVPLPPPPTLPPTLSVSTSFTPLPSSVGA--------ALELQLHSEKTKV--AELGRRCTELEVKSGTFENVVCVLNR---EVERFTTTMEASNRQHKLDQDK---IEALSNKVRQLERTVGLKDLTVAEMEGRLREMAATTFDGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIIDAFR------PDVTSSSFQRPVSEMNIASGCPLFCPLS 571          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000049812.1 (SMESG000049812.1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 415/465 (89.25%), Postives = 435/465 (93.55%), Query Frame = 3
Query:   87 MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKN--LEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRNDPICIYYNPIS 1475
            MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLS NDKFCPG+A +CQVQ +NF  + +EDHPI+LRISKVIVKCPRQNCE KTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNES+YCHSNLLIAMINNLN QMESMMNENMEL+QRM RMEAKE +NT KIE+LN  ILAVKKNNQSLRDEMTELSKENRKF+QQIDTIELQSA+LQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQ+LQANKN  LEMEKCANEIRQIQSTFGYEN LKSGFFEWEIDKIS+Q+R+  IYSKPFYSGPFGYKMCLAV I GD+  I V F+L+R DFDNNLEWPFKY VA+DVIDSANGNII SRSVKYSDCPDD GWRKP SDRNDPICIYYN IS
Sbjct:    1 MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSKNDKFCPGQARFCQVQKVNFTRNVSEDHPISLRISKVIVKCPRQNCETKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESSYCHSNLLIAMINNLNSQMESMMNENMELKQRMRRMEAKERKNTAKIEDLNNVILAVKKNNQSLRDEMTELSKENRKFKQQIDTIELQSADLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQRLQANKNFQLEMEKCANEIRQIQSTFGYENFLKSGFFEWEIDKISKQKRDNRIYSKPFYSGPFGYKMCLAVIIGGDDY-IAVGFNLMRSDFDNNLEWPFKYSVAIDVIDSANGNIIDSRSVKYSDCPDDVGWRKPTSDRNDPICIYYNSIS 464          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000049812.1 (SMESG000049812.1)

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 408/458 (89.08%), Postives = 428/458 (93.45%), Query Frame = 3
Query:  108 MMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKN--LEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRNDPICIYYNPIS 1475
            MMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLS NDKFCPG+A +CQVQ +NF  + +EDHPI+LRISKVIVKCPRQNCE KTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNES+YCHSNLLIAMINNLN QMESMMNENMEL+QRM RMEAKE +NT KIE+LN  ILAVKKNNQSLRDEMTELSKENRKF+QQIDTIELQSA+LQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQ+LQANKN  LEMEKCANEIRQIQSTFGYEN LKSGFFEWEIDKIS+Q+R+  IYSKPFYSGPFGYKMCLAV I GD+  I V F+L+R DFDNNLEWPFKY VA+DVIDSANGNII SRSVKYSDCPDD GWRKP SDRNDPICIYYN IS
Sbjct:    1 MMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSKNDKFCPGQARFCQVQKVNFTRNVSEDHPISLRISKVIVKCPRQNCETKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESSYCHSNLLIAMINNLNSQMESMMNENMELKQRMRRMEAKERKNTAKIEDLNNVILAVKKNNQSLRDEMTELSKENRKFKQQIDTIELQSADLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQRLQANKNFQLEMEKCANEIRQIQSTFGYENFLKSGFFEWEIDKISKQKRDNRIYSKPFYSGPFGYKMCLAVIIGGDDY-IAVGFNLMRSDFDNNLEWPFKYSVAIDVIDSANGNIIDSRSVKYSDCPDDVGWRKPTSDRNDPICIYYNSIS 457          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000049805.1 (SMESG000049805.1)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 408/467 (87.37%), Postives = 432/467 (92.51%), Query Frame = 3
Query:   87 MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRNDPICIYY----NPIS 1475
            MFTNLWKMMREN+F SDNEI SELKCRICKCLMIKACNAPCGCRFCS+CIEQYLS N+KFCPG+AEYCQVQMINF  +  ED   NLRISKVIVKCPRQNCEIKT+LIKMEEHMNNCDKRPISCPFNTFGC INEVASDEMNAHLNESNYCHSNLLIAMINNLN QMESMMNENM+LRQRMG +EAKE++NT KIE+LNK+ILAVKKNNQ+L+DEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEE++VLKN+Y+SMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQN EQQQLQANKNLEMEKCANEIRQIQS  GYENLLK GFFEWEIDKISE RR+E IYSKPFYSGP GYKMCLAVFI GD   I V+FHL+RGDFDNNLEWPFKY VA+DVIDSANGNII SR+VKYSD PD  GWRKPASD+NDPICIYY    NPIS
