RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)

Overview
NameRMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)
Smed IDSMED30033131
Length (bp)1728
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) (SMED30033131) t-SNE clustered cells

Violin plots show distribution of expression levels for RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) (SMED30033131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) (SMED30033131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) (SMED30033131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033131h1SMcG0015397 SmedASXL_009929SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033131h1SMcG0015397 SmedASXL_009929SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Human
Match: RMI1 (RecQ mediated genome instability 1 [Source:HGNC Symbol;Acc:HGNC:25764])

HSP 1 Score: 90.8929 bits (224), Expect = 6.596e-19
Identity = 60/191 (31.41%), Postives = 91/191 (47.64%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVME-----FNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EACI W+ +E+ N   ++S  +    + +QWL +DLRDLE P    + D ++E      NG    Q+     VSQ  Y Q++ L G    N  V A  +       AK             L+L LTDGI   +G EY+   +  + +  G K  + G  + R  + LL  +N++ LGGEV+ L
Sbjct:   21 KVPPMWLEACINWIQEENNN--VNLSQAQMNKQVFEQWLLTDLRDLEHP---LLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSR---------MLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDAL 197          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Human
Match: RMI1 (RecQ mediated genome instability 1 [Source:HGNC Symbol;Acc:HGNC:25764])

HSP 1 Score: 90.8929 bits (224), Expect = 1.625e-18
Identity = 60/191 (31.41%), Postives = 91/191 (47.64%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVME-----FNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EACI W+ +E+ N   ++S  +    + +QWL +DLRDLE P    + D ++E      NG    Q+     VSQ  Y Q++ L G    N  V A  +       AK             L+L LTDGI   +G EY+   +  + +  G K  + G  + R  + LL  +N++ LGGEV+ L
Sbjct:   21 KVPPMWLEACINWIQEENNN--VNLSQAQMNKQVFEQWLLTDLRDLEHP---LLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSR---------MLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDAL 197          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Zebrafish
Match: rmi1 (RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) [Source:NCBI gene;Acc:393149])

HSP 1 Score: 93.9745 bits (232), Expect = 6.926e-20
Identity = 64/189 (33.86%), Postives = 90/189 (47.62%), Query Frame = 3
Query:   81 FQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLF-TISDNVMEFNGVMCC-QVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
             Q P  W++AC+ W+ +E     +S+   +    + +QWL +DLRDL  P L   IS+         CC Q+     VSQ  Y Q++ + GT   N  V A  +       AK             L+L LTDG+ N EG EYR     +  +  G K +L GP  +R  + LL  +NI+ LGGEVE L
Sbjct:   19 IQVPPAWLDACVNWIKEEVDR--ASIPQSQLNQRVLEQWLLTDLRDLAHPVLPERISEAQKTVLSNRCCVQMDSLLDVSQPAYNQLQRIRGTDCSNDQVSAVTQETQRPWEAKPTR---------MLMLQLTDGVQNLEGMEYRPIPALNANLPPGTKLQLVGPIAVRLGVLLLKAENIKVLGGEVEQL 196          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Zebrafish
Match: rmi1 (RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) [Source:NCBI gene;Acc:393149])

HSP 1 Score: 93.9745 bits (232), Expect = 6.926e-20
Identity = 64/189 (33.86%), Postives = 90/189 (47.62%), Query Frame = 3
Query:   81 FQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLF-TISDNVMEFNGVMCC-QVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
             Q P  W++AC+ W+ +E     +S+   +    + +QWL +DLRDL  P L   IS+         CC Q+     VSQ  Y Q++ + GT   N  V A  +       AK             L+L LTDG+ N EG EYR     +  +  G K +L GP  +R  + LL  +NI+ LGGEVE L
Sbjct:   19 IQVPPAWLDACVNWIKEEVDR--ASIPQSQLNQRVLEQWLLTDLRDLAHPVLPERISEAQKTVLSNRCCVQMDSLLDVSQPAYNQLQRIRGTDCSNDQVSAVTQETQRPWEAKPTR---------MLMLQLTDGVQNLEGMEYRPIPALNANLPPGTKLQLVGPIAVRLGVLLLKAENIKVLGGEVEQL 196          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Xenopus
Match: rmi1 (RecQ mediated genome instability 1 [Source:NCBI gene;Acc:549050])

