Intermediate filament b

Overview
NameIntermediate filament b
Smed IDSMED30033119
Length (bp)1930
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intermediate filament b (SMED30033119) t-SNE clustered cells

Violin plots show distribution of expression levels for Intermediate filament b (SMED30033119) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intermediate filament b (SMED30033119) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intermediate filament b (SMED30033119) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033119

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal ventral margin of the whole animalSMED30033119h1SMcG0021341 SMED30033119smed_20140614PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
adhesion glandSMED30033119h1SMcG0021341 SMED30033119smed_20140614PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30033119h1SMcG0021341 SmedASXL_019769SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30033119h1SMcG0021341 SmedASXL_019205SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033119h1SMcG0021341 dd_Smed_v4_3065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033119h1SMcG0021341 dd_Smed_v4_7515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30033119h1SMcG0021341 HM135949smed_ncbi_20240424PMID:21295481
Molina et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30033119h1SMcG0021341 H.106.2esmed_ncbi_20240424PMID:25017721
van Wolfswinkel et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30033119h1SMcG0021341 SMED30033119smed_20140614PMID:21295483
Gaviño et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30033119h1SMcG0021341 dd_Smed_v6_7515_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033119h1SMcG0021341 dd_Smed_v6_3065_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30033119h1SMcG0021341 dd_Smed_v4_3065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal progenitor cellSMED30033119h1SMcG0021341 SMED30033119smed_20140614PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30033119h1SMcG0021341 SMED30033119smed_20140614PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30033119h1SMcG0021341 dd_Smed_v4_7515_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intermediate filament b vs. Ensembl Human
Match: LMNB2 (lamin B2 [Source:HGNC Symbol;Acc:HGNC:6638])

HSP 1 Score: 128.642 bits (322), Expect = 1.498e-30
Identity = 150/557 (26.93%), Postives = 263/557 (47.22%), Query Frame = 2
Query:  275 REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTL--------------EDLILEAQTELNDATQL-HLADKETIDKMASTLSD---YEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIF-----ESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQV-------TSVIKGEMSAKTSF----QRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC---SESNWGFGAQIVTVLQNSKGEEKATHT 1834
            R +EK EL++LNDR A+YID+VR LE EN RL  ++ + ++   +E + IK  Y++++   RR LD+    +A+++++I  L              E  +  AQ  + D   L H ++ E    +A+ LSD    E ++A LR +L      K  D   +          K+ LEKETL  +   N  QSL ++++F K +F     E+  R    LV  DS+  +++   +MAQAL ++++++D ++     ++E  Y  K+   + +  Q +      REE    + +L  +  +L  L+ + +  E  +  L   +  +  +F    +   +E+   +  ++  L E Q LLD KL+L++EI AYRK+LEGEE R+    + +   T     +    + ++  +   +   + +V        SV+         F    Q +A G+V+I+E   +GKF+ L+N   +++ +  + ++R    G  +     P K IL      +   +WA G     S         +S+WG G    TVL N+ GEE A  T
Sbjct:   43 RLQEKEELRELNDRLAHYIDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVE----LAAALSDKRGLESDVAELRAQLA-----KAEDGHAVA---------KKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEY-DFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTP-KYILRA---GQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRT 576          
BLAST of Intermediate filament b vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 93.5893 bits (231), Expect = 1.710e-19
Identity = 113/389 (29.05%), Postives = 192/389 (49.36%), Query Frame = 2
Query:  212 SSTPG------ATSNIVHNGVNN-LMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLL---KQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN 1345
            SS PG      +    + + +N    N R  EK ELQ+LNDRFANYIDKVR LE +NK L  EL  LK Q GK  +R+   Y+ +M +LRR +DQ    KA++E++ + L +                                   +I  LR++L           +E+++ +E  N L   +QD++  +L  +    +++SL ++I FLKK+ E E++EL + + +   + + D  + ++  ALRD++ +Y+        + E  Y  K  ++    ++ N    Q ++E+T  + Q+  +   +  L+  N  LER +  +      +   +      L+ E+ N K E+   L E Q LL+ K++L++EI  YRK+LEGEE R++
Sbjct:   72 SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQ-GK--SRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAE-----------------------------------DIMRLREKL----------QEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 412          
BLAST of Intermediate filament b vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 93.5893 bits (231), Expect = 1.710e-19
Identity = 113/389 (29.05%), Postives = 192/389 (49.36%), Query Frame = 2
Query:  212 SSTPG------ATSNIVHNGVNN-LMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLL---KQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN 1345
            SS PG      +    + + +N    N R  EK ELQ+LNDRFANYIDKVR LE +NK L  EL  LK Q GK  +R+   Y+ +M +LRR +DQ    KA++E++ + L +                                   +I  LR++L           +E+++ +E  N L   +QD++  +L  +    +++SL ++I FLKK+ E E++EL + + +   + + D  + ++  ALRD++ +Y+        + E  Y  K  ++    ++ N    Q ++E+T  + Q+  +   +  L+  N  LER +  +      +   +      L+ E+ N K E+   L E Q LL+ K++L++EI  YRK+LEGEE R++
Sbjct:   72 SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQ-GK--SRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAE-----------------------------------DIMRLREKL----------QEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 412          
BLAST of Intermediate filament b vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 92.8189 bits (229), Expect = 2.045e-19
Identity = 115/386 (29.79%), Postives = 192/386 (49.74%), Query Frame = 2
Query:  212 SSTPG------ATSNIVHNGVNN-LMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN 1345
            SS PG      +    + + +N    N R  EK ELQ+LNDRFANYIDKVR LE +NK L  EL  LK Q GK  +R+   Y+ +M +LRR +DQ    KA++E++ + L + I+     L +  Q  +  +E  +   +TL  +  ++                DN  + RL         DLE+          +++SL ++I FLKK+ E E++EL + + +   + + D  + ++  ALRD++ +Y+        + E  Y  K  ++    ++ N    Q ++E+T  + Q+  +   +  L+  N  LER +  +      +   +      L+ E+ N K E+   L E Q LL+ K++L++EI  YRK+LEGEE R++
Sbjct:   72 SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQ-GK--SRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIM----RLREKLQEEMLQREEAE---NTLQSFRQDV----------------DNASLARL---------DLER----------KVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 412          
BLAST of Intermediate filament b vs. Ensembl Human
Match: LMNB1 (lamin B1 [Source:HGNC Symbol;Acc:HGNC:6637])