Sbjct:    1 MFTNLWKMMRENKFRSDNEISSELKCRICKCLMIKACNAPCGCRFCSNCIEQYLSGNNKFCPGQAEYCQVQMINFTKNILEDQTANLRISKVIVKCPRQNCEIKTKLIKMEEHMNNCDKRPISCPFNTFGCEINEVASDEMNAHLNESNYCHSNLLIAMINNLNSQMESMMNENMKLRQRMGHIEAKEMKNTAKIEDLNKKILAVKKNNQTLKDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEILVLKNDYQSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNFEQQQLQANKNLEMEKCANEIRQIQSIIGYENLLKPGFFEWEIDKISELRRDEWIYSKPFYSGPLGYKMCLAVFIWGDY--IAVNFHLMRGDFDNNLEWPFKYSVAIDVIDSANGNIIDSRAVKYSDRPDAVGWRKPASDKNDPICIYYPIYNNPIS 465          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000049805.1 (SMESG000049805.1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 408/469 (86.99%), Postives = 432/469 (92.11%), Query Frame = 3
Query:   87 MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANKN--LEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRNDPICIYY----NPIS 1475
            MFTNLWKMMREN+F SDNEI SELKCRICKCLMIKACNAPCGCRFCS+CIEQYLS N+KFCPG+AEYCQVQMINF  +  ED   NLRISKVIVKCPRQNCEIKT+LIKMEEHMNNCDKRPISCPFNTFGC INEVASDEMNAHLNESNYCHSNLLIAMINNLN QMESMMNENM+LRQRMG +EAKE++NT KIE+LNK+ILAVKKNNQ+L+DEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEE++VLKN+Y+SMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQN EQQQLQANKN  LEMEKCANEIRQIQS  GYENLLK GFFEWEIDKISE RR+E IYSKPFYSGP GYKMCLAVFI GD   I V+FHL+RGDFDNNLEWPFKY VA+DVIDSANGNII SR+VKYSD PD  GWRKPASD+NDPICIYY    NPIS
Sbjct:    1 MFTNLWKMMRENKFRSDNEISSELKCRICKCLMIKACNAPCGCRFCSNCIEQYLSGNNKFCPGQAEYCQVQMINFTKNILEDQTANLRISKVIVKCPRQNCEIKTKLIKMEEHMNNCDKRPISCPFNTFGCEINEVASDEMNAHLNESNYCHSNLLIAMINNLNSQMESMMNENMKLRQRMGHIEAKEMKNTAKIEDLNKKILAVKKNNQTLKDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEILVLKNDYQSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNFEQQQLQANKNFQLEMEKCANEIRQIQSIIGYENLLKPGFFEWEIDKISELRRDEWIYSKPFYSGPLGYKMCLAVFIWGDY--IAVNFHLMRGDFDNNLEWPFKYSVAIDVIDSANGNIIDSRAVKYSDRPDAVGWRKPASDKNDPICIYYPIYNNPIS 467          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000049832.1 (SMESG000049832.1)

HSP 1 Score: 826.239 bits (2133), Expect = 0.000e+0
Identity = 405/460 (88.04%), Postives = 427/460 (92.83%), Query Frame = 3
Query:   87 MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNYCHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNKEILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCEQQQLQANK--NLEMEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFHLIRGDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASDRNDPICIY 1460
            MFTNLWKMMREN+FESDNEI SELKCRICKCLMIKACNAPCGCRFCSDCIEQYL  +DKFCPGEAEYCQ QMINF  + +EDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKR IS PFNTFGCAINEVASDEMNAHLNESNYCHS LLIAMINNLNRQMESMMNENM+LRQRMG MEA E++NT+ IE+LN  I+AV+KNNQSLRDEMTELSKENRKF+QQIDTIEL SANL+Q MGEMEAREQENAGEIELLNEEMVVLKNE RSMSSQMETN EAI+QIRMQIERIEIN QQQ+DALKQNCEQQQLQANK  NLE+EKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRR+E IYSKPFYSGPF YKM LAV IRGD GDIYV+FHL+RGDFDNNLEWPFKY +AVDVI+SANGNIIHSRSVKYSD PD+AGWRKPA DRN  I IY
Sbjct:    1 MFTNLWKMMRENKFESDNEISSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLRKDDKFCPGEAEYCQFQMINFTRNVSEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRLISYPFNTFGCAINEVASDEMNAHLNESNYCHSKLLIAMINNLNRQMESMMNENMKLRQRMGHMEANEMKNTKNIEDLNNAIVAVEKNNQSLRDEMTELSKENRKFKQQIDTIELHSANLKQNMGEMEAREQENAGEIELLNEEMVVLKNESRSMSSQMETNVEAIHQIRMQIERIEINLQQQNDALKQNCEQQQLQANKNFNLEIEKCANEIRQIQSTFGYENLLKSGFFEWEIDKISEQRRSEWIYSKPFYSGPFAYKMILAVNIRGD-GDIYVNFHLMRGDFDNNLEWPFKYSIAVDVINSANGNIIHSRSVKYSDRPDNAGWRKPAHDRNSAIYIY 459          