Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2

Overview
NamePhosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2
Smed IDSMED30033121
Length (bp)1782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 (SMED30033121) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 (SMED30033121) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 (SMED30033121) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 (SMED30033121) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033121

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033121SMESG000060206.1 dd_Smed_v4_4925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033121SMESG000060206.1 Contig44814newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033121SMESG000060206.1 Contig44814uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033121SMESG000060206.1 Contig7649newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033121SMESG000060206.1 Contig7649uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033121SMESG000060206.1 Contig38715newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033121SMESG000060206.1 Contig38715uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Human
Match: TPTE2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:HGNC Symbol;Acc:HGNC:17299])

HSP 1 Score: 319.701 bits (818), Expect = 8.745e-102
Identity = 173/449 (38.53%), Postives = 261/449 (58.13%), Query Frame = 2
Query:  341 LAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            ++      FL++++LR+   G + YF +  N++D  ++ +  ++ ++    DI L  +      +   L  +  I    L + K+ + K  R + SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L E++ F K   EW+ +  +NI+A+HCKGGKGRTGTM+C  LI S +F  AE  L YFG+RRT+     KFQGVETPSQNRYVGYF  +K   ++ +P  ++L I++  I   +   C  + ++ ++         ++ +    +LG+   C +  D E+ +  + I + D P L+DDVK++FF+ N  +P+ YD C FFFWF+T FI++                         RL L R +LDNPHK+  W IY  EF V+I F
Sbjct:  111 ISLAIGLFFLMDVLLRVFVEGRQQYFSDLFNILDTAIIVIPLLVDVIYIFFDIKLLRNIPRWTHLVRLLRLIILIRIFHLLHQKRQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME---------KKVVFSSTSLGN---CSILHDIETDK--ILINVYDGPPLYDDVKVQFFSSN--LPKYYDNCPFFFWFNTSFIQNN------------------------RLCLPRNELDNPHKQKAWKIYPPEFAVEILF 519          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Human
Match: TPTE2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:HGNC Symbol;Acc:HGNC:17299])

HSP 1 Score: 308.916 bits (790), Expect = 4.305e-99
Identity = 157/365 (43.01%), Postives = 223/365 (61.10%), Query Frame = 2
Query:  578 KKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            ++  K  R + SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L E++ F K   EW+ +  +NI+A+HCKGGKGRTGTM+C  LI S +F  AE  L YFG+RRT+     KFQGVETPSQNRYVGYF  +K   ++ +P  ++L I++  I   +   C  + ++ ++         ++ +    +LG+   C +  D E+ +  + I + D P L+DDVK++FF+ N  +P+ YD C FFFWF+T FI++                         RL L R +LDNPHK+  W IY  EF V+I F
Sbjct:   84 RQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME---------KKVVFSSTSLGN---CSILHDIETDK--ILINVYDGPPLYDDVKVQFFSSN--LPKYYDNCPFFFWFNTSFIQNN------------------------RLCLPRNELDNPHKQKAWKIYPPEFAVEILF 408          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Human
Match: TPTE2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:HGNC Symbol;Acc:HGNC:17299])

HSP 1 Score: 309.686 bits (792), Expect = 6.968e-99
Identity = 157/365 (43.01%), Postives = 223/365 (61.10%), Query Frame = 2
Query:  578 KKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            ++  K  R + SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L E++ F K   EW+ +  +NI+A+HCKGGKGRTGTM+C  LI S +F  AE  L YFG+RRT+     KFQGVETPSQNRYVGYF  +K   ++ +P  ++L I++  I   +   C  + ++ ++         ++ +    +LG+   C +  D E+ +  + I + D P L+DDVK++FF+ N  +P+ YD C FFFWF+T FI++                         RL L R +LDNPHK+  W IY  EF V+I F
Sbjct:  118 RQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME---------KKVVFSSTSLGN---CSILHDIETDK--ILINVYDGPPLYDDVKVQFFSSN--LPKYYDNCPFFFWFNTSFIQNN------------------------RLCLPRNELDNPHKQKAWKIYPPEFAVEILF 442          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Human
Match: TPTE2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:HGNC Symbol;Acc:HGNC:17299])

HSP 1 Score: 309.686 bits (792), Expect = 6.968e-99
Identity = 157/365 (43.01%), Postives = 223/365 (61.10%), Query Frame = 2
Query:  578 KKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            ++  K  R + SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L E++ F K   EW+ +  +NI+A+HCKGGKGRTGTM+C  LI S +F  AE  L YFG+RRT+     KFQGVETPSQNRYVGYF  +K   ++ +P  ++L I++  I   +   C  + ++ ++         ++ +    +LG+   C +  D E+ +  + I + D P L+DDVK++FF+ N  +P+ YD C FFFWF+T FI++                         RL L R +LDNPHK+  W IY  EF V+I F
Sbjct:  118 RQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME---------KKVVFSSTSLGN---CSILHDIETDK--ILINVYDGPPLYDDVKVQFFSSN--LPKYYDNCPFFFWFNTSFIQNN------------------------RLCLPRNELDNPHKQKAWKIYPPEFAVEILF 442          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Human
Match: TPTE2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:HGNC Symbol;Acc:HGNC:17299])

HSP 1 Score: 309.686 bits (792), Expect = 2.047e-98
Identity = 157/365 (43.01%), Postives = 223/365 (61.10%), Query Frame = 2
Query:  578 KKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            ++  K  R + SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L E++ F K   EW+ +  +NI+A+HCKGGKGRTGTM+C  LI S +F  AE  L YFG+RRT+     KFQGVETPSQNRYVGYF  +K   ++ +P  ++L I++  I   +   C  + ++ ++         ++ +    +LG+   C +  D E+ +  + I + D P L+DDVK++FF+ N  +P+ YD C FFFWF+T FI++                         RL L R +LDNPHK+  W IY  EF V+I F
Sbjct:  155 RQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME---------KKVVFSSTSLGN---CSILHDIETDK--ILINVYDGPPLYDDVKVQFFSSN--LPKYYDNCPFFFWFNTSFIQNN------------------------RLCLPRNELDNPHKQKAWKIYPPEFAVEILF 479          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Celegans
Match: daf-18 (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase daf-18 [Source:UniProtKB/Swiss-Prot;Acc:G5EE01])

HSP 1 Score: 129.798 bits (325), Expect = 3.653e-31
Identity = 67/184 (36.41%), Postives = 104/184 (56.52%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGP-NYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKK 1147
            R   S N+ R +    DLD  Y+TDR+IA+ +P++G  A +RNS     +F   ++G  N K++NL     YD   F+  V  + + DH+ P LE +  F + ++EWL   D+++IAVHCK GKGRTG MIC  LI    + +    L Y+      +++ K  +GV  PSQ RY+ Y+  +++
Sbjct:   50 RTAVSSNRCRTEYQNIDLDCAYITDRIIAIGYPATGIEANFRNSKVQTQQFLTRRHGKGNVKVFNLRGGYYYDADNFDGNVICFDMTDHHPPSLELMAPFCREAKEWLEADDKHVIAVHCKAGKGRTGVMICALLIYINFYPSPRQILDYYS-----IIRTKNNKGVTIPSQRRYIYYYHKLRE 228          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0089902)

HSP 1 Score: 175.252 bits (443), Expect = 1.440e-48
Identity = 116/363 (31.96%), Postives = 179/363 (49.31%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSG-FTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKL-LKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY---RSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            R+V S+ + R++  GYDLDL Y+ D +IAM +P+      L+RN + DV K     +  +YKIYNLC ER+YD   F  +V  Y   DHN P +E I  F      WL +   N++AVHCK GKGRTGTMIC +L+ SG+  +A+  L ++ ++RT     K  +GV  PSQ RYV YF  +  S    +P  K+ L + +I  + +         E S+ +    + +             P + +       K  +LTI     P++     +K F   KK P   DK    FW +T F+ +Y    SD ++ ++ +               +LS+ ++D+ HK +    ++ EFK+ I F
Sbjct:   13 RNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRT-----KDRKGVTIPSQRRYVQYFSKLVCS---SVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATE----------NAKPDRLKTLPIDFQKSFVLTIK----PSIPVSGDVK-FELTKKSP---DKIICHFWLNTFFVRNYSPCESDGTVNKYIH---------------TLSKSEIDDVHKDSEHKRFSEEFKISIVF 334          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0300562)

HSP 1 Score: 173.326 bits (438), Expect = 4.260e-47
Identity = 116/363 (31.96%), Postives = 179/363 (49.31%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSG-FTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKL-LKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY---RSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            R+V S+ + R++  GYDLDL Y+ D +IAM +P+      L+RN + DV K     +  +YKIYNLC ER+YD   F  +V  Y   DHN P +E I  F      WL +   N++AVHCK GKGRTGTMIC +L+ SG+  +A+  L ++ ++RT     K  +GV  PSQ RYV YF  +  S    +P  K+ L + +I  + +         E S+ +    + +             P + +       K  +LTI     P++     +K F   KK P   DK    FW +T F+ +Y    SD ++ ++ +               +LS+ ++D+ HK +    ++ EFK+ I F
Sbjct:   13 RNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRT-----KDRKGVTIPSQRRYVQYFSKLVCS---SVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATE----------NAKPDRLKTLPIDFQKSFVLTIK----PSIPVSGDVK-FELTKKSP---DKIICHFWLNTFFVRNYSPCESDGTVNKYIH---------------TLSKSEIDDVHKDSEHKRFSEEFKISIVF 334          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0301521)

HSP 1 Score: 173.326 bits (438), Expect = 4.260e-47
Identity = 116/363 (31.96%), Postives = 179/363 (49.31%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSG-FTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKL-LKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY---RSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            R+V S+ + R++  GYDLDL Y+ D +IAM +P+      L+RN + DV K     +  +YKIYNLC ER+YD   F  +V  Y   DHN P +E I  F      WL +   N++AVHCK GKGRTGTMIC +L+ SG+  +A+  L ++ ++RT     K  +GV  PSQ RYV YF  +  S    +P  K+ L + +I  + +         E S+ +    + +             P + +       K  +LTI     P++     +K F   KK P   DK    FW +T F+ +Y    SD ++ ++ +               +LS+ ++D+ HK +    ++ EFK+ I F
Sbjct:   13 RNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRT-----KDRKGVTIPSQRRYVQYFSKLVCS---SVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATE----------NAKPDRLKTLPIDFQKSFVLTIK----PSIPVSGDVK-FELTKKSP---DKIICHFWLNTFFVRNYSPCESDGTVNKYIH---------------TLSKSEIDDVHKDSEHKRFSEEFKISIVF 334          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0089900)

HSP 1 Score: 173.326 bits (438), Expect = 4.260e-47
Identity = 116/363 (31.96%), Postives = 179/363 (49.31%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSG-FTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKL-LKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY---RSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            R+V S+ + R++  GYDLDL Y+ D +IAM +P+      L+RN + DV K     +  +YKIYNLC ER+YD   F  +V  Y   DHN P +E I  F      WL +   N++AVHCK GKGRTGTMIC +L+ SG+  +A+  L ++ ++RT     K  +GV  PSQ RYV YF  +  S    +P  K+ L + +I  + +         E S+ +    + +             P + +       K  +LTI     P++     +K F   KK P   DK    FW +T F+ +Y    SD ++ ++ +               +LS+ ++D+ HK +    ++ EFK+ I F
Sbjct:   13 RNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRT-----KDRKGVTIPSQRRYVQYFSKLVCS---SVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATE----------NAKPDRLKTLPIDFQKSFVLTIK----PSIPVSGDVK-FELTKKSP---DKIICHFWLNTFFVRNYSPCESDGTVNKYIH---------------TLSKSEIDDVHKDSEHKRFSEEFKISIVF 334          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0089904)