HSP 1 Score: 88.9669 bits (219), Expect = 4.042e-18
Identity = 64/188 (34.04%), Postives = 92/188 (48.94%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNL-FTISDNV-MEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EACI W+ +E  N  SS+   +    + +QWL +DLRDLE   L   +SD++  E NG    Q+     VSQ  Y Q + L G  + N  V  T + +     AK             L+L LTDG  + +G EYR   + +  +  G K  L+G    R  + LL  +N++ LGGEVE L
Sbjct:   21 KVPNPWLEACINWIQEE--NNGSSLLQAEINKQVFEQWLLTDLRDLEFSVLPANLSDSLKFELNGFYAIQIDSLVDVSQPAYSQHQKLKGKDSTNEQVTCTTQISQKPWEAKPTR---------MLMLQLTDGTQHIQGMEYRPIQVLNANLSPGTKMLLQGSIVCRLGVLLLKPENVKVLGGEVEAL 197          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Mouse
Match: Rmi1 (RecQ mediated genome instability 1 [Source:MGI Symbol;Acc:MGI:1921636])

HSP 1 Score: 92.0485 bits (227), Expect = 4.951e-19
Identity = 61/192 (31.77%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEF-----NGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDLT 644
            + P  W+EAC+ W+ +E+ N  +++S  +    + +QWL +DLRDLE P    + D+++E      NG    Q+     VSQ  Y Q++ L G    N  V A      T +T K   EV        L+L LTDG+ + +G EY+      + +  G K  ++G    R  + LL  +N++ LGGEV+ L+
Sbjct:   21 KVPPMWLEACVNWIQEENNN--ATLSQAQINKQVLEQWLLTDLRDLEHP---LLPDDILELPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVSAE-----TQSTPKPW-EV---RPSRMLMLQLTDGVTHIQGMEYQSIPALHSGLPPGTKILVRGCILFRLGVLLLKPENVKVLGGEVDGLS 198          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Mouse
Match: Rmi1 (RecQ mediated genome instability 1 [Source:MGI Symbol;Acc:MGI:1921636])

HSP 1 Score: 92.0485 bits (227), Expect = 4.951e-19
Identity = 61/192 (31.77%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEF-----NGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDLT 644
            + P  W+EAC+ W+ +E+ N  +++S  +    + +QWL +DLRDLE P    + D+++E      NG    Q+     VSQ  Y Q++ L G    N  V A      T +T K   EV        L+L LTDG+ + +G EY+      + +  G K  ++G    R  + LL  +N++ LGGEV+ L+
Sbjct:   21 KVPPMWLEACVNWIQEENNN--ATLSQAQINKQVLEQWLLTDLRDLEHP---LLPDDILELPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVSAE-----TQSTPKPW-EV---RPSRMLMLQLTDGVTHIQGMEYQSIPALHSGLPPGTKILVRGCILFRLGVLLLKPENVKVLGGEVDGLS 198          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Mouse
Match: Rmi1 (RecQ mediated genome instability 1 [Source:MGI Symbol;Acc:MGI:1921636])

HSP 1 Score: 92.0485 bits (227), Expect = 4.951e-19
Identity = 61/192 (31.77%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEF-----NGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDLT 644
            + P  W+EAC+ W+ +E+ N  +++S  +    + +QWL +DLRDLE P    + D+++E      NG    Q+     VSQ  Y Q++ L G    N  V A      T +T K   EV        L+L LTDG+ + +G EY+      + +  G K  ++G    R  + LL  +N++ LGGEV+ L+
Sbjct:   21 KVPPMWLEACVNWIQEENNN--ATLSQAQINKQVLEQWLLTDLRDLEHP---LLPDDILELPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVSAE-----TQSTPKPW-EV---RPSRMLMLQLTDGVTHIQGMEYQSIPALHSGLPPGTKILVRGCILFRLGVLLLKPENVKVLGGEVDGLS 198          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Mouse
Match: Rmi1 (RecQ mediated genome instability 1 [Source:MGI Symbol;Acc:MGI:1921636])