HSP 1 Score: 88.9669 bits (219), Expect = 6.945e-18
Identity = 86/273 (31.50%), Postives = 143/273 (52.38%), Query Frame = 2
Query:  272 GREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQA--EGAKAQMEM-KINTLEDLIL----EAQTELNDATQLHLADKETI-----DKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVREL-----ASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETV 1039
             R +EK EL++LNDR A YIDKVR+LE EN  L  ++ + ++  G+E   +K  Y+ ++   RR+LD    E AK Q+E+ K     D +L    + +++LN A Q+ L + E         +A+ L D        +K L G + E ++D  +I +L+  L   K+ L  ETL  +   N  QSL + +EF K ++E E+ E        LV  DS    ++   ++AQAL +++ ++D ++     ++E  Y  K++  R + S+ N  TV
Sbjct:   28 SRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGA-QIKLREYEAALNSKDAALATALGD--------KKSLEG-DLEDLKD--QIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEY-EYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLS-SEMNTSTV 286          

HSP 2 Score: 66.6254 bits (161), Expect = 7.976e-11
Identity = 60/201 (29.85%), Postives = 98/201 (48.76%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSV----IKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC---SESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R+             S      VT +  S   +  +T+ +   V     +   S   S   +A GNV I+E   DGKFI L+NT  Q++ + G+ + R   +  +  K+   S+ +L+     +   IWA       S   +    ++++WG G  +  +L+NS+GEE A  +  TV++
Sbjct:  365 DVKLALDMEISAYRKLLEGEEERLKL-----------SPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYT--SRYVLKA---GQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRS--TVFK 547          
BLAST of Intermediate filament b vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 291.197 bits (744), Expect = 4.494e-90
Identity = 210/577 (36.40%), Postives = 351/577 (60.83%), Query Frame = 2
Query:  134 GPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE-----CSESNWGFGAQIVTVLQNSKGEEKATHTQR 1840
            G T   V +Q        EM    G   +P        N  + + + RE+EK E+ DLNDR A+YI+KVR LE +N++L+ +L  L+ +WGK+T  I+  Y+ +++  ++ +D+    +  ME ++  ++D + E + +L DAT+    D+  ID +  TLS+ E EI+ L++R+  LE+E  R  +E  RL  EL   + DL++ETL  I   N++Q+L+++I+FL+++ ++E++EL +L  +D+T EN++F++NE++ A+RDI+ EYD+  +    DME+ Y LK+QEI+T  +++N+E    +EE  RL+ QL+++R +L +LE+RN+ LE+ ++ L  ++E+  R ++   N+   ++   + E + +++ELQ+LLD K +L+ EI  YRKMLEGEE R   K              ++ V +T +I+Q+     T T+   V+KGE +++ SFQR+AKGNV+I E SPDGKFI+L+NT  +++E I  + L+R  D  R  + + +P   +L   GK    KI+AR    QG   P       +E ++G G  + T+L N +GEE+ATH QR
Sbjct:   24 GRTTGNVTSQDRMLKIVTEMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQ------------LVEQVVKTHAITQE-----TDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA-GKT--LKIFARN---QGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 571          
BLAST of Intermediate filament b vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 290.812 bits (743), Expect = 5.066e-90
Identity = 210/577 (36.40%), Postives = 351/577 (60.83%), Query Frame = 2
Query:  134 GPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE-----CSESNWGFGAQIVTVLQNSKGEEKATHTQR 1840
            G T   V +Q        EM    G   +P        N  + + + RE+EK E+ DLNDR A+YI+KVR LE +N++L+ +L  L+ +WGK+T  I+  Y+ +++  ++ +D+    +  ME ++  ++D + E + +L DAT+    D+  ID +  TLS+ E EI+ L++R+  LE+E  R  +E  RL  EL   + DL++ETL  I   N++Q+L+++I+FL+++ ++E++EL +L  +D+T EN++F++NE++ A+RDI+ EYD+  +    DME+ Y LK+QEI+T  +++N+E    +EE  RL+ QL+++R +L +LE+RN+ LE+ ++ L  ++E+  R ++   N+   ++   + E + +++ELQ+LLD K +L+ EI  YRKMLEGEE R   K              ++ V +T +I+Q+     T T+   V+KGE +++ SFQR+AKGNV+I E SPDGKFI+L+NT  +++E I  + L+R  D  R  + + +P   +L   GK    KI+AR    QG   P       +E ++G G  + T+L N +GEE+ATH QR