HSP 1 Score: 173.326 bits (438), Expect = 4.260e-47
Identity = 116/363 (31.96%), Postives = 179/363 (49.31%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSG-FTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKL-LKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY---RSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            R+V S+ + R++  GYDLDL Y+ D +IAM +P+      L+RN + DV K     +  +YKIYNLC ER+YD   F  +V  Y   DHN P +E I  F      WL +   N++AVHCK GKGRTGTMIC +L+ SG+  +A+  L ++ ++RT     K  +GV  PSQ RYV YF  +  S    +P  K+ L + +I  + +         E S+ +    + +             P + +       K  +LTI     P++     +K F   KK P   DK    FW +T F+ +Y    SD ++ ++ +               +LS+ ++D+ HK +    ++ EFK+ I F
Sbjct:   13 RNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRT-----KDRKGVTIPSQRRYVQYFSKLVCS---SVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATE----------NAKPDRLKTLPIDFQKSFVLTIK----PSIPVSGDVK-FELTKKSP---DKIICHFWLNTFFVRNYSPCESDGTVNKYIH---------------TLSKSEIDDVHKDSEHKRFSEEFKISIVF 334          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Zebrafish
Match: tpte (transmembrane phosphatase with tensin homology [Source:ZFIN;Acc:ZDB-GENE-030131-5503])

HSP 1 Score: 331.257 bits (848), Expect = 1.379e-106
Identity = 180/452 (39.82%), Postives = 267/452 (59.07%), Query Frame = 2
Query:  332 LDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            L+ ++   S  FLI+++LR++  G K YF + +N+VD  +V +T V++++    D +  +           L  L  +    L + K+ + K +R + SENKRR+Q  G+DLDL YVT+RVIAMSFPSSG  ALYRN I +V +F ++K+  +YK++NLC E+ YD K F+ +VER M+ DHNVP L+++L +    R+W+    +N+IA+HCKGGKGRTGTM+C  LIDS  F++A+  L YFG+RRTD     KFQGVETPSQ+RYVGY+E +K   + ++P  K LKI+ I I         + S++ L+I       ++  ++ +        C V  D  S  + + I + D P +  DVK+  F  +  +P+ Y+ C F+FWF+T F+E+Y                        RL LSRE+LDNPHK  TW+IY  +F V + F
Sbjct:   90 LETVSLVISFFFLIDVLLRVYVEGFKVYFSSKLNIVDACIVVITLVVTMIYAFSDFSGASLIPRVVTFLRSLRILILVRIFRLASQKRELEKVTRRMVSENKRRYQKDGFDLDLTYVTERVIAMSFPSSGKQALYRNPIREVVRFLDTKHMDHYKVFNLCSEKGYDPKFFHYRVERVMIDDHNVPSLDDMLRYTACVRDWMAADSRNVIAIHCKGGKGRTGTMVCTWLIDSDQFESAQESLDYFGERRTDKSMSSKFQGVETPSQSRYVGYYEIMKNQYNRQLPPRKSLKIKSIRIHSIAGVGKGNGSDLKLKII------VKHELVFQCVCAKQHNCTVFPDTGS--NAVVISLQDGPIVTGDVKV-MFESSAGLPKGYEDCPFYFWFNTSFVENY------------------------RLFLSREELDNPHKPKTWDIYKEDFGVTLSF 508          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Zebrafish
Match: tpte (transmembrane phosphatase with tensin homology [Source:ZFIN;Acc:ZDB-GENE-030131-5503])

HSP 1 Score: 331.257 bits (848), Expect = 1.379e-106
Identity = 180/452 (39.82%), Postives = 267/452 (59.07%), Query Frame = 2
Query:  332 LDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            L+ ++   S  FLI+++LR++  G K YF + +N+VD  +V +T V++++    D +  +           L  L  +    L + K+ + K +R + SENKRR+Q  G+DLDL YVT+RVIAMSFPSSG  ALYRN I +V +F ++K+  +YK++NLC E+ YD K F+ +VER M+ DHNVP L+++L +    R+W+    +N+IA+HCKGGKGRTGTM+C  LIDS  F++A+  L YFG+RRTD     KFQGVETPSQ+RYVGY+E +K   + ++P  K LKI+ I I         + S++ L+I       ++  ++ +        C V  D  S  + + I + D P +  DVK+  F  +  +P+ Y+ C F+FWF+T F+E+Y                        RL LSRE+LDNPHK  TW+IY  +F V + F
Sbjct:   90 LETVSLVISFFFLIDVLLRVYVEGFKVYFSSKLNIVDACIVVITLVVTMIYAFSDFSGASLIPRVVTFLRSLRILILVRIFRLASQKRELEKVTRRMVSENKRRYQKDGFDLDLTYVTERVIAMSFPSSGKQALYRNPIREVVRFLDTKHMDHYKVFNLCSEKGYDPKFFHYRVERVMIDDHNVPSLDDMLRYTACVRDWMAADSRNVIAIHCKGGKGRTGTMVCTWLIDSDQFESAQESLDYFGERRTDKSMSSKFQGVETPSQSRYVGYYEIMKNQYNRQLPPRKSLKIKSIRIHSIAGVGKGNGSDLKLKII------VKHELVFQCVCAKQHNCTVFPDTGS--NAVVISLQDGPIVTGDVKV-MFESSAGLPKGYEDCPFYFWFNTSFVENY------------------------RLFLSREELDNPHKPKTWDIYKEDFGVTLSF 508          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Zebrafish
Match: ptenb (phosphatase and tensin homolog B [Source:ZFIN;Acc:ZDB-GENE-030616-47])

HSP 1 Score: 181.03 bits (458), Expect = 8.985e-51
Identity = 119/372 (31.99%), Postives = 190/372 (51.08%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYS---EDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCP---TLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQF--------AYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            +   S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YDT  FN +V +Y  +DHN P+LE I  F +   +WL+++D ++ A+HCK GKGRTG MIC +L+  G F  A+  L ++ + RT     +  +GV  PSQ RYV Y+  + ++              K+E       + K   E ++ +F G +   + +  ++ ++++  +P+  +    +E K      M  + P    +  D+K++FF K  K+ +K  +  F FW +T FI         ++           Q      N      L+LS+  LD  +K      ++  FKV +FF
Sbjct:    6 KEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKDHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSENDNHVAAIHCKAGKGRTGVMICAYLLHRGKFKKAQEALDFYDEVRT-----RDKKGVTIPSQRRYVYYYSYLLRN--------------KLEYKPVALLFHKMVFE-TVPMFSGGTCNPQFVVYQLKVKIHTSNPAHTR----REEK-----YMFFEFPQPLPVCGDIKVEFFHKQNKMMKK--EKMFHFWVNTFFIPGSEESTEKVENGGLVKDLDGIQTAERGENDKDYLILTLSKTDLDKANKDKANRYFSPNFKVKMFF 346          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Zebrafish
Match: ptena (phosphatase and tensin homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-3776])

HSP 1 Score: 179.874 bits (455), Expect = 4.443e-50
Identity = 109/312 (34.94%), Postives = 172/312 (55.13%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFE-TIKKSPDFKIPNGKLLK------IEKIEITGAQKFYCKSESEISLQIFQGYS-----EDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFI 1498
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YD   FN +V +Y  +DHN P+LE I  F +   +WL++ + ++ A+HCK GKGRTG MIC +L+    F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+   +K   D+K P   L        +        +    K+ SE++ Q F+  S     + +  ++ ++++  +P+       +  ++H++       P    D+K++FF K  K+ +K DK  F FW +T FI
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSYLLKNKLDYK-PVALLFHKMVFQTLPMFSGGTCRDSTVKNRSEVNPQGFKKGSWHWDPQFVVYQLKVKIHTSNPAHT-----RREEKHMIFEFPQPLPVC-GDIKVEFFHKQSKMMKK-DKM-FHFWINTFFI 303          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Zebrafish
Match: ptena (phosphatase and tensin homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-3776])