HSP 1 Score: 92.0485 bits (227), Expect = 4.951e-19
Identity = 61/192 (31.77%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEF-----NGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDLT 644
            + P  W+EAC+ W+ +E+ N  +++S  +    + +QWL +DLRDLE P    + D+++E      NG    Q+     VSQ  Y Q++ L G    N  V A      T +T K   EV        L+L LTDG+ + +G EY+      + +  G K  ++G    R  + LL  +N++ LGGEV+ L+
Sbjct:   21 KVPPMWLEACVNWIQEENNN--ATLSQAQINKQVLEQWLLTDLRDLEHP---LLPDDILELPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVSAE-----TQSTPKPW-EV---RPSRMLMLQLTDGVTHIQGMEYQSIPALHSGLPPGTKILVRGCILFRLGVLLLKPENVKVLGGEVDGLS 198          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. UniProt/SwissProt
Match: sp|Q7ZVM9|RMI1_DANRE (RecQ-mediated genome instability protein 1 OS=Danio rerio OX=7955 GN=rmi1 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.446e-19
Identity = 64/189 (33.86%), Postives = 90/189 (47.62%), Query Frame = 3
Query:   81 FQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLF-TISDNVMEFNGVMCC-QVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
             Q P  W++AC+ W+ +E     +S+   +    + +QWL +DLRDL  P L   IS+         CC Q+     VSQ  Y Q++ + GT   N  V A  +       AK             L+L LTDG+ N EG EYR     +  +  G K +L GP  +R  + LL  +NI+ LGGEVE L
Sbjct:   19 IQVPPAWLDACVNWIKEEADR--ASIPQSQLNQRVLEQWLLTDLRDLAHPVLPERISEAQKTVLSNRCCVQMDSLLDVSQPAYNQLQRIRGTDCSNDQVSAVTQETQRPWEAKPTR---------MLMLQLTDGVQNLEGMEYRPIPALNANLPPGTKLQLVGPIAVRLGVLLLKAENIKVLGGEVEQL 196          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. UniProt/SwissProt
Match: sp|Q9D4G9|RMI1_MOUSE (RecQ-mediated genome instability protein 1 OS=Mus musculus OX=10090 GN=Rmi1 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.463e-18
Identity = 61/192 (31.77%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEF-----NGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDLT 644
            + P  W+EAC+ W+ +E+ N  +++S  +    + +QWL +DLRDLE P    + D+++E      NG    Q+     VSQ  Y Q++ L G    N  V A      T +T K   EV        L+L LTDG+ + +G EY+      + +  G K  ++G    R  + LL  +N++ LGGEV+ L+
Sbjct:   21 KVPPMWLEACVNWIQEENNN--ATLSQAQINKQVLEQWLLTDLRDLEHP---LLPDDILELPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVSAE-----TQSTPKPW-EV---RPSRMLMLQLTDGVTHIQGMEYQSIPALHSGLPPGTKILVRGCILFRLGVLLLKPENVKVLGGEVDGLS 198          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. UniProt/SwissProt
Match: sp|Q9H9A7|RMI1_HUMAN (RecQ-mediated genome instability protein 1 OS=Homo sapiens OX=9606 GN=RMI1 PE=1 SV=3)