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF32.027e-2324.69TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.027e-2324.69TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.069e-1722.35TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.069e-1722.35TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.813e-1522.06TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-12.936e-937.80TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-23.181e-628.41TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf31.182e-2023.06TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf62.379e-1622.10TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf62.379e-1622.10TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf62.379e-1622.10TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf2a2.462e-1625.00Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh22.396e-1923.26slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh29.564e-1621.29slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf1.841e-1420.74epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
slc12a13.278e-1221.09solute carrier family 12 member 1 [Source:Xenbase;... [more]
TRAF21.862e-1121.07TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf33.122e-2324.49TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.548e-1822.55TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.548e-1822.55TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf66.417e-1420.82TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf51.522e-1320.60TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13114|TRAF3_HUMAN9.736e-2324.69TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE2.184e-2224.49TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q6DJN2|TRF6B_XENLA1.302e-1621.68TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|B6CJY4|TRAF6_CERAT1.186e-1521.06TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU1.207e-1521.06TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1013.175e-3626.01TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID83.051e-2832.37TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
A0A2K6N2X04.921e-2524.28TNF receptor-associated factor OS=Rhinopithecus bi... [more]
A0A553N2K71.769e-2223.66TNF receptor-associated factor OS=Danionella trans... [more]
A0A0P7UB074.804e-2224.12TNF receptor-associated factor 3-like (Fragment) O... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a1.792e-1725.20TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf61.632e-1521.49TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf58.488e-1523.04TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf11.750e-1422.03TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf18.082e-1423.09TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.11.903e-2422.54pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.13.959e-1721.81pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf63.606e-1123.53TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352372.838e-2023.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.652e-1921.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494642.734e-1919.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487731.864e-1621.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483942.866e-1322.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.25.070e-1824.26TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000001369.27.336e-1622.14TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf61.107e-1320.91TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf33.007e-1223.83TNF receptor associated factor 3 [Source:NCBI gene... [more]