HSP 1 Score: 179.874 bits (455), Expect = 4.443e-50
Identity = 109/312 (34.94%), Postives = 172/312 (55.13%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFE-TIKKSPDFKIPNGKLLK------IEKIEITGAQKFYCKSESEISLQIFQGYS-----EDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFI 1498
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YD   FN +V +Y  +DHN P+LE I  F +   +WL++ + ++ A+HCK GKGRTG MIC +L+    F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+   +K   D+K P   L        +        +    K+ SE++ Q F+  S     + +  ++ ++++  +P+       +  ++H++       P    D+K++FF K  K+ +K DK  F FW +T FI
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSYLLKNKLDYK-PVALLFHKMVFQTLPMFSGGTCRDSTVKNRSEVNPQGFKKGSWHWDPQFVVYQLKVKIHTSNPAHT-----RREEKHMIFEFPQPLPVC-GDIKVEFFHKQSKMMKK-DKM-FHFWINTFFI 303          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 311.227 bits (796), Expect = 1.636e-99
Identity = 171/438 (39.04%), Postives = 257/438 (58.68%), Query Frame = 2
Query:  374 EIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            +++L +   G + YF + +N+ D ++V VT ++++V    D +  ++          L  +  I  L L + K+ + K +R + SENKRR+Q  G+DLDL Y+TDR+IAMSFPSSG  + YRN I +VA+F +SK+  +YKIYNLC E+ YD K F+ +VER  + DHNVP L ++L F  S R W+ +  QN+IA+HCKGGKGRTGTM+C +L+DS  F++A   L YFG+RRTD     KFQGVETPSQ+RYV Y+E +K     ++P  K LKI  I I   Q     + +++ +QI       +++ ++ +        C++  D  +  + + I +  CP +  D+KI+ F  +  +P+ YD CAF+FWF+T FIE+                         RL LS+ +LDNPHK+ +  IY   F V++ F
Sbjct:   45 DVLLHIFVEGFRQYFSSKLNIFDAVIVIVTLLVTLVYAFTDFSGASNIPRMVNFLRALRIIILIRILRLASQKRQLEKVTRRLVSENKRRYQKDGFDLDLTYITDRIIAMSFPSSGKQSFYRNPIEEVARFLDSKHQDHYKIYNLCSEKGYDPKYFHYRVERVFIDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQLKIRSIRIYSIQGVGRSNGTDLKVQII------MKKEVVFQCVCETQGNCKLFFD--AGNNSIVISLDGCPVISGDIKIR-FESSANIPKGYDDCAFYFWFNTSFIENS------------------------RLYLSKNELDNPHKEKSGKIYKENFAVELNF 449          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 311.227 bits (796), Expect = 3.194e-99
Identity = 171/438 (39.04%), Postives = 257/438 (58.68%), Query Frame = 2
Query:  374 EIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            +++L +   G + YF + +N+ D ++V VT ++++V    D +  ++          L  +  I  L L + K+ + K +R + SENKRR+Q  G+DLDL Y+TDR+IAMSFPSSG  + YRN I +VA+F +SK+  +YKIYNLC E+ YD K F+ +VER  + DHNVP L ++L F  S R W+ +  QN+IA+HCKGGKGRTGTM+C +L+DS  F++A   L YFG+RRTD     KFQGVETPSQ+RYV Y+E +K     ++P  K LKI  I I   Q     + +++ +QI       +++ ++ +        C++  D  +  + + I +  CP +  D+KI+ F  +  +P+ YD CAF+FWF+T FIE+                         RL LS+ +LDNPHK+ +  IY   F V++ F
Sbjct:   66 DVLLHIFVEGFRQYFSSKLNIFDAVIVIVTLLVTLVYAFTDFSGASNIPRMVNFLRALRIIILIRILRLASQKRQLEKVTRRLVSENKRRYQKDGFDLDLTYITDRIIAMSFPSSGKQSFYRNPIEEVARFLDSKHQDHYKIYNLCSEKGYDPKYFHYRVERVFIDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQLKIRSIRIYSIQGVGRSNGTDLKVQII------MKKEVVFQCVCETQGNCKLFFD--AGNNSIVISLDGCPVISGDIKIR-FESSANIPKGYDDCAFYFWFNTSFIENS------------------------RLYLSKNELDNPHKEKSGKIYKENFAVELNF 470          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 311.227 bits (796), Expect = 9.781e-99
Identity = 171/438 (39.04%), Postives = 257/438 (58.68%), Query Frame = 2
Query:  374 EIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            +++L +   G + YF + +N+ D ++V VT ++++V    D +  ++          L  +  I  L L + K+ + K +R + SENKRR+Q  G+DLDL Y+TDR+IAMSFPSSG  + YRN I +VA+F +SK+  +YKIYNLC E+ YD K F+ +VER  + DHNVP L ++L F  S R W+ +  QN+IA+HCKGGKGRTGTM+C +L+DS  F++A   L YFG+RRTD     KFQGVETPSQ+RYV Y+E +K     ++P  K LKI  I I   Q     + +++ +QI       +++ ++ +        C++  D  +  + + I +  CP +  D+KI+ F  +  +P+ YD CAF+FWF+T FIE+                         RL LS+ +LDNPHK+ +  IY   F V++ F
Sbjct:  103 DVLLHIFVEGFRQYFSSKLNIFDAVIVIVTLLVTLVYAFTDFSGASNIPRMVNFLRALRIIILIRILRLASQKRQLEKVTRRLVSENKRRYQKDGFDLDLTYITDRIIAMSFPSSGKQSFYRNPIEEVARFLDSKHQDHYKIYNLCSEKGYDPKYFHYRVERVFIDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQLKIRSIRIYSIQGVGRSNGTDLKVQII------MKKEVVFQCVCETQGNCKLFFD--AGNNSIVISLDGCPVISGDIKIR-FESSANIPKGYDDCAFYFWFNTSFIENS------------------------RLYLSKNELDNPHKEKSGKIYKENFAVELNF 507          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 274.633 bits (701), Expect = 7.484e-85
Identity = 160/438 (36.53%), Postives = 244/438 (55.71%), Query Frame = 2
Query:  374 EIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            +++L +   G + YF + +N+ D ++V VT ++++V    D +  ++          L  +  I  L L + K+ + K +R + SENKRR+Q  G+DLDL Y+TDR+IAMSFPSSG  + YRN I              +  + +CE + YD K F+ +VER  + DHNVP L ++L F  S R W+ +  QN+IA+HCKGGKGRTGTM+C +L+DS  F++A   L YFG+RRTD     KFQGVETPSQ+RYV Y+E +K     ++P  K LKI  I I   Q     + +++ +QI       +++ ++ +        C++  D  +  + + I +  CP +  D+KI+ F  +  +P+ YD CAF+FWF+T FIE+                         RL LS+ +LDNPHK+ +  IY   F V++ F
Sbjct:   99 DVLLHIFVEGFRQYFSSKLNIFDAVIVIVTLLVTLVYAFTDFSGASNIPRMVNFLRALRIIILIRILRLASQKRQLEKVTRRLVSENKRRYQKDGFDLDLTYITDRIIAMSFPSSGKQSFYRNPIEVYL----------HMAFRICE-KGYDPKYFHYRVERVFIDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQLKIRSIRIYSIQGVGRSNGTDLKVQII------MKKEVVFQCVCETQGNCKLFFD--AGNNSIVISLDGCPVISGDIKIR-FESSANIPKGYDDCAFYFWFNTSFIENS------------------------RLYLSKNELDNPHKEKSGKIYKENFAVELNF 492          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 239.965 bits (611), Expect = 1.955e-71
Identity = 126/321 (39.25%), Postives = 184/321 (57.32%), Query Frame = 2
Query:  710 TALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            T  Y     +VA+F +SK+  +YKIYNLC E+ YD K F+ +VER  + DHNVP L ++L F  S R W+ +  QN+IA+HCKGGKGRTGTM+C +L+DS  F++A   L YFG+RRTD     KFQGVETPSQ+RYV Y+E +K     ++P  K LKI  I I   Q     + +++ +QI       +++ ++ +        C++  D  +  + + I +  CP +  D+KI+ F  +  +P+ YD CAF+FWF+T FIE+                         RL LS+ +LDNPHK+ +  IY   F V++ F
Sbjct:  222 TEFYHLFSQEVARFLDSKHQDHYKIYNLCSEKGYDPKYFHYRVERVFIDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQLKIRSIRIYSIQGVGRSNGTDLKVQII------MKKEVVFQCVCETQGNCKLFFD--AGNNSIVISLDGCPVISGDIKIR-FESSANIPKGYDDCAFYFWFNTSFIENS------------------------RLYLSKNELDNPHKEKSGKIYKENFAVELNF 509          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Mouse
Match: Tpte (transmembrane phosphatase with tensin homology [Source:MGI Symbol;Acc:MGI:2446460])

HSP 1 Score: 302.753 bits (774), Expect = 7.248e-94
Identity = 176/454 (38.77%), Postives = 262/454 (57.71%), Query Frame = 2
Query:  332 LDY--LAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVI----SIVDITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKS-SRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            LDY  ++   +  FL++++LR+   G + YF + +N +D +V+ VT V+    ++ D           ++   L  L  I  L L + K+ ++  +R + S NKRR++  G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F ++K+  +Y++YNLC ERAYD K F+ +V R M+ DHNVP LEE+L F+K    W+ +  +N++A+HCKGGKGRTGTM+C  LI S +  NA+  L +FG+RRTD     KFQG+ETPSQNRYV YFE +K +    +P  K+L I+++ +           S++ +QI   + E +        +  +   C +  D E+   +  I +  CP L+DDVK+KF + N  +P+ YD C FFFWFHT FI++                         RL L R +LDN HK  TW IY  +F V++ F
Sbjct:  244 LDYRSISLAIALFFLVDVLLRVSVEGRRRYFSDVLNTLDAVVIGVTVVVAVIYALYDKHFLRDIPRLAVLLRPLRLLILIRILQLAHQKRQLERLTRKLVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGRESFYRNPIKEVVRFLDTKHPNHYQVYNLCSERAYDPKHFHYRVRRIMIDDHNVPTLEEMLLFSKEVNNWMAQDPENVVAIHCKGGKGRTGTMVCACLIASEIVLNAKESLYFFGERRTDKSNSSKFQGIETPSQNRYVKYFEKLKINYQLTLPPKKVLVIKRLVVYSIHGVGKGDGSDLEVQIIM-WQETV-------FSFCNSRNCMIFHDPETDRAI--INVFHCPALYDDVKVKFLSPN--LPKYYDDCPFFFWFHTSFIKNN------------------------RLYLPRNELDNTHKPKTWKIYGEKFAVEVDF 661          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Mouse
Match: Tpte (transmembrane phosphatase with tensin homology [Source:MGI Symbol;Acc:MGI:2446460])

HSP 1 Score: 236.884 bits (603), Expect = 1.398e-69
Identity = 132/316 (41.77%), Postives = 199/316 (62.97%), Query Frame = 2
Query:  332 LDY--LAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVI----SIVDITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKS-SRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQI 1258
            LDY  ++   +  FL++++LR+   G + YF + +N +D +V+ VT V+    ++ D           ++   L  L  I  L L + K+ ++  +R + S NKRR++  G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F ++K+  +Y++YNLC ERAYD K F+ +V R M+ DHNVP LEE+L F+K    W+ +  +N++A+HCKGGKGRTGTM+C  LI S +  NA+  L +FG+RRTD     KFQG+ETPSQNRYV YFE +K +    +P  K+L I+++ +           S++ +QI
Sbjct:  244 LDYRSISLAIALFFLVDVLLRVSVEGRRRYFSDVLNTLDAVVIGVTVVVAVIYALYDKHFLRDIPRLAVLLRPLRLLILIRILQLAHQKRQLERLTRKLVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGRESFYRNPIKEVVRFLDTKHPNHYQVYNLCSERAYDPKHFHYRVRRIMIDDHNVPTLEEMLLFSKEVNNWMAQDPENVVAIHCKGGKGRTGTMVCACLIASEIVLNAKESLYFFGERRTDKSNSSKFQGIETPSQNRYVKYFEKLKINYQLTLPPKKVLVIKRLVVYSIHGVGKGDGSDLEVQI 559          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Mouse
Match: Pten (phosphatase and tensin homolog [Source:MGI Symbol;Acc:MGI:109583])

HSP 1 Score: 181.8 bits (460), Expect = 5.201e-51
Identity = 122/371 (32.88%), Postives = 191/371 (51.48%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFE-TIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCP---TLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFR---------LSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YDT  FN +V +Y  +DHN P+LE I  F +   +WL++ D ++ A+HCK GKGRTG MIC +L+  G F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+   +K   D++ P   L      E               ++ +F G + +  + ++ ++ +   S     + +E K      M  + P    +  D+K++FF K  K+ +K DK  F FW +T FI         ++    C   I +   + R         L+L++  LD  +K      ++  FKV ++F
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSYLLKNHLDYR-PVALLFHKMMFE---------------TIPMFSGGTCN-PQFVVCQLKVKIYSSNSGPTRREDK-----FMYFEFPQPLPVCGDIKVEFFHKQNKMLKK-DK-MFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 112.464 bits (280), Expect = 3.021e-25
Identity = 70/207 (33.82%), Postives = 110/207 (53.14%), Query Frame = 2
Query:  647 DLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQG 1267
            +LDL YVT+R+IA+SFPS+     +R+++ +VA+   SK+G NY ++NL E+R   TK+ + +V  +   D + P LE+I    K+   WL     N++ +H KG +GR G +I  +L  S +  +A+  L  F  +R       K   +  PSQ RYV YF  +  S   K+ N K L +  + + G   F  K      L+I+Q 
Sbjct:  139 ELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRPDITKL-HAKVLEFGWPDLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASADQALDRFAMKR---FYEDKIVPIGQPSQRRYVHYFSGL-LSGSIKM-NNKPLFLHHVIMHGIPNFESKGGCRPFLRIYQA 339          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 112.464 bits (280), Expect = 3.042e-25
Identity = 70/207 (33.82%), Postives = 110/207 (53.14%), Query Frame = 2
Query:  647 DLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQG 1267
            +LDL YVT+R+IA+SFPS+     +R+++ +VA+   SK+G NY ++NL E+R   TK+ + +V  +   D + P LE+I    K+   WL     N++ +H KG +GR G +I  +L  S +  +A+  L  F  +R       K   +  PSQ RYV YF  +  S   K+ N K L +  + + G   F  K      L+I+Q 
Sbjct:  183 ELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRPDITKL-HAKVLEFGWPDLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASADQALDRFAMKR---FYEDKIVPIGQPSQRRYVHYFSGL-LSGSIKM-NNKPLFLHHVIMHGIPNFESKGGCRPFLRIYQA 383          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. UniProt/SwissProt
Match: sp|Q6XPS3|TPTE2_HUMAN (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Homo sapiens OX=9606 GN=TPTE2 PE=1 SV=2)