HSP 1 Score: 90.8929 bits (224), Expect = 7.805e-18
Identity = 60/191 (31.41%), Postives = 91/191 (47.64%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVME-----FNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EACI W+ +E+ N   ++S  +    + +QWL +DLRDLE P    + D ++E      NG    Q+     VSQ  Y Q++ L G    N  V A  +       AK             L+L LTDGI   +G EY+   +  + +  G K  + G  + R  + LL  +N++ LGGEV+ L
Sbjct:   21 KVPPMWLEACINWIQEENNN--VNLSQAQMNKQVFEQWLLTDLRDLEHP---LLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSR---------MLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDAL 197          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. UniProt/SwissProt
Match: sp|Q6DDH2|RMI1_XENLA (RecQ-mediated genome instability protein 1 OS=Xenopus laevis OX=8355 GN=rmi1 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.845e-16
Identity = 60/188 (31.91%), Postives = 91/188 (48.40%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNL-FTISDNVM-EFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EACI W+ +E+ + +     +K    + +QWL +DLRDLE P L   I+D++  E NG    Q+     +S   Y Q++ L G  + N  V  T + +     AK             L+L LTDG  + +  EYR     +  +  G K  L+G    R  + LL  +N++ LGGEVE L
Sbjct:   22 KVPDPWLEACINWIQEENGSSLLQAEINKQ---VFEQWLLTDLRDLEFPVLPANITDSLKCELNGFHAVQMDSLVDISLPAYSQLQKLKGKDSTNEQVTCTTQQSQKPWEAKPTR---------MLMLQLTDGTQHIQAMEYRPIQALNANLSPGTKMVLQGTIVCRLGVLLLKPENVKVLGGEVEAL 197          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. UniProt/SwissProt
Match: sp|Q5ZHV8|RMI1_CHICK (RecQ-mediated genome instability protein 1 OS=Gallus gallus OX=9031 GN=RMI1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.751e-16
Identity = 58/191 (30.37%), Postives = 90/191 (47.12%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVM-----EFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EACI W+ +E  N   ++S  +    + +QWL +DLRDLE P    + D ++     E +G    Q+     VSQ  Y Q++ + G    N  V A  +       AK             L+L LTDGI+  +G EY+   +  + +  G K  + G    R  + LL  +N++ LGGEV+ L
Sbjct:   21 KVPLTWLEACINWIQEE--NGGGNLSQAQISRQVFEQWLLTDLRDLEYP---ILPDGILDAPKGELSGFYSLQIDSLLDVSQPAYSQLQKIRGKSTVNEEVTANTQAFQKPWEAKPTR---------MLMLQLTDGIHQIQGMEYQPVPVLHSNLPPGTKITVHGNVAYRLGVLLLKPENVKLLGGEVDAL 197          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. TrEMBL
Match: A0A4Y2GLG4 (RecQ-mediated genome instability protein 1 OS=Araneus ventricosus OX=182803 GN=rmi1 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.252e-26
Identity = 147/566 (25.97%), Postives = 232/566 (40.99%), Query Frame = 3
Query:   99 WVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDL---ETPNLFTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDLTFCEVKFXXXXXXXXXXXXXXPTRINKSVVKIKAAKLENKESNRTIVNNSLDVKLHYLSEKYLEIKPKIEKFSPVIENFSNNKNNLQV-------PKTNVHSSADSGNINFIESFEGITQLSLSNWIKDSNALNSVPNDIPQLV-----DRF-DDEAEELLSSIPLNELTNEA----------DKEKSIKTETISFVKTDIKIENQSNSIEKPF------------DKSEPFVYLVDVFNELSQPDVEKILDKKFKIKGLIFTFASKLKIVEDIKKIYRWDLQIVLGDGTATVDCFLSDDFITKEIGFTANHFQEMKKSKSIENYKKSFIDFQAYIVKC-------NCGLFTLQICDGYDKLCVVDYQPIDEGTVKALQNRI 1661
            W+EAC+ +L +EH   +S  S   +   + QQWL +DL ++     P     +  V   NG    QV G R + +  Y Q+++L   VN N    A  E  +    +K             L+LNLTDG  + +G EY+  +  S  +  G K  ++GP   R  I LL    I+ LGGEVE                        TR+++  V  +A +L  ++ + ++ N+ L       +     + P         E+F +N N+          P+   H      N N  ES   I Q +L  + +  N   S   DIP +V     + F DDE ++ L    L+E+  E+          ++E  I  E    V+  +  +++    + PF            D+S+PF YL   F  L  P      D    +KG I T  SKL+   D      W L + + DGTA++D  + D  +   IG +A    +M+  ++ EN +K     +A I KC       NC L  ++   G  K C+V   P     V+ L+ R+
Sbjct:   26 WIEACVTFLKEEHNQTLSLQSLKNY---VYQQWLDADLEEIGVASLPQELARTQKVT-LNGCFALQVEGIRDIGRPAYSQLKELDKDVNTNAEFSAAPEPTLAPWESKPTR---------MLMLNLTDGCIHIQGMEYKPISTLSPNLPPGIKVLIQGPVDCRFGILLLTSDKIKILGGEVESKL---------------------TRLSRKAVLREALQLPPEDESESVANDDLSNADELPNSV---VNPSAYAPGGQYESFQSNTNSAVTMPPDNAGPRNQNHWREARNNRNTNESNRRI-QATLP-FSRQQNVFPSEVGDIPDMVNIDNLEAFEDDEFDQTLDYGALDEIEKESLNKSNENEVPNEEPDIWAEDEDMVQDMLAFQDEDPEFQFPFEGLSDERSASRVDESKPFTYL---FTPLQNPSS----DCTVTVKGFIITVLSKLECTVD----KGWSLMVKINDGTASLDVNIHDKVLENIIGISAPAMVKMQL-QAAENPEKRREVMEA-ISKCKKTLQNYNC-LMDVKFTPG-SKPCLVKAYPTSPLHVQQLRERV 537          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. TrEMBL
Match: A0A0S7HXG5 (RMI1 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=RMI1 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 6.769e-22
Identity = 68/189 (35.98%), Postives = 91/189 (48.15%), Query Frame = 3
Query:   81 FQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNL--FTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
             Q P  W+EAC+EW+ Q    E   +S  +    +  QWL +DLRDL+ P L          E NG  C QV     VSQ  YGQ++   GT   N  V A      T TT +       +     LLL +TDG+ + E  EY+     S+A+  G K +L+G    R  + LL   N++ LGGEVEDL
Sbjct:   22 VQVPFAWLEACVEWI-QGETGEAVHLSQQQINQQVLDQWLLTDLRDLDHPVLPEGLAQAQKTELNGTFCVQVDSLLDVSQPAYGQLQKWRGTDCANDEVSA-----FTQTTQRPWEAKATR----ILLLQITDGVQSLEAMEYQSIPALSSALRPGAKLQLQGKMVCRLGVVLLGPSNVKILGGEVEDL 200          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. TrEMBL
Match: A0A3S2MW14 (DUF1767 domain-containing protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00088660 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 6.493e-21
Identity = 63/188 (33.51%), Postives = 93/188 (49.47%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNL--FTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EAC++W+ QE   E + +S  +   L+  QWL +DLRDL+ P L          + NG+ C QV  +  +SQ  YGQ++   GT   N  V A  +       AK+            +LL +TDG+ + E  EYR     S  +  G K +L+G    R  + LL   N++ LGGEVE+L
Sbjct:   19 RVPFAWLEACVQWI-QEEAGEAAHLSQQQVNQLVLDQWLLTDLRDLDFPVLPEGLAQAQKTQLNGIFCVQVDSFLDISQPAYGQLQKWRGTDCANDEVSAVTQATQRPWEAKTTR---------MMLLQVTDGVQSLEAMEYRPIPALSATLRPGAKLQLQGQMVCRLGVLLLGPSNVKILGGEVEEL 196          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. TrEMBL
Match: A0A3B3E126 (RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.188e-20
Identity = 64/188 (34.04%), Postives = 93/188 (49.47%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNL--FTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EAC++WL QE   E + +S  +   L+  QWL +DLRDL+ P L          + NG+ C QV  +  +SQ  YGQ++   GT   N  V A  +       AK+            +LL +TDG+ + E  EYR     S  +  G K +L+G    R  + LL   N++ LGGEVE+L
Sbjct:   19 RVPFAWLEACVQWL-QEEAGEGARLSQQQVNQLVLDQWLLTDLRDLDFPVLPEGLAQAQKTQLNGIFCVQVDSFLDISQPAYGQLQKWRGTDCANDEVSAVTQATQRPWEAKTTR---------MMLLQVTDGVQSLEAMEYRPIPALSATLRPGAKLQLQGQMVCRLGVLLLGPSNVKILGGEVEEL 196          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. TrEMBL
Match: A0A3P9ML67 (RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.647e-20
Identity = 63/188 (33.51%), Postives = 93/188 (49.47%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNL--FTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EAC++WL QE   E + +S  +   L+  QWL +DLRDL+ P L          + NG+ C QV  +  +SQ  YGQ++   GT   N  V A  +       AK+            +LL +TDG+ + E  EY+     S  +  G K +L+G    R  + LL   N++ LGGEVE+L
Sbjct:   19 RVPFAWLEACVQWL-QEEAGEAAHLSQQQVNQLVLDQWLLTDLRDLDYPVLPEGLAQAQKTQLNGIFCVQVDSFLDISQPAYGQLQKWRGTDCTNDEVSAVTQATQRPWEAKTTR---------MMLLQVTDGVQSLEAMEYQPIPALSATLRPGAKLQLQGQMVCRLGVLLLGPSNVKILGGEVEEL 196          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Cavefish
Match: rmi1 (RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) [Source:NCBI gene;Acc:393149])