unm_sa8081.203e-1120.58TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049812.10.000e+089.25SMESG000049812.1[more]
SMESG000049812.10.000e+089.08SMESG000049812.1[more]
SMESG000049805.10.000e+087.37SMESG000049805.1[more]
SMESG000049805.10.000e+086.99SMESG000049805.1[more]
SMESG000049832.10.000e+088.04SMESG000049832.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033139 ID=SMED30033139|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1906bp
TTCAAATTTATGGAAAATTTTAAATAAAACATTTCTTTATCTACATCAAA
ATATAAATTGTGTAAACTTGAAATTATAAAGACAAAATGTTTACAAACTT
ATGGAAAATGATGAGAGAAAATCAATTTGAGTCTGATAATGAAATCTGCA
GTGAATTGAAATGCAGAATTTGCAAATGCTTAATGATAAAAGCTTGCAAT
GCTCCTTGCGGTTGTCGTTTTTGTTCCGATTGCATTGAGCAATATTTGAG
TACAAATGATAAATTCTGTCCAGGAGAGGCAGAATATTGTCAAGTTCAAA
TGATTAATTTCATTAATGATGCAACTGAAGATCATCCAATCAATTTAAGG
ATATCAAAAGTTATTGTGAAATGCCCAAGGCAAAATTGTGAAATCAAAAC
CGAGCTGATCAAGATGGAGGAGCACATGAATAACTGCGACAAGCGGCCAA
TCAGCTGCCCATTCAATACGTTTGGATGTGCAATAAATGAGGTGGCAAGT
GACGAAATGAATGCCCATCTCAATGAGAGCAATTATTGCCATAGCAACTT
GCTGATTGCTATGATCAATAATTTGAACCGTCAGATGGAATCAATGATGA
ATGAAAATATGGAATTGAGGCAGAGAATGGGCCGCATGGAAGCGAAAGAG
CTGGAAAATACCCGAAAAATTGAGAATTTGAATAAGGAAATTCTTGCAGT
GAAAAAGAATAATCAATCATTGAGAGATGAAATGACCGAATTGAGCAAGG
AAAACCGCAAATTCAGACAACAAATTGATACTATCGAGTTGCAGTCAGCA
AATCTACAGCAGAAAATGGGCGAGATGGAAGCGAGAGAGCAGGAAAATGC
AGGAGAGATAGAACTATTAAACGAAGAAATGGTTGTACTGAAGAACGAGT
ATCGGTCAATGAGCAGCCAGATGGAGACCAATGCTGAGGCAATCAATCAG
ATCCGGATGCAGATCGAGAGGATTGAGATCAATTCACAACAGCAAAGTGA
TGCATTGAAACAAAACTGTGAGCAGCAGCAACTGCAAGCCAATAAAAATC
TGGAAATGGAGAAATGCGCCAATGAAATTCGGCAGATTCAATCAACATTT
GGATATGAAAATTTATTGAAATCTGGATTTTTTGAATGGGAAATCGATAA
AATATCAGAACAAAGGAGAAATGAAATGATTTACAGCAAGCCATTTTATT
CCGGGCCATTCGGGTACAAAATGTGCTTGGCGGTGTTTATTAGGGGTGAT
AATGGTGATATTTATGTTGATTTCCATTTGATACGGGGCGATTTCGATAA
CAATTTGGAATGGCCATTCAAATATGAAGTGGCAGTTGATGTGATCGATT
CAGCAAATGGAAACATTATTCACAGCAGATCAGTAAAATATTCTGATTGC
CCTGATGATGCCGGATGGAGGAAGCCAGCAAGTGACAGAAATGATCCAAT
TTGCATTTATTATAATCCGATTTCAATCAAATCAGCAGCAAAAAATAATA
AATTGCTGCTAAAGTGTAAAATCGAAAAATTGTGACAAATTTGAACAAAA
AATTCATTTGCTAAATAAATTTCCGATTTTAAATTTATGGAAAGCGCCGG
TTTTGATAGGAGGGGAAATCTCTCAGTTGCCCTTAGCAACAGGATCAGAA
ATAGTAAAAATGTGAAAATTATTATTAATATTTACTTTTTTGAGTTTAAA
ACATTATAAAAATCAACAAATAAACCTCCGATTTAGCAGCAGCTGGCGCA
TCGATTTCACTCGTTCCGAACTTTGATTGGAATTTTGTCATAACTTGCGA
TTTGTATTTTTCTCAAAAAATTCACTTTTCATTATCCCGATTTGATATCG
CATTTTGTGATTTTCTATAATTTCATTATATTTTCTTTTAATAAAATCTC
AATTTA
back to top

protein sequence of SMED30033139-orf-1

>SMED30033139-orf-1 ID=SMED30033139-orf-1|Name=SMED30033139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCI
EQYLSTNDKFCPGEAEYCQVQMINFINDATEDHPINLRISKVIVKCPRQN
CEIKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESNY
CHSNLLIAMINNLNRQMESMMNENMELRQRMGRMEAKELENTRKIENLNK
EILAVKKNNQSLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAR
EQENAGEIELLNEEMVVLKNEYRSMSSQMETNAEAINQIRMQIERIEINS
QQQSDALKQNCEQQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFE
WEIDKISEQRRNEMIYSKPFYSGPFGYKMCLAVFIRGDNGDIYVDFHLIR
GDFDNNLEWPFKYEVAVDVIDSANGNIIHSRSVKYSDCPDDAGWRKPASD
RNDPICIYYNPISIKSAAKNNKLLLKCKIEKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0016567protein ubiquitination
GO:0006955immune response
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR001293Znf_TRAF
IPR013323SIAH-type
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 15..35
NoneNo IPR availableCOILSCoilCoilcoord: 221..238
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 30..205
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 54..236
e-value: 4.2E-27
score: 97.0
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 103..203
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 30..205