HSP 1 Score: 319.701 bits (818), Expect = 4.200e-101
Identity = 173/449 (38.53%), Postives = 261/449 (58.13%), Query Frame = 2
Query:  341 LAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            ++      FL++++LR+   G + YF +  N++D  ++ +  ++ ++    DI L  +      +   L  +  I    L + K+ + K  R + SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L E++ F K   EW+ +  +NI+A+HCKGGKGRTGTM+C  LI S +F  AE  L YFG+RRT+     KFQGVETPSQNRYVGYF  +K   ++ +P  ++L I++  I   +   C  + ++ ++         ++ +    +LG+   C +  D E+ +  + I + D P L+DDVK++FF+ N  +P+ YD C FFFWF+T FI++                         RL L R +LDNPHK+  W IY  EF V+I F
Sbjct:  111 ISLAIGLFFLMDVLLRVFVEGRQQYFSDLFNILDTAIIVIPLLVDVIYIFFDIKLLRNIPRWTHLVRLLRLIILIRIFHLLHQKRQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME---------KKVVFSSTSLGN---CSILHDIETDK--ILINVYDGPPLYDDVKVQFFSSN--LPKYYDNCPFFFWFNTSFIQNN------------------------RLCLPRNELDNPHKQKAWKIYPPEFAVEILF 519          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. UniProt/SwissProt
Match: sp|Q4R6N0|TPTE2_MACFA (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Macaca fascicularis OX=9541 GN=TPTE2 PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 1.317e-90
Identity = 159/397 (40.05%), Postives = 238/397 (59.95%), Query Frame = 2
Query:  341 LAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMII--EMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYR 1510
            ++   +  FL++++LR+   G + YF + +N++D  ++    ++ +V    DI    +      +   L  +  I    L + K+ + K  R + SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L E++ F K   EW+ +   NI+A+HCKGGKGRTGTMIC  LI S +F  AE  L YFG+RRTD     KFQGVETPSQNRYVGYF  +K   ++ +P  ++L I++  I   +        ++ ++I       + E+ ++    +LG+   C +  D E+   L  I +   P L+DDVK++FF+ N  +P+ YD C FFFWF+T FI+  R
Sbjct:  173 ISLAIALFFLMDVLLRVFVEGRQHYFSDLLNVLDTAIIVTPLLVDVVYIFFDIKFLRNIPRWIHLVRLLRLIILIRIFHLIHQKRELEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHPNHYRVYNLCSERAYDPKYFHNRVSRIMIDDHNVPTLHEMVVFTKEVNEWMAQDPANIVAIHCKGGKGRTGTMICAFLIASEIFLTAEESLYYFGERRTDKTNSSKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGVGTGGVCDLKVRI-------VMEKKVVFSSTSLGN---CSILHDIETDRVL--IDVFSGPPLYDDVKVQFFSSN--LPKYYDNCPFFFWFNTSFIQSNR 555          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. UniProt/SwissProt
Match: sp|P56180|TPTE_HUMAN (Putative tyrosine-protein phosphatase TPTE OS=Homo sapiens OX=9606 GN=TPTE PE=1 SV=3)

HSP 1 Score: 283.108 bits (723), Expect = 1.233e-86
Identity = 164/453 (36.20%), Postives = 252/453 (55.63%), Query Frame = 2
Query:  341 LAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIV----DITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFI-KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQV----TSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            ++   +  FL++++LR+     + YF +  N++D  ++ +  ++ +V    DI L  +      +   L  +  +    L + K+ + K  R   SENKRR+   G+DLDL YVT+R+IAMSFPSSG  + YRN I +V +F + K+  +Y++YNLC ERAYD K F+++V R M+ DHNVP L +++ F K   EW+ +  +NI+A+HCKGG  RTGTM+C  LI S +   A+  L YFG+RRTD    +KFQGV+TPSQ RYV YF  +K   ++ +P  ++L I+   I    ++    + +I ++         ++ +   ++LG   KC V    T+DK      + I + D   L+DDVK++FF  N  +P  YD C+F+FW HT FIE+                         RL L + +LDN HK+    IY S+F V+I F
Sbjct:  129 ISLAIALFFLMDVLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFDIKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKLIRRRVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEME---------KKVVFSTISLG---KCSVLDNITTDK------ILIDVFDGLPLYDDVKVQFFYSN--LPTYYDNCSFYFWLHTSFIENN------------------------RLYLPKNELDNLHKQKARRIYPSDFAVEILF 537          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. UniProt/SwissProt
Match: sp|O08586|PTEN_MOUSE (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Mus musculus OX=10090 GN=Pten PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.638e-50
Identity = 122/371 (32.88%), Postives = 191/371 (51.48%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFE-TIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCP---TLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFR---------LSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YDT  FN +V +Y  +DHN P+LE I  F +   +WL++ D ++ A+HCK GKGRTG MIC +L+  G F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+   +K   D++ P   L      E               ++ +F G + +  + ++ ++ +   S     + +E K      M  + P    +  D+K++FF K  K+ +K DK  F FW +T FI         ++    C   I +   + R         L+L++  LD  +K      ++  FKV ++F
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSYLLKNHLDYR-PVALLFHKMMFE---------------TIPMFSGGTCN-PQFVVCQLKVKIYSSNSGPTRREDK-----FMYFEFPQPLPVCGDIKVEFFHKQNKMLKK-DK-MFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. UniProt/SwissProt
Match: sp|P60484|PTEN_HUMAN (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.909e-50
Identity = 122/371 (32.88%), Postives = 191/371 (51.48%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFE-TIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCP---TLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFR---------LSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YDT  FN +V +Y  +DHN P+LE I  F +   +WL++ D ++ A+HCK GKGRTG MIC +L+  G F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+   +K   D++ P   L      E               ++ +F G + +  + ++ ++ +   S     + +E K      M  + P    +  D+K++FF K  K+ +K DK  F FW +T FI         ++    C   I +   + R         L+L++  LD  +K      ++  FKV ++F
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSYLLKNHLDYR-PVALLFHKMMFE---------------TIPMFSGGTCN-PQFVVCQLKVKIYSSNSGPTRREDK-----FMYFEFPQPLPVCGDIKVEFFHKQNKMLKK-DK-MFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. TrEMBL
Match: A0A267DMK1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032453g1 PE=4 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 2.456e-121
Identity = 194/453 (42.83%), Postives = 283/453 (62.47%), Query Frame = 2
Query:  335 DYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDI-------TLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            DY+      +F+IE+ +R+  +G + +F NWI ++DF VV +T ++S+V +       T +          IRL RL  ++ + L   K   K++RHV S+NK+R++  G+DLDLCY+T++VIAMS+PSSG  A+YRN I +VAKF + K+   YK+YNLC ER YD+  F+D+VERY++ DHNVPRL ++++FA S R+WL   +QNII VHCKGGKGRTGTMIC +++DS +++NA+ CL +FG +RTD  QG KFQGVETPSQNRYVGYFET+KK  ++++P    L + KI I G         S+   +IF+G       + + E +LG    C     +E+   ++T+   + PT+ +DVK  FF++N+ VP  Y+ CAFFFW +T FI+D                         ++ L R QLDNPHK  TW +++  F V++ F
Sbjct:   84 DYVGLVIVILFVIEVGVRIFALGPEKFFSNWIMVLDFAVVILTFIVSVVFMSVPDLSDTAKLGKLVVLARLIRLPRLVALVRVFLTERKNLTKATRHVVSQNKKRYEDDGFDLDLCYITEKVIAMSYPSSGLMAMYRNPIKEVAKFLDLKHYNRYKVYNLCSERYYDSSFFHDRVERYLIDDHNVPRLSDMVKFANSVRDWLAAHEQNIIVVHCKGGKGRTGTMICTYMVDSDIYENAKECLDFFGLKRTDYQQGIKFQGVETPSQNRYVGYFETVKKEFNYEMPPDTPLIVRKIIIHGISSIGNGDGSDFWFRIFEG------GKQVGEFDLGINKNCMAEFSRETDSAVVTLR--NPPTVLNDVKFSFFSRNRNVPTAYENCAFFFWIYTYFIQD------------------------LKIKLDRTQLDNPHKSKTWKVWHENFAVEVLF 504          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. TrEMBL
Match: A0A267DEJ3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032453g2 PE=4 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 4.349e-121
Identity = 194/453 (42.83%), Postives = 283/453 (62.47%), Query Frame = 2
Query:  335 DYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDI-------TLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            DY+      +F+IE+ +R+  +G + +F NWI ++DF VV +T ++S+V +       T +          IRL RL  ++ + L   K   K++RHV S+NK+R++  G+DLDLCY+T++VIAMS+PSSG  A+YRN I +VAKF + K+   YK+YNLC ER YD+  F+D+VERY++ DHNVPRL ++++FA S R+WL   +QNII VHCKGGKGRTGTMIC +++DS +++NA+ CL +FG +RTD  QG KFQGVETPSQNRYVGYFET+KK  ++++P    L + KI I G         S+   +IF+G       + + E +LG    C     +E+   ++T+   + PT+ +DVK  FF++N+ VP  Y+ CAFFFW +T FI+D                         ++ L R QLDNPHK  TW +++  F V++ F
Sbjct:   84 DYVGLVIVILFVIEVGVRIFALGPEKFFSNWIMVLDFAVVLLTFIVSVVFMSVPDLSDTAKLGKLVVLARLIRLPRLVALVRVFLTERKNLTKATRHVVSQNKKRYEDDGFDLDLCYITEKVIAMSYPSSGLMAMYRNPIKEVAKFLDLKHYNRYKVYNLCSERYYDSSFFHDRVERYLIDDHNVPRLSDMVKFANSVRDWLAAHEQNIIVVHCKGGKGRTGTMICTYMVDSDIYENAKECLDFFGLKRTDYQQGIKFQGVETPSQNRYVGYFETVKKEFNYEMPPDTPLIVRKIIIHGISSIGNGDGSDFWFRIFEG------GKQVGEFDLGINKNCIAEFSRETDSAVVTLR--NPPTVLNDVKFSFFSRNRNVPTAYENCAFFFWIYTYFIQD------------------------LKIKLDRTQLDNPHKSKTWKVWHENFAVEVLF 504          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. TrEMBL
Match: A0A267FVM4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032453g3 PE=4 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 5.280e-121
Identity = 194/453 (42.83%), Postives = 282/453 (62.25%), Query Frame = 2
Query:  335 DYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDI-------TLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            DY+      +F+IE+ +R+  +G + +F NWI ++DF VV +T ++S+V +       T +          IRL RL  ++ + L   K   K++RHV S+NK+R++  G+DLDLCY+T++VIAMS+PSSG  A+YRN I +VAKF + K+   YK+YNLC ER YD+  F+D+VERY++ DHNVPRL ++++FA S R+WL   +QNII VHCKGGKGRTGTMIC +++DS +++NA+ CL +FG +RTD  QG KFQGVETPSQNRYVGYFET+KK  ++++P    L + KI I G         S+   +IF+G  +      + E +LG    C     +E+   ++T+   + PT+ +DVK  FF++N+ VP  Y+ CAFFFW +T FI+D                         ++ L R QLDNPHK  TW  ++  F V++ F
Sbjct:   84 DYVGLVIVILFVIEVGVRIFALGPEKFFSNWIMVLDFAVVLLTFIVSVVFMSVPDLSDTAKLGKLVVLARLIRLPRLVALVRVFLTERKNLTKATRHVVSQNKKRYEDDGFDLDLCYITEKVIAMSYPSSGLMAMYRNPIKEVAKFLDLKHYNRYKVYNLCSERYYDSSFFHDRVERYLIDDHNVPRLSDMVKFANSVRDWLAAHEQNIIVVHCKGGKGRTGTMICTYMVDSDIYENAKECLDFFGLKRTDYQQGIKFQGVETPSQNRYVGYFETVKKEFNYEMPPDTPLIVRKIIIHGISSIGNGDGSDFWFRIFEGVKQ------VGEFDLGINKNCMAEFSRETDSAVVTLR--NPPTVLNDVKFSFFSRNRNVPTAYENCAFFFWIYTYFIQD------------------------LKIKLDRTQLDNPHKTKTWKAWHENFAVEVLF 504          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. TrEMBL
Match: A0A4Y2BQI5 (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Araneus ventricosus OX=182803 GN=TPTE2 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 2.741e-117
Identity = 178/452 (39.38%), Postives = 275/452 (60.84%), Query Frame = 2
Query:  317 LDEKELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + EK  +  A  F C FL+E+ +R+   G++ +F  W N+VD +V+ V+ +++++  +++       ++    L        L    K  +K +R + S+NKRR+Q  G+DLDL YVT+RVIAMSFPS G  +LYRN I +VA+F + K+  +YK+YNLC E+ YD   F+ +VER+++ DHNVP + +++ F K+ REW  +   N+IAVHCKGGKGRTGTMIC+ L+++G+F +AE  L YFG RRTDL +  KFQGVETPSQNRYVGYF+ IK+      P    L++ +I+IT        + S+++ +++ G S+      + E + G    CQ  ++ +S+  +L + +L+CP LH DVK++F   ++ VP+ Y+ C F+FWFHT FIE+                         R  + R+ LDNPHK  TW ++  +F +++FF
Sbjct:  126 VQEKAFEVTALCFVCYFLLEVSIRIAAKGVRQFFNEWFNVVDLVVIIVSFIVTVIYTSVDLGLGYAKLVVAGRLIRIVTFVRLYTERKHLVKGARQMVSQNKRRYQKDGFDLDLTYVTERVIAMSFPSRGKMSLYRNPIQEVARFLDFKHKDHYKVYNLCSEKTYDDTYFHGRVERFIIDDHNVPSVTDMIRFVKNVREWFDQDKSNVIAVHCKGGKGRTGTMICIWLVEAGLFGSAEASLDYFGNRRTDLSKSSKFQGVETPSQNRYVGYFQEIKEKFGGVPPEEIPLRLRQIKITALAGIGKGNGSDLTCEVYNGRSK------VFECDFGINKNCQ--AEYKSEADVLEVTVLNCPILHGDVKLRFQCSSRGVPKGYENCPFYFWFHTSFIENN------------------------RFYVQRDYLDNPHKPKTWKVFREKFSIELFF 545          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. TrEMBL
Match: R7TQR5 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_62994 PE=4 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 2.393e-115
Identity = 191/451 (42.35%), Postives = 275/451 (60.98%), Query Frame = 2
Query:  332 LDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDITLET---STXXXXXXXXXXXXXXXXXXXXXXNYKKFIK-SSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            L+ ++      F+IEI+LR+   GIK +   W  +VD +++  + V ++V   + T   S+ A   + +    L  I+ + L   KK ++ ++R   S+NKRR+Q  G+DLDLCY+T+R+IAMSFPSSG  +LYRN I +V  F  +K+  +Y+IYNLC ER+YD  +F++ VER  + DHNVP++ E+L++AK++R+WL   ++NIIAVHCKGGKGRTGTMICV L++SG FD A+  L+YFG RRTDL  G+KFQGVETPSQ+RYVGYFE  KK  + ++P    LK++ I +            ++S ++       I E  I E N G  S C+V  D ++    +T+   D P L  D+K+ F + + KVP+ YD CAF+FWFHT FIE+                          L L RE+LDNPHK+ TWN++   F V + F
Sbjct:   43 LEIISLFIMTYFMIEIVLRVFAFGIKHFVSKWYEVVDAVIIVASFVFAVVLTAINTHGNSSLAFARLVVAGRLLRIILLVRLIGEKKHLQQATRLAVSQNKRRYQKDGFDLDLCYITNRLIAMSFPSSGAHSLYRNPIKEVVNFMKTKHENHYRIYNLCSERSYDESLFDNNVERIRIDDHNVPKVAEMLDYAKNARQWLEADEENIIAVHCKGGKGRTGTMICVWLVESGAFDEAKESLEYFGDRRTDLSVGRKFQGVETPSQSRYVGYFEKAKKQFNGELPPSVTLKLKTITVQNLSGVAKGDGRDLSCKV-------ITESKIWEYNFGSQSDCRVACDSDTVS--VTVTPDDMPVLCGDIKVMFHSSSPKVPKNYDDCAFYFWFHTSFIENN------------------------GLWLPREELDNPHKEKTWNVFKEGFGVMLQF 460          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Cavefish
Match: ENSAMXT00000007968.2 (phosphatase and tensin homolog [Source:NCBI gene;Acc:103025186])