HSP 1 Score: 92.4337 bits (228), Expect = 1.917e-19
Identity = 64/189 (33.86%), Postives = 92/189 (48.68%), Query Frame = 3
Query:   81 FQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFT-ISD-NVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
             Q PQ W+EAC+EW+ +E      ++   +    +  QWL +DLRDL  P L   IS+   ME NG  C Q+     VSQ  Y Q++ + G+   N  V A  +       AK             L+L LTDG+ + EG EYR     + ++  G K ++ G   +R  + LL  +N+  LGGEVE L
Sbjct:   20 IQVPQTWLEACVEWVLEEAGG--VAVPQAQLNKQVLDQWLLTDLRDLAHPLLPACISEAQKMELNGCYCLQLDSLLDVSQPAYSQLQRVRGSDCTNEQVTAVTQATQKPWEAKPTR---------MLMLQLTDGVQSLEGMEYRPIPALNTSLPPGTKLQVAGTVVVRLGVLLLKAENVRVLGGEVEQL 197          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Nematostella
Match: EDO31902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL0])

HSP 1 Score: 52.7582 bits (125), Expect = 3.077e-7
Identity = 36/138 (26.09%), Postives = 62/138 (44.93%), Query Frame = 3
Query:   93 QGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYR 506
            QGW++ CI+++  +  N   S++  +   L+  ++L +DL+++   +L  I D VM   G  C Q+     V QS Y Q+  + G  +P +           L    +  E  VK     L   L+DG    +  EY+
Sbjct:   23 QGWLDECIDFI--KRTNSGRSITQHQLNQLVYDKFLLADLQEIGEASLPQIEDEVMMVEGTYCLQINSVINVGQSAYSQIMKIKGKDDPESH----------LDKKHTNWEPKVKASRM-LFFQLSDGGQQIQAMEYQ 147          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Nematostella
Match: EDO31900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWK8])