HSP 1 Score: 179.489 bits (454), Expect = 3.317e-50
Identity = 119/369 (32.25%), Postives = 189/369 (51.22%), Query Frame = 2
Query:  605 VTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSED---IRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCP---TLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYR-------SDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YDT  FN +V +Y  +DHN P+LE I  F +   +WL + D ++ A+HCK GKGRTG MIC +L+  G F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+  + K+              K++       + K   E ++ +F G + +   +  ++ ++++  +P   +   +K         M  + P    +  D+K++FF +  K+ +K DK  F FW +T FI            D+       Q      N      L+L++  LD  +K     +++  FKV ++F
Sbjct:    8 MVSRNKRRYQEDGFDLDLTYIYPNLIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIRPFCEDLDKWLGEHDNHVAAIHCKAGKGRTGVMICAYLLHQGKFKKAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSYLLKN--------------KLDYKPVALLFHKMMFE-TVPMFSGGNCNPHFVVYQLKVKIHTSNPGNTRREDNK--------CMHFEFPQPLPVCGDIKVEFFNRQNKMLKK-DK-MFHFWVNTFFIPGPEKLEKVENGDLPKELDEIQSLEKGENDKDYLILTLTKHDLDKANKDKANRLFSPNFKVKLYF 346          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Cavefish
Match: ENSAMXT00000043891.1 (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like [Source:NCBI gene;Acc:103046962])

HSP 1 Score: 177.563 bits (449), Expect = 4.053e-49
Identity = 108/303 (35.64%), Postives = 168/303 (55.45%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYS---EDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFI 1498
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YD   FN +V +Y  +DHN P+LE I  F +   +WL++ + ++ A+HCK GKGRTG MIC +L+    F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+  + K+              ++E       + K   E +L +F G +   + +  ++ ++++  +PS  +    +E K H+        P    D+K++FF K  K+ +K DK  F FW +T FI
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHRNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSHLLKN--------------QLEYKPVALLFHKMVFE-TLPMFSGGTCNPQFVVYQLKVKIHTSNPSHTR----REDK-HMFFEFPQPLPVC-GDIKVEFFHKQNKMMKK-DKM-FHFWVNTFFI 280          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Cavefish
Match: ENSAMXT00000055423.1 (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like [Source:NCBI gene;Acc:103046962])

HSP 1 Score: 176.022 bits (445), Expect = 2.268e-48
Identity = 112/311 (36.01%), Postives = 171/311 (54.98%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIE----ITGA--QKFYCKSESEISLQIFQ--GYSED---IRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFI 1498
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YD   FN +V +Y  +DHN P+LE I  F +   +WL++ + ++ A+HCK GKGRTG MIC +L+    F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+  + K+     P   L      E     +G   +    K+ SE + Q F+   +  D   +  ++ ++++  +PS  +    +E K H+        P    D+K++FF K  K+ +K DK  F FW +T FI
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHRNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSHLLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEANPQGFKKGNWHWDPQFVVYQLKVKIHTSNPSHTR----REDK-HMFFEFPQPLPVC-GDIKVEFFHKQNKMMKK-DKM-FHFWVNTFFI 303          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Cavefish
Match: ENSAMXT00000038725.1 (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like [Source:NCBI gene;Acc:103046962])

HSP 1 Score: 112.079 bits (279), Expect = 1.723e-26
Identity = 99/371 (26.68%), Postives = 164/371 (44.20%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYS---EDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCH----------FLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + + S NKRR+Q  G+DLDL Y+   +IAM       T                               A +T+++    E Y  +DHN P+LE I  F +   +WL++ + ++ A+HCK GKGRTG MIC +L+    F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+  + K+              ++E       + K   E +L +F G +   + +  ++ ++++  +PS  +    +E K H+        P    D+K++FF K  K+ +K DK  F FW +T FI          +       I  N            +L  L+L++  LD  +K      ++  FKV ++F
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMVHLQHVHTP------------------------------AQNTRVYQ---EEYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRT-----RDKKGVTIPSQRRYVYYYSHLLKN--------------QLEYKPVALLFHKMVFE-TLPMFSGGTCNPQFVVYQLKVKIHTSNPSHTR----REDK-HMFFEFPQPLPVC-GDIKVEFFHKQNKMMKK-DKM-FHFWVNTFFIPGPEESPEKWENGSVVNDIDSNSSQTGAPDADRDYLI-LTLTKNDLDKANKDKANRYFSPNFKVKLYF 314          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Cavefish
Match: ENSAMXT00000055284.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001063.1:312263:351370:1 gene:ENSAMXG00000032162.1 transcript:ENSAMXT00000055284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 2.931e-26
Identity = 84/291 (28.87%), Postives = 136/291 (46.74%), Query Frame = 2
Query:  641 GYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMIC--VHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY 1507
            GY+LDL YVT+R+IA+SFP S     Y +++ DV +   SK+  NY + NL E+R +D    N +       D + P L++I    K+   WL     +++ +HC+GGKGR G +IC  VH  D  +  +A+  L  F  R+       K   + TPSQ RYV    ++  S   K+ N   L +  I + G   F         ++++Q   + +    + ++  G               H + I++     L  D+ +K F  +K  P + +   F   FHTG ++DY
Sbjct:    4 GYELDLTYVTERIIAVSFPQSCSEETYLHNLKDVTRMLKSKHADNYLVINLSEKR-HDLTRMNPKTLDTGWPDLHAPPLDKICTICKAMENWLNADPLHVVVIHCRGGKGRIGVVICSFVHFTD--ISASADQALDRFAMRK---FYDDKVSALMTPSQKRYVWILNSL-LSGSMKM-NASPLFLHCIILHGIPNFDNSGVCRPFIKVYQAM-QAVYYSGVYQIGPG-------------HRHKVCIVLEPAQLLKGDIMVKCF--HKSSPSQRE-IIFRLQFHTGAVQDY 269          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Sea Lamprey
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 96.6709 bits (239), Expect = 4.672e-21
Identity = 52/169 (30.77%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  638 GGYDLDLCYVTDRVIAMSFPSSGFTAL-YRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETI 1141
            GG DL+L Y+T+R+I++  P+ G + + Y   + DVA+  +SK+   Y + NL E R +D + FN  V  +   D + P L+ +    K+   WL     +++ +HCKG K RTG ++  ++  +G+  +A   L  +  ++       K   +  PSQ RYV YF  +
Sbjct:    9 GGRDLELTYITERIISLCAPTGGDSHVAYHQQMRDVARMLHSKHANGYLVINLSERR-HDIEKFNVHVRDFGWPDLHAPPLDVLCSICKAMDSWLNADPAHVVVIHCKGNKCRTGVVVASYMYYNGICASASQALDRYAMKK---FYDDKVAKLSQPSQRRYVSYFSEL 173          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005736.1 (pep scaffold:Pmarinus_7.0:GL478791:38400:53446:1 gene:ENSPMAG00000005201.1 transcript:ENSPMAT00000005736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 5.350e-20
Identity = 60/209 (28.71%), Postives = 94/209 (44.98%), Query Frame = 2
Query:  641 GYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQG 1267
            G +LDL Y+T+R+IA+S+P  G    Y                    I NL E R +D +  N QV+ +   D + P L+ +    K+   WL    Q+++ +HCKG KGRTG ++  ++  + +  +A   L  +  ++       K   V  PSQ RYV YF  +  S   K+ N  L  +  I + G   F         L+I+Q 
Sbjct:   10 GQELDLTYITERIIAVSYPPGGSQLTY--------------------ILNLSERR-HDIEKLNPQVKDFGWPDLHAPPLDILCSLCKAMDSWLNADPQHVVVIHCKGNKGRTGVVVASYMYYNSICASAHQALDRYAMKK---FYDDKVAAVSQPSQKRYVTYFSEL-LSGKTKVNNMPLF-LHHIVVQGLPNFEANGGCRPFLKIYQA 192          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007420.1 (pep scaffold:Pmarinus_7.0:GL480034:173278:177354:1 gene:ENSPMAG00000006694.1 transcript:ENSPMAT00000007420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 8.277e-20
Identity = 52/142 (36.62%), Postives = 83/142 (58.45%), Query Frame = 2
Query:  323 EKELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDITLETSTXXXX-----XXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSI 733
             + L   +   S  FL+++ LR+   G ++YF   +N+ D  +V +T V+SIV  +++ S  A       ++ +  L +   +  L+       K+SR + S+NKRR++  G+DLDL YVT+RVIAMSFPSSG  ++YRN I
Sbjct:   30 SRALSASSLAISVFFLVDVALRVFVSGFRSYFREKLNIADAGIVVITLVVSIVYTSIDLSGTALLPRYNKVLRVLRLIMIIRVWRLVSQRHHLEKASRQMVSQNKRRYRKDGFDLDLTYVTERVIAMSFPSSGTQSMYRNPI 171          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009584.1 (pep scaffold:Pmarinus_7.0:GL480473:6650:34123:1 gene:ENSPMAG00000008668.1 transcript:ENSPMAT00000009584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 3.657e-19
Identity = 45/138 (32.61%), Postives = 71/138 (51.45%), Query Frame = 2
Query:  647 DLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRR 1060
            DLD+ Y+T RV  MS+P+ G  + ++N I DV  + +S++  +Y ++NLC +R Y    F+++V  Y       P L  +  F K    WL +  +NI  VHC  G+  +   +C  L    +F  AE  L  +  RR
Sbjct:    6 DLDISYITTRVAVMSYPAEGVESAFKNHIEDVRAYLDSRHPDHYAVFNLC-QRGYRPARFHNRVSEYAFPTRRAPNLGCLYTFCKDLLVWLKQDPKNICVVHCLDGRAVSAVAVCSFLCFCRLFSTAEAALYMYSLRR 142          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010485.1 (pep scaffold:Pmarinus_7.0:GL477590:24098:49109:-1 gene:ENSPMAG00000009496.1 transcript:ENSPMAT00000010485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 7.788e-19
Identity = 57/212 (26.89%), Postives = 99/212 (46.70%), Query Frame = 2
Query:  644 YDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGA----QKFYCKSESEISLQIFQG 1267
            ++ DL Y+T+R+IA + P       +++S+ D+A    SK+   Y I NL   R    ++ N QV  +     + P L+ +    K+   WL     ++  +HC G  G  G +I   +  S +  +A+  L  F  +R  +   +KF  +  PSQ RYV YF  +  S   K+ N   + +  I + GA     +   +S   + L+++QG
Sbjct:    5 FEFDLTYITERIIATTLPPGIAEHAHQSSLRDIAGMLTSKHADKYLIINLSGRRNEMLQL-NPQVLDFGWPSRHAPHLDTLCSICKAIDSWLNSHPLHVAVLHCAGNSGSAGVVIAAFMHYSAICASADQALDRFAMKRFYV---EKFASLTQPSQQRYVYYFNGL-LSGSIKM-NSAPVYLSHILLHGAWGPPPRLDTRSVKRVFLRVYQG 210          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Nematostella
Match: EDO47071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN45])

HSP 1 Score: 330.102 bits (845), Expect = 9.643e-109
Identity = 166/361 (45.98%), Postives = 224/361 (62.05%), Query Frame = 2
Query:  590 KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            +++R + S+NKRR+Q  G+DLDL YVT+RVIAMSFPSSG   +YRN I++VA+F ++K+  +YK+YNLC ER+YD  IF++QVER ++ DHNVPRL ++L F  + REWL K   N+IAVHCKGGKGRTGT IC  LI SG F+ A+  L+YFG RRTD   GK +QGV+TPSQ RYVGY E I    + ++P    LK++ I+I G          ++ L++       I   ++  M+  +    Q   D +  + ++ +   DCP+L  D+KIKF++ N  VP  YD CAF+FWFHT FIE+Y                        RL L RE+LDNPHK   W +Y   F VDI F
Sbjct:   26 RATRRMISQNKRRYQQDGFDLDLTYVTERVIAMSFPSSGKHKMYRNPISEVARFLDTKHSDHYKVYNLCSERSYDPSIFHNQVERILIDDHNVPRLSQLLYFCHNVREWLDKDPSNVIAVHCKGGKGRTGTAICAWLIASGQFEQAQHSLEYFGVRRTDYSVGKTYQGVQTPSQGRYVGYLEQIFTKLNRRMPPAVTLKLKTIKIDGIGGVGNGDGKDLRLEVI------INSSVVCHMSCSEGQPGQYFEDLD--KLVIAVGETDCPSLTGDIKIKFYSNNPNVPVGYDHCAFYFWFHTSFIENY------------------------RLFLRREELDNPHKPKVWKVYKETFAVDITF 354          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Nematostella
Match: EDO32901 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STQ6])

HSP 1 Score: 173.326 bits (438), Expect = 4.310e-49
Identity = 119/364 (32.69%), Postives = 176/364 (48.35%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLK-IEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIII-----NCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + + S+ KRRFQ  G+DLDL Y+   ++AM FPS     +YRN + +V +F   K+  +YK+YNLC ER YD   F+++V  Y   DHN P  E I  F     EWL  S+ N+  +HCK GKGRTG MIC +L+ +G F + +  ++Y+G  RT     +  +GV  PSQ RYV Y+  + ++    +P   LL+  E I I   Q   C         I   Y   I    +IE      SK   TS K      L I          D+K++FF K+    ++     F FWF+T FI    +  ++       PTI       N    +  ++ ++ +D  HK     +++ +FKV   F
Sbjct:    5 KQLVSKKKRRFQEDGFDLDLTYIKPNIVAMGFPSEKLEGVYRNHMDEVYRFLEQKHKDSYKVYNLCSERQYDPMRFHNRVATYPFDDHNAPPFELIKPFCDDVDEWLKASNLNVAIIHCKAGKGRTGVMICAYLLHNGHFKDTKEAMEYYGNART-----RNAKGVTIPSQRRYVEYYGYLLRNCLTYVPTMVLLRGFEIITIPNMQGGNC-----CPFYIIWQYKVKIHTSKLIES-----SKKGDTSIKLELSQPLPIC--------GDIKVEFFHKDTFGRKER---MFQFWFNTFFIS---TGANMTDSREGEPTIHTFKESRNSDVRW-FAIPKQFVDKAHKDNKCKVFSPDFKVSNVF 338          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Nematostella
Match: EDO45782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM0])

HSP 1 Score: 142.124 bits (357), Expect = 7.216e-38
Identity = 102/304 (33.55%), Postives = 143/304 (47.04%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKN--KKVPEKYDKCAFFFWFHTGFIED 1504
            RHV  E         +DLDL Y+T+R+IAMSFP +G  + YRN++ DVAK    K+   Y ++NL E R YD    N QV  +   DH  P LE +    KS   WL    Q+++ VHCKGGKGRTG +I  ++  S +  + E  L +F  +R       K  GV  PSQ RYV YF    +    K+ +  +  +  + + G   F  K   +  L+++ G        + +           VT D E     + I I     LH DV IK + KN    V +   +C     FHTG I+D
Sbjct:    9 RHVDHE---------FDLDLTYITERIIAMSFPGTGLESTYRNNLRDVAKMLQRKHQDKYMVFNLSERR-YDISKLNHQVLDFGWPDHLAPPLERLCSIIKSIDSWLKTDPQHVVVVHCKGGKGRTGVVISAYMHFSKMCSSPEAALDWFAIKR---FYDDKLGGVTQPSQRRYVHYFSDYLEG-KIKLSSEPMF-LHHVIVHGIPNFDSKGGCKPFLRVYDGLKLVYTSGVFL-----------VTQDMER----VCITIEGGLILHGDVLIKCYHKNTLSSVRDIIFRCQ----FHTGAIKD 278          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Nematostella
Match: EDO43926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX98])

HSP 1 Score: 99.3673 bits (246), Expect = 7.981e-22
Identity = 84/307 (27.36%), Postives = 133/307 (43.32%), Query Frame = 2
Query:  617 NKRRFQS-GGY---DLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKF-YCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCP---TLHDDVKIKFF----TKNKKVPEKYDKC-AFFFWFHTGFI 1498
            + + FQS  GY   DLDL Y+T R+I MSFP+ G  + Y+N+I DV +F  +K+   Y + N+   R Y     + +V       + +P LE I+   +    WL K    +I +HC  G+  +G ++    +   +F N       F  RR  + Q        TPSQ RY+ Y   +  +P  K P    L I+ + +     F   ++     ++++QG      +R++            V   ++ +E  L+   +  P   TL  DV I  +    T   KV  K      F   FHTGFI
Sbjct:  390 SNKAFQSMAGYVKNDLDLSYITSRIIVMSFPAEGIESTYKNNIDDVREFLEAKHYEQYFVVNV-SPRNYRADKLSTRVLHQCWPVNRLPPLESIISLCRKIFVWLKKDSSRVIVIHCMDGRVASGVLVSAFFVFCKLFKNPNGAADMFSIRRCGIGQKVAL----TPSQERYLLYIAELINNPSMK-PQKNSLYIKSVTLNPVPAFNKARNGCRPFIEMYQG-----NQRVL----------TTVQEIEKMREFTLSDGKVTFPVNLTLQGDVTIIVYHGRSTLGGKVQGKMASMRVFLLQFHTGFI 675          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Nematostella
Match: EDO29614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T353])

HSP 1 Score: 58.151 bits (139), Expect = 4.327e-11
Identity = 26/66 (39.39%), Postives = 35/66 (53.03%), Query Frame = 2
Query:  770 PNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGK 967
            P+  ++  C ER YD   F+++V  Y   DHN P  E I  F     EWL  S+ N+  +HCK GK
Sbjct:    4 PSRSLHFSCSERQYDPMRFHNRVATYPFDDHNAPPFELIKPFCDDVDEWLKASNLNVAIIHCKAGK 69          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Medaka
Match: tpte (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 [Source:NCBI gene;Acc:101172265])