HSP 1 Score: 51.6026 bits (122), Expect = 6.527e-7
Identity = 26/93 (27.96%), Postives = 49/93 (52.69%), Query Frame = 3
Query:   93 QGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSV 371
            QGW++ CI+++  +  N   S++  +   L+  ++L +DL+++   +L  I D VM   G  C Q+     V QS Y Q+  + G  +P + +
Sbjct:   23 QGWLDECIDFI--KRTNSGRSITQHQLNQLVYDKFLLADLQEIGEASLPQIKDEVMMVEGTYCLQINSVINVGQSAYSQIMKIKGKDDPESHL 113          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Medaka
Match: rmi1 (RecQ mediated genome instability 1 [Source:NCBI gene;Acc:101171749])

HSP 1 Score: 106.686 bits (265), Expect = 9.232e-24
Identity = 63/188 (33.51%), Postives = 93/188 (49.47%), Query Frame = 3
Query:   84 QFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNL--FTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDL 641
            + P  W+EAC++WL QE   E + +S  +   L+  QWL +DLRDL+ P L          + NG+ C QV  +  +SQ  YGQ++   GT   N  V A  +       AK+            +LL +TDG+ + E  EY+     S  +  G K +L+G    R  + LL   N++ LGGEVE+L
Sbjct:   28 RVPFAWLEACVQWL-QEEAGEAAHLSQQQVNQLVLDQWLLTDLRDLDYPVLPEGLAQAQKTQLNGIFCVQVDSFLDISQPAYGQLQKWRGTDCGNDEVSAVTQATQRPWEAKTTR---------MMLLQVTDGVQSLEAMEYQPIPALSATLRPGAKLQLQGQMVCRLGVLLLGPSNVKILGGEVEEL 205          
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Planmine SMEST
Match: SMESG000052467.1 (SMESG000052467.1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 543/548 (99.09%), Postives = 543/548 (99.09%), Query Frame = 3
Query:   33 MENXXXXXXXXXXXXXFQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEVEDLTFCEVKFXXXXXXXXXXXXXXPTRINKSVVKIKAAKLENKESNRTIVNNSLDVKLHYLSEKYLEIKPKIEKFSPVIENFSNNKNNLQVPKTNVHSSADSGNINFIESFEGITQLSLSNWIKDSNALNSVPNDIPQLVDRFDDEAEELLSSIPLNELTNEADKEKSIKTETISFVKTDIKIENQSNSIEKPFDKSEPFVYLVDVFNELSQPDVEKILDKKFKIKGLIFTFASKLKIVEDIKKIYRWDLQIVLGDGTATVDCFLSDDFITKEIGFTANHFQEMKKSKSIENYKKSFIDFQAYIVKCNCGLFTLQICDGYDKLCVVDYQPIDEGTVKALQNRISQTNL 1676
            MENIISLSIKHLKSKSFQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPF IRRRIALLAKQNIEFLGGEVEDLTFCEVKFLRENLELNKNKRK PTRINKSVVKIKAAKLENKESNRTIVNNSLDVK HYLSEKYLEIKPKIEKFSPVIEN SNNK NLQVPKTNVHSSADSGNINFIESFEGITQLSLSNWIKDSNALNSVPNDIPQLVDRFDDEAEELLSSIPLNELTNEADKEKSIKTETISFVKTDIKIENQSNSIEKPFDKSEPFVYLVDVFNELSQPDVEKILDKKFKIKGLIFTFASKLKIVEDIKKIYRWDLQIVLGDGTATVDCFLSDDFITKEIGFTANHFQEMKKSKSIENYKKSFIDFQAYIVKCNCGLFTLQICDGYDKLCVVDYQPIDEGTVKALQNRISQTNL
Sbjct:    1 MENIISLSIKHLKSKSFQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCLIEQQWLFSDLRDLETPNLFTISDNVMEFNGVMCCQVMGYRTVSQSYYGQVRDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGINNFEGYEYREWNLKSNAIVIGCKCRLKGPFKIRRRIALLAKQNIEFLGGEVEDLTFCEVKFLRENLELNKNKRKKPTRINKSVVKIKAAKLENKESNRTIVNNSLDVKPHYLSEKYLEIKPKIEKFSPVIENSSNNKKNLQVPKTNVHSSADSGNINFIESFEGITQLSLSNWIKDSNALNSVPNDIPQLVDRFDDEAEELLSSIPLNELTNEADKEKSIKTETISFVKTDIKIENQSNSIEKPFDKSEPFVYLVDVFNELSQPDVEKILDKKFKIKGLIFTFASKLKIVEDIKKIYRWDLQIVLGDGTATVDCFLSDDFITKEIGFTANHFQEMKKSKSIENYKKSFIDFQAYIVKCNCGLFTLQICDGYDKLCVVDYQPIDEGTVKALQNRISQTNL 548          
The following BLAST results are available for this feature:
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RMI16.596e-1931.41RecQ mediated genome instability 1 [Source:HGNC Sy... [more]
RMI11.625e-1831.41RecQ mediated genome instability 1 [Source:HGNC Sy... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rmi16.926e-2033.86RMI1, RecQ mediated genome instability 1, homolog ... [more]
rmi16.926e-2033.86RMI1, RecQ mediated genome instability 1, homolog ... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rmi14.042e-1834.04RecQ mediated genome instability 1 [Source:NCBI ge... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rmi14.951e-1931.77RecQ mediated genome instability 1 [Source:MGI Sym... [more]