HSP 1 Score: 313.538 bits (802), Expect = 5.295e-100
Identity = 176/459 (38.34%), Postives = 267/459 (58.17%), Query Frame = 2
Query:  326 KELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVD---------FLVVFVTSVISIVDITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFFI 1675
            K L+ ++   S  FL +++LR++  G K YF + +N+VD           +V+  S +S V +        RF+  I L+R+ R+        K+  K +R + SENKRR+Q  G+DLDL YVTDRVIAMSFPSSG  A YRN I +VA+F ++K+  +YK++NLC E+ YD + F+ +VER  + DHNVP LE++L+F  S REW++   QN+IA+HCKGGKGRTGTM+C  LIDS  F++A+  L+YFG+RRTD  +  KFQGVETPSQ+RYVGY+E +K   + ++P  + L+I+ + I           S++ ++I       +R  ++ +        C V  D  S   ++++   + P +  DVK+  F  +  +P+ Y+   F+FWF+T F+E                          +L   RE+LDNPHK  TWN+Y  +F + ++F+
Sbjct:   68 KALEAVSLSISFFFLADVLLRVYVEGFKVYFRSKLNIVDACVVVLTLVVTMVYTFSDLSGVSLIPRVVNFFRFLRIIILVRVFRLAAQK----KELEKVTRRMISENKRRYQKDGFDLDLTYVTDRVIAMSFPSSGKQAFYRNPIKEVARFLDTKHEGHYKVFNLCSEKGYDPQHFHYRVERVFIDDHNVPALEDMLKFTASVREWMSADPQNVIAIHCKGGKGRTGTMVCTWLIDSDQFESAQDSLEYFGERRTDKTRSSKFQGVETPSQSRYVGYYEVMKNKFNRQLPPPQSLRIKSLRIHSIAGVGRGDGSDLKVKII------VRGELVFQCVCAQQENCTVFPDAGSNAAVISLQ--NGPVVEGDVKV-MFESSAGLPKGYEDVPFYFWFNTSFVEHN------------------------KLFFPREELDNPHKPKTWNLYKEDFGITVYFL 489          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Medaka
Match: tpte (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 [Source:NCBI gene;Acc:101172265])

HSP 1 Score: 313.538 bits (802), Expect = 8.605e-100
Identity = 176/459 (38.34%), Postives = 267/459 (58.17%), Query Frame = 2
Query:  326 KELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVD---------FLVVFVTSVISIVDITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFFI 1675
            K L+ ++   S  FL +++LR++  G K YF + +N+VD           +V+  S +S V +        RF+  I L+R+ R+        K+  K +R + SENKRR+Q  G+DLDL YVTDRVIAMSFPSSG  A YRN I +VA+F ++K+  +YK++NLC E+ YD + F+ +VER  + DHNVP LE++L+F  S REW++   QN+IA+HCKGGKGRTGTM+C  LIDS  F++A+  L+YFG+RRTD  +  KFQGVETPSQ+RYVGY+E +K   + ++P  + L+I+ + I           S++ ++I       +R  ++ +        C V  D  S   ++++   + P +  DVK+  F  +  +P+ Y+   F+FWF+T F+E                          +L   RE+LDNPHK  TWN+Y  +F + ++F+
Sbjct:   87 KALEAVSLSISFFFLADVLLRVYVEGFKVYFRSKLNIVDACVVVLTLVVTMVYTFSDLSGVSLIPRVVNFFRFLRIIILVRVFRLAAQK----KELEKVTRRMISENKRRYQKDGFDLDLTYVTDRVIAMSFPSSGKQAFYRNPIKEVARFLDTKHEGHYKVFNLCSEKGYDPQHFHYRVERVFIDDHNVPALEDMLKFTASVREWMSADPQNVIAIHCKGGKGRTGTMVCTWLIDSDQFESAQDSLEYFGERRTDKTRSSKFQGVETPSQSRYVGYYEVMKNKFNRQLPPPQSLRIKSLRIHSIAGVGRGDGSDLKVKII------VRGELVFQCVCAQQENCTVFPDAGSNAAVISLQ--NGPVVEGDVKV-MFESSAGLPKGYEDVPFYFWFNTSFVEHN------------------------KLFFPREELDNPHKPKTWNLYKEDFGITVYFL 508          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Medaka
Match: tpte (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 [Source:NCBI gene;Acc:101172265])

HSP 1 Score: 308.916 bits (790), Expect = 1.665e-98
Identity = 152/366 (41.53%), Postives = 224/366 (61.20%), Query Frame = 2
Query:  578 KKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFFI 1675
            K+  K +R + SENKRR+Q  G+DLDL YVTDRVIAMSFPSSG  A YRN I +VA+F ++K+  +YK++NLC E+ YD + F+ +VER  + DHNVP LE++L+F  S REW++   QN+IA+HCKGGKGRTGTM+C  LIDS  F++A+  L+YFG+RRTD  +  KFQGVETPSQ+RYVGY+E +K   + ++P  + L+I+ + I           S++ ++I       +R  ++ +        C V  D  S   ++++   + P +  DVK+  F  +  +P+ Y+   F+FWF+T F+E                          +L   RE+LDNPHK  TWN+Y  +F + ++F+
Sbjct:  136 KELEKVTRRMISENKRRYQKDGFDLDLTYVTDRVIAMSFPSSGKQAFYRNPIKEVARFLDTKHEGHYKVFNLCSEKGYDPQHFHYRVERVFIDDHNVPALEDMLKFTASVREWMSADPQNVIAIHCKGGKGRTGTMVCTWLIDSDQFESAQDSLEYFGERRTDKTRSSKFQGVETPSQSRYVGYYEVMKNKFNRQLPPPQSLRIKSLRIHSIAGVGRGDGSDLKVKII------VRGELVFQCVCAQQENCTVFPDAGSNAAVISLQ--NGPVVEGDVKV-MFESSAGLPKGYEDVPFYFWFNTSFVEHN------------------------KLFFPREELDNPHKPKTWNLYKEDFGITVYFL 468          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Medaka
Match: PTEN (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [Source:NCBI gene;Acc:101173689])

HSP 1 Score: 196.438 bits (498), Expect = 2.534e-56
Identity = 130/372 (34.95%), Postives = 196/372 (52.69%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIE-----DYR---------SDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFF 1672
            + + S NKRRFQ  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YDT  FN +V +Y  +DHN P+LE I  F +   +WL++++ ++ A+HCK GKGRTG MIC +L+  G F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+  + K+     P   L      E          SES  S      + + +  ++ ++++  +P+  +    +E K  LL         +  D+K++FF K  KV +K  +  F FW +T FI       Y+         SDVS     YQ P    +  FL  L+L++ +LD  +K      ++  FKV +FF
Sbjct:    7 KEIVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTTKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENEHHVAAIHCKAGKGRTGVMICAYLLHRGKFREAQEALDFYGEVRT-----RDKKGVTIPSQRRYVVYYNYLLKNRLQYKPVALLFHKMMFETVPMFTVGTCSESG-SGPPLHAHPQFVVYQLKVKIHTSNPAHTR----REDK--LLLFEFPQPLPVCGDIKVEFFHKQNKVMKK--EKMFHFWINTFFIPGPEEASYKLENGSAAPNSDVS--DRTYQNPGDANDKDFLV-LTLTKNELDKANKDKANKNFSPNFKVRLFF 361          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Medaka
Match: ENSORLT00000007833.2 (phosphatase and tensin homolog [Source:NCBI gene;Acc:101171856])

HSP 1 Score: 180.259 bits (456), Expect = 3.200e-50
Identity = 111/305 (36.39%), Postives = 168/305 (55.08%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIE----ITGAQKFYCKSESEISLQIFQGYSEDIRERMII-EMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFI 1498
            + + S NKRR+Q  G+DLDL Y+   +IAM FP+     +YRN+I DV +F +SK+  +YKIYNLC ER YD   FN +V +Y  +DHN P+LE I  F +   +WL++ D ++ A+HCK GKGRTG MIC +L+  G F  A+  L ++G+ RT     +  +GV  PSQ RYV Y+  + K+     P   L      E     +G      K+ SE + Q F+  +     + ++ ++ +   +   + + +E K H+        P    D+K++FF K  K+ +K DK  F FW +T FI
Sbjct:    6 KEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRT-----RDKKGVTIPSQRRYVCYYSYLLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDVKNRSEPTPQGFKKGNWHWDPQFVVYQLKVKIHTSNPLHTRREDK-HMYFEFPQPLPVC-GDIKVEFFHKQNKMMKK-DK-MFHFWVNTFFI 301          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Planmine SMEST
Match: SMESG000060206.1 (SMESG000060206.1)

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 488/518 (94.21%), Postives = 489/518 (94.40%), Query Frame = 2
Query:  140 MENKQIYHVTFDEVDKGLNRDCVDKSKAAARQLTDNXXXXXXXXXXXXXXXXXXXTSFILDEKELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDITLETSTXXXXXXXXXXXXXXXXXXXXXXNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNIYNSEFKVDIFFINDSLVD 1693
            MENKQIYHVTFDEVDKGLNRDCVDKSKAAARQLTDNIAFRIIIIFLILADIGILI SFILD+KELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDITLETSTRARFIIAIRLLRLPRIIGLLLRNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYG NYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQK YCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLL I ILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY                        RLSLSREQLDNPHKKTTWNIYNSEFKVDIFFINDSLVD
Sbjct:    1 MENKQIYHVTFDEVDKGLNRDCVDKSKAAARQLTDNIAFRIIIIFLILADIGILIASFILDKKELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLVDFLVVFVTSVISIVDITLETSTRARFIIAIRLLRLPRIIGLLLRNYKKFIKSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGSNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKIEKIEITGAQKLYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVTSDKESKEHLLKIKILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHTGFIEDY------------------------RLSLSREQLDNPHKKTTWNIYNSEFKVDIFFINDSLVD 494          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Planmine SMEST
Match: SMESG000072902.1 (SMESG000072902.1)

HSP 1 Score: 154.066 bits (388), Expect = 4.514e-41
Identity = 77/184 (41.85%), Postives = 111/184 (60.33%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKS 1150
            R + S+ KRR++  G++LDL YVT R+IAM FP+  F ALYRN I DV+KFF   +   YKIYNLC ER ++   F+ ++ R+   DHN P   +++       ++L     N++A++CK GKGRTG ++C  LI      +A   LQ +G+ RT  L GK   GV  PSQ RY+ Y++   K+
Sbjct:    6 RTIVSKKKRRYKKQGFNLDLSYVTSRIIAMGFPAEKFEALYRNDIDDVSKFFEVNHCGKYKIYNLCRERNFNASKFSGEIARFPFDDHNAPIFTDLVACVNDIAQFLDSCPDNVVAINCKAGKGRTGVIVCCTLIHCENNKDATTALQDYGKSRT--LNGK---GVTIPSQIRYIFYYDHFVKN 184          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Planmine SMEST
Match: SMESG000043909.1 (SMESG000043909.1)