Rmi14.951e-1931.77RecQ mediated genome instability 1 [Source:MGI Sym... [more]
Rmi14.951e-1931.77RecQ mediated genome instability 1 [Source:MGI Sym... [more]
Rmi14.951e-1931.77RecQ mediated genome instability 1 [Source:MGI Sym... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZVM9|RMI1_DANRE2.446e-1933.86RecQ-mediated genome instability protein 1 OS=Dani... [more]
sp|Q9D4G9|RMI1_MOUSE3.463e-1831.77RecQ-mediated genome instability protein 1 OS=Mus ... [more]
sp|Q9H9A7|RMI1_HUMAN7.805e-1831.41RecQ-mediated genome instability protein 1 OS=Homo... [more]
sp|Q6DDH2|RMI1_XENLA1.845e-1631.91RecQ-mediated genome instability protein 1 OS=Xeno... [more]
sp|Q5ZHV8|RMI1_CHICK3.751e-1630.37RecQ-mediated genome instability protein 1 OS=Gall... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2GLG41.252e-2625.97RecQ-mediated genome instability protein 1 OS=Aran... [more]
A0A0S7HXG56.769e-2235.98RMI1 (Fragment) OS=Poeciliopsis prolifica OX=18813... [more]
A0A3S2MW146.493e-2133.51DUF1767 domain-containing protein OS=Oryzias javan... [more]
A0A3B3E1261.188e-2034.04RMI1, RecQ mediated genome instability 1, homolog ... [more]
A0A3P9ML671.647e-2033.51RMI1, RecQ mediated genome instability 1, homolog ... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rmi11.917e-1933.86RMI1, RecQ mediated genome instability 1, homolog ... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO319023.077e-726.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319006.527e-727.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rmi19.232e-2433.51RecQ mediated genome instability 1 [Source:NCBI ge... [more]
back to top
BLAST of RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052467.10.000e+099.09SMESG000052467.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033131 ID=SMED30033131|Name=RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)|organism=Schmidtea mediterranea sexual|type=transcript|length=1728bp
TTTTAATATAAAGTTTTTGGCCATTTTTTATAATGGAAAATATTATCTCT
CTTTCCATCAAACATTTGAAATCTAAATCTTTTCAATTTCCCCAAGGTTG
GGTTGAAGCTTGTATTGAATGGTTATTTCAAGAGCATAAGAATGAAATTT
CTTCTATGTCAAATGATAAATGGTGTTGTTTAATTGAACAACAATGGCTA
TTTTCTGATCTGAGAGACTTAGAAACGCCTAATTTATTCACAATATCAGA
CAATGTTATGGAATTCAATGGAGTAATGTGTTGTCAAGTAATGGGTTACA
GAACGGTGTCACAATCTTACTATGGTCAGGTAAGAGATCTTACAGGAACT
GTAAATCCAAATACATCCGTCAAAGCTACCTGTGAGGGAGCCATCACATT
AACGACAGCCAAATCTTGTACAGAAGTGATAGTTAAGAATCAAGAGACAT
CATTGCTTCTTAATTTAACCGATGGAATTAATAATTTCGAAGGATATGAA
TATAGAGAATGGAATTTAAAATCTAATGCCATTGTTATTGGCTGTAAGTG
CCGACTGAAAGGCCCATTTACAATTAGAAGAAGGATCGCATTATTAGCGA
AGCAGAACATAGAGTTTCTCGGTGGAGAGGTGGAGGATTTAACATTTTGT
GAGGTAAAATTTCTGAGAGAGAATTTGGAATTAAACAAAAATAAAAGAAA
AAATCCTACAAGAATCAATAAATCAGTAGTAAAAATCAAAGCTGCAAAAT
TAGAAAATAAAGAAAGCAATAGAACTATTGTTAACAATTCCCTAGATGTT
AAACTTCATTATTTATCAGAAAAATATTTAGAAATTAAGCCGAAAATCGA
AAAATTTTCCCCAGTAATAGAAAATTTCTCAAATAATAAAAATAATCTCC
AAGTTCCGAAAACAAATGTTCATTCTTCTGCTGATTCAGGAAATATAAAT
TTTATAGAATCTTTCGAAGGCATTACCCAGTTATCTTTAAGTAATTGGAT
TAAAGACTCAAATGCATTGAATTCTGTTCCTAATGATATTCCACAGCTCG
TTGATCGTTTTGATGACGAAGCAGAAGAATTACTTTCGAGTATTCCATTG
AATGAGCTAACAAATGAAGCTGATAAGGAAAAATCCATCAAAACAGAAAC
TATTTCATTTGTCAAAACAGATATTAAAATAGAAAATCAATCTAATTCTA
TTGAAAAACCATTTGATAAAAGTGAACCATTCGTTTACCTGGTTGATGTG
TTTAATGAGTTATCCCAACCGGATGTGGAGAAAATTCTTGATAAAAAGTT
TAAAATCAAAGGATTAATTTTCACTTTTGCCAGTAAATTGAAAATTGTGG
AAGATATCAAAAAAATTTATCGATGGGATTTACAAATAGTTTTAGGCGAT
GGAACGGCGACAGTTGATTGTTTTTTATCCGACGACTTCATTACCAAAGA
AATCGGATTCACAGCCAATCATTTCCAGGAAATGAAGAAATCAAAATCTA
TAGAAAATTATAAAAAATCTTTCATCGACTTTCAGGCATATATTGTGAAA
TGTAATTGTGGACTGTTTACTTTACAAATATGTGATGGATATGATAAACT
TTGTGTAGTAGACTATCAACCGATTGATGAAGGTACCGTCAAGGCTTTAC
AGAATCGTATTTCTCAAACGAATTTATGATTTTCATCTTCCAAACCTTTT
ATTTATGTATAGTCCATTGTTGTGATAA
back to top