HSP 1 Score: 147.517 bits (371), Expect = 3.171e-38
Identity = 75/181 (41.44%), Postives = 108/181 (59.67%), Query Frame = 2
Query:  599 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIF--NDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFE 1135
            + + S+ K R+   G+DLDL Y+T R+IAM FP+  +  +YRN I DV  FF+ K+  +Y+IYNLC ER  D + F  N    +Y   DHN P   +++E  K  +++L     NI+A+ CK GKGRTG ++C  L+      +A   LQ++G+RRT    GK   GV  PSQ R++ YFE
Sbjct:    6 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRT--TNGK---GVTIPSQIRFIYYFE 181          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Planmine SMEST
Match: SMESG000081891.1 (SMESG000081891.1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.875e-11
Identity = 59/215 (27.44%), Postives = 93/215 (43.26%), Query Frame = 2
Query:  647 DLDLCYVTDRVIAMSFPS-SGFTALYRNSITDVAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYF-----ETIKKSPDFKIPNGKLLKIEKIEITGAQKF-YCKSESEISLQIFQGY 1270
            DL++ YVT R+I M  P  SG  AL R+ I DV  F + ++   Y IYNL   R+  T+ FND+V +             ++        WL    +N+I + C  G+  +G  +   L    + D +   +     RR D     +F    T SQ RY+ Y          +S   +IP+  ++K+  IE+     F   K+     ++IF  Y
Sbjct:  459 DLNITYVTSRIIMMPTPGESGIDALTRDKIEDVQTFLDFRHPNQYYIYNLSL-RSIKTERFNDRVMQLGFDSMKPMSFNNLVSVCIHQLSWLLADAKNVIVIQCTDGRIGSGLNVAALLCFCRLVDTSSAAVNIVKFRRGDC----QF----TSSQLRYIDYICRLMHNISNQSIGPEIPHKFIVKLTGIELEPVPIFNRAKTGVRPYVEIFNDY 664          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPTE28.745e-10238.53transmembrane phosphoinositide 3-phosphatase and t... [more]
TPTE24.305e-9943.01transmembrane phosphoinositide 3-phosphatase and t... [more]
TPTE26.968e-9943.01transmembrane phosphoinositide 3-phosphatase and t... [more]
TPTE26.968e-9943.01transmembrane phosphoinositide 3-phosphatase and t... [more]
TPTE22.047e-9843.01transmembrane phosphoinositide 3-phosphatase and t... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
daf-183.653e-3136.41Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pten1.440e-4831.96gene:FBgn0026379 transcript:FBtr0089902[more]
Pten4.260e-4731.96gene:FBgn0026379 transcript:FBtr0300562[more]
Pten4.260e-4731.96gene:FBgn0026379 transcript:FBtr0301521[more]
Pten4.260e-4731.96gene:FBgn0026379 transcript:FBtr0089900[more]
Pten4.260e-4731.96gene:FBgn0026379 transcript:FBtr0089904[more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpte1.379e-10639.82transmembrane phosphatase with tensin homology [So... [more]
tpte1.379e-10639.82transmembrane phosphatase with tensin homology [So... [more]
ptenb8.985e-5131.99phosphatase and tensin homolog B [Source:ZFIN;Acc:... [more]
ptena4.443e-5034.94phosphatase and tensin homolog A [Source:ZFIN;Acc:... [more]
ptena4.443e-5034.94phosphatase and tensin homolog A [Source:ZFIN;Acc:... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpte21.636e-9939.04transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte23.194e-9939.04transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte29.781e-9939.04transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte27.484e-8536.53transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte21.955e-7139.25transmembrane phosphoinositide 3-phosphatase and t... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpte7.248e-9438.77transmembrane phosphatase with tensin homology [So... [more]
Tpte1.398e-6941.77transmembrane phosphatase with tensin homology [So... [more]
Pten5.201e-5132.88phosphatase and tensin homolog [Source:MGI Symbol;... [more]
Tns13.021e-2533.82tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns13.042e-2533.82tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6XPS3|TPTE2_HUMAN4.200e-10138.53Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
sp|Q4R6N0|TPTE2_MACFA1.317e-9040.05Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
sp|P56180|TPTE_HUMAN1.233e-8636.20Putative tyrosine-protein phosphatase TPTE OS=Homo... [more]
sp|O08586|PTEN_MOUSE3.638e-5032.88Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
sp|P60484|PTEN_HUMAN3.909e-5032.88Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DMK12.456e-12142.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DEJ34.349e-12142.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FVM45.280e-12142.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Y2BQI52.741e-11739.38Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
R7TQR52.393e-11542.35Uncharacterized protein (Fragment) OS=Capitella te... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000007968.23.317e-5032.25phosphatase and tensin homolog [Source:NCBI gene;A... [more]
ENSAMXT00000043891.14.053e-4935.64phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSAMXT00000055423.12.268e-4836.01phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSAMXT00000038725.11.723e-2626.68phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSAMXT00000055284.12.931e-2628.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS14.672e-2130.77tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
ENSPMAT00000005736.15.350e-2028.71pep scaffold:Pmarinus_7.0:GL478791:38400:53446:1 g... [more]
ENSPMAT00000007420.18.277e-2036.62pep scaffold:Pmarinus_7.0:GL480034:173278:177354:1... [more]
ENSPMAT00000009584.13.657e-1932.61pep scaffold:Pmarinus_7.0:GL480473:6650:34123:1 ge... [more]
ENSPMAT00000010485.17.788e-1926.89pep scaffold:Pmarinus_7.0:GL477590:24098:49109:-1 ... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470719.643e-10945.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329014.310e-4932.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457827.216e-3833.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439267.981e-2227.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296144.327e-1139.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpte5.295e-10038.34phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
tpte8.605e-10038.34phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
tpte1.665e-9841.53phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
PTEN2.534e-5634.95phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSORLT00000007833.23.200e-5036.39phosphatase and tensin homolog [Source:NCBI gene;A... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000060206.10.000e+094.21SMESG000060206.1[more]
SMESG000072902.14.514e-4141.85SMESG000072902.1[more]
SMESG000043909.13.171e-3841.44SMESG000043909.1[more]
SMESG000081891.14.875e-1127.44SMESG000081891.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033121 ID=SMED30033121|Name=Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2|organism=Schmidtea mediterranea sexual|type=transcript|length=1782bp
TGAATCGAATCATTGAAATTATGAATTCATCAATTAGGTTATAGTTCACT
GATCGAGATAAATTTACATATTCAGTTGTTAGTTATTCGTTCTAGAATAA
TTGTGCTATCGATTGGATTGAGAGCTTGATTGGAAAAAAATGGAAAACAA
ACAAATTTACCATGTCACTTTCGATGAAGTTGACAAAGGTCTGAATCGAG
ATTGTGTTGATAAATCAAAAGCGGCTGCTAGACAACTCACAGACAATATT
GCGTTTAGGATTATTATAATATTTCTCATTCTGGCTGATATTGGAATTTT
GATCACTTCATTTATATTGGATGAAAAAGAATTAGATTATTTAGCATTTG
GATTTTCTTGCATTTTTCTAATCGAAATTATTTTGCGATTACATGGCATT
GGAATAAAGACGTATTTTTGTAACTGGATCAATCTTGTCGATTTTCTGGT
CGTTTTTGTGACGAGCGTCATATCAATAGTGGATATCACTCTGGAAACGT
CAACACGAGCGCGATTTATAATAGCTATTCGGCTGCTTCGACTGCCTAGA
ATTATTGGTTTATTATTGAGGAATTATAAGAAGTTTATTAAGTCAAGTCG
ACACGTTACATCAGAAAACAAAAGACGATTTCAAAGCGGCGGATATGATT
TAGATCTTTGCTATGTGACCGATCGCGTTATAGCAATGTCCTTTCCGTCA
TCCGGTTTCACCGCATTATATAGAAATTCAATAACGGACGTTGCCAAGTT
TTTCAACAGCAAGTATGGGCCAAACTACAAAATCTATAATTTGTGTGAGG
AAAGAGCATATGATACAAAAATATTCAACGATCAAGTAGAGAGGTACATG
GTTAAGGATCACAATGTTCCACGATTGGAAGAAATACTTGAATTTGCAAA
GAGTTCCAGAGAATGGTTAACTAAATCTGATCAGAACATTATAGCAGTTC
ATTGTAAAGGTGGAAAAGGGCGCACTGGAACAATGATATGTGTACATTTG
ATTGACAGTGGGGTATTTGATAACGCCGAACTCTGCCTCCAATATTTTGG
ACAACGACGAACTGATTTACTTCAAGGCAAAAAGTTTCAAGGAGTTGAAA
CTCCAAGTCAGAATAGGTATGTTGGCTATTTTGAAACCATTAAAAAGTCA
CCAGATTTTAAAATTCCTAACGGGAAATTATTGAAAATTGAAAAAATAGA
AATAACTGGAGCACAGAAATTTTATTGCAAAAGTGAATCGGAAATTTCGT
TGCAAATTTTTCAAGGATATAGCGAGGATATTAGAGAAAGGATGATTATA
GAAATGAATCTTGGTGATCCTTCGAAATGTCAAGTCACTTCCGACAAGGA
ATCTAAAGAACACTTATTAACAATTATGATCTTGGATTGTCCAACACTTC
ATGACGATGTGAAAATCAAGTTTTTTACAAAAAATAAAAAAGTTCCGGAA
AAATATGATAAATGTGCTTTTTTCTTCTGGTTTCATACTGGGTTCATAGA
GGATTACAGGTCAGATGTTAGCTTGTTGCAATTTGCTTATCAGTGTCCAA
CTATCATTATCAACTGCCATTTTTTATTTAGATTATCATTGTCCCGGGAA
CAGCTTGATAATCCACACAAGAAAACAACATGGAATATTTACAACTCTGA
ATTTAAAGTGGATATTTTTTTCATAAATGATTCTTTAGTCGATTAAATTT
TTGCCTTTTTACAATTTATTTTACAGTTTTTTAATAATATTTTCTGTTAT
TTGATTATTGGATTCACACATTTTATTGGTAA
back to top

protein sequence of SMED30033121-orf-1

>SMED30033121-orf-1 ID=SMED30033121-orf-1|Name=SMED30033121-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MENKQIYHVTFDEVDKGLNRDCVDKSKAAARQLTDNIAFRIIIIFLILAD
IGILITSFILDEKELDYLAFGFSCIFLIEIILRLHGIGIKTYFCNWINLV
DFLVVFVTSVISIVDITLETSTRARFIIAIRLLRLPRIIGLLLRNYKKFI
KSSRHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITD
VAKFFNSKYGPNYKIYNLCEERAYDTKIFNDQVERYMVKDHNVPRLEEIL
EFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCL
QYFGQRRTDLLQGKKFQGVETPSQNRYVGYFETIKKSPDFKIPNGKLLKI
EKIEITGAQKFYCKSESEISLQIFQGYSEDIRERMIIEMNLGDPSKCQVT
SDKESKEHLLTIMILDCPTLHDDVKIKFFTKNKKVPEKYDKCAFFFWFHT
GFIEDYRSDVSLLQFAYQCPTIIINCHFLFRLSLSREQLDNPHKKTTWNI
YNSEFKVDIFFINDSLVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR014020Tensin_C2-dom
IPR027359Volt_channel_dom_sf
IPR029021Prot-tyrosine_phosphatase-like
IPR000340Dual-sp_phosphatase_cat-dom
IPR005821Ion_trans_dom
IPR016130Tyr_Pase_AS
IPR029023Tensin_phosphatase
IPR000008C2_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0016311dephosphorylation
GO:0034220ion transmembrane transport
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0005216ion channel activity
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014020Tensin phosphatase, C2 domainSMARTSM01326PTEN_C2_2coord: 343..514
e-value: 7.3E-24
score: 95.3
IPR014020Tensin phosphatase, C2 domainPFAMPF10409PTEN_C2coord: 346..512
e-value: 1.7E-14
score: 53.8
IPR014020Tensin phosphatase, C2 domainPROSITEPS51182C2_TENSINcoord: 340..515
score: 15.997
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 229..317
e-value: 1.6E-6
score: 27.9
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 28..150
e-value: 2.6E-18
score: 67.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.1110coord: 342..516
e-value: 6.1E-31
score: 109.1
NoneNo IPR availablePANTHERPTHR12305PHOSPHATASE WITH HOMOLOGY TO TENSINcoord: 151..514
NoneNo IPR availableCDDcd14510PTP_VSP_TPTEcoord: 158..334
e-value: 9.0484E-102
score: 301.589
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 397..512
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 39..141
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
NoneNo IPR availableTMHMMTMhelixcoord: 69..89
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 38..139
e-value: 1.4E-8
score: 34.2
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 151..337
e-value: 8.9E-72
score: 243.0
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 169..334
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 270..280
IPR029023Tensin-type phosphatase domainPROSITEPS51181PPASE_TENSINcoord: 162..338
score: 33.276