protein sequence of SMED30033131-orf-1

>SMED30033131-orf-1 ID=SMED30033131-orf-1|Name=SMED30033131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=549bp
MENIISLSIKHLKSKSFQFPQGWVEACIEWLFQEHKNEISSMSNDKWCCL
IEQQWLFSDLRDLETPNLFTISDNVMEFNGVMCCQVMGYRTVSQSYYGQV
RDLTGTVNPNTSVKATCEGAITLTTAKSCTEVIVKNQETSLLLNLTDGIN
NFEGYEYREWNLKSNAIVIGCKCRLKGPFTIRRRIALLAKQNIEFLGGEV
EDLTFCEVKFLRENLELNKNKRKNPTRINKSVVKIKAAKLENKESNRTIV
NNSLDVKLHYLSEKYLEIKPKIEKFSPVIENFSNNKNNLQVPKTNVHSSA
DSGNINFIESFEGITQLSLSNWIKDSNALNSVPNDIPQLVDRFDDEAEEL
LSSIPLNELTNEADKEKSIKTETISFVKTDIKIENQSNSIEKPFDKSEPF
VYLVDVFNELSQPDVEKILDKKFKIKGLIFTFASKLKIVEDIKKIYRWDL
QIVLGDGTATVDCFLSDDFITKEIGFTANHFQEMKKSKSIENYKKSFIDF
QAYIVKCNCGLFTLQICDGYDKLCVVDYQPIDEGTVKALQNRISQTNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR042470RMI1_N_2
IPR039215RMI1
IPR033472DUF1767
IPR032199RMI1_C
IPR013894RMI1_N
Vocabulary: cellular component
TermDefinition
GO:0031422RecQ helicase-Topo III complex
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033472RecQ mediated genome instability protein, DUF1767SMARTSM01161DUF1767_2coord: 9..101
e-value: 2.1E-13
score: 60.5
IPR032199Recq-mediated genome instability protein 1, C-terminal OB-fold domainPFAMPF16099RMI1_Ccoord: 397..543
e-value: 2.1E-18
score: 66.5
IPR013894RecQ mediated genome instability protein, N-terminalPFAMPF08585RMI1_Ncoord: 12..204
e-value: 9.9E-31
score: 107.2
IPR042470RecQ mediated genome instability protein, N-terminal, subdomain 2GENE3DG3DSA:2.40.50.770coord: 59..215
e-value: 3.4E-22
score: 80.4
NoneNo IPR availableGENE3DG3DSA:1.10.8.1020coord: 4..58
e-value: 3.9E-6
score: 28.3
IPR039215RecQ-mediated genome instability protein 1PANTHERPTHR14790FAMILY NOT NAMEDcoord: 11..543