Sbjct:   16 GRTTGNVTSQDRMLKIVTEMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQ------------LVEQVVKTHAITQE-----TDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA-GKT--LKIFARN---QGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 563          
BLAST of Intermediate filament b vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 290.812 bits (743), Expect = 5.066e-90
Identity = 210/577 (36.40%), Postives = 351/577 (60.83%), Query Frame = 2
Query:  134 GPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE-----CSESNWGFGAQIVTVLQNSKGEEKATHTQR 1840
            G T   V +Q        EM    G   +P        N  + + + RE+EK E+ DLNDR A+YI+KVR LE +N++L+ +L  L+ +WGK+T  I+  Y+ +++  ++ +D+    +  ME ++  ++D + E + +L DAT+    D+  ID +  TLS+ E EI+ L++R+  LE+E  R  +E  RL  EL   + DL++ETL  I   N++Q+L+++I+FL+++ ++E++EL +L  +D+T EN++F++NE++ A+RDI+ EYD+  +    DME+ Y LK+QEI+T  +++N+E    +EE  RL+ QL+++R +L +LE+RN+ LE+ ++ L  ++E+  R ++   N+   ++   + E + +++ELQ+LLD K +L+ EI  YRKMLEGEE R   K              ++ V +T +I+Q+     T T+   V+KGE +++ SFQR+AKGNV+I E SPDGKFI+L+NT  +++E I  + L+R  D  R  + + +P   +L   GK    KI+AR    QG   P       +E ++G G  + T+L N +GEE+ATH QR
Sbjct:   16 GRTTGNVTSQDRMLKIVTEMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQ------------LVEQVVKTHAITQE-----TDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA-GKT--LKIFARN---QGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 563          
BLAST of Intermediate filament b vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 290.812 bits (743), Expect = 5.066e-90
Identity = 210/577 (36.40%), Postives = 351/577 (60.83%), Query Frame = 2
Query:  134 GPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE-----CSESNWGFGAQIVTVLQNSKGEEKATHTQR 1840
            G T   V +Q        EM    G   +P        N  + + + RE+EK E+ DLNDR A+YI+KVR LE +N++L+ +L  L+ +WGK+T  I+  Y+ +++  ++ +D+    +  ME ++  ++D + E + +L DAT+    D+  ID +  TLS+ E EI+ L++R+  LE+E  R  +E  RL  EL   + DL++ETL  I   N++Q+L+++I+FL+++ ++E++EL +L  +D+T EN++F++NE++ A+RDI+ EYD+  +    DME+ Y LK+QEI+T  +++N+E    +EE  RL+ QL+++R +L +LE+RN+ LE+ ++ L  ++E+  R ++   N+   ++   + E + +++ELQ+LLD K +L+ EI  YRKMLEGEE R   K              ++ V +T +I+Q+     T T+   V+KGE +++ SFQR+AKGNV+I E SPDGKFI+L+NT  +++E I  + L+R  D  R  + + +P   +L   GK    KI+AR    QG   P       +E ++G G  + T+L N +GEE+ATH QR
Sbjct:   16 GRTTGNVTSQDRMLKIVTEMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQ------------LVEQVVKTHAITQE-----TDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA-GKT--LKIFARN---QGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 563          
BLAST of Intermediate filament b vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 290.812 bits (743), Expect = 5.550e-90
Identity = 210/577 (36.40%), Postives = 351/577 (60.83%), Query Frame = 2
Query:  134 GPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE-----CSESNWGFGAQIVTVLQNSKGEEKATHTQR 1840
            G T   V +Q        EM    G   +P        N  + + + RE+EK E+ DLNDR A+YI+KVR LE +N++L+ +L  L+ +WGK+T  I+  Y+ +++  ++ +D+    +  ME ++  ++D + E + +L DAT+    D+  ID +  TLS+ E EI+ L++R+  LE+E  R  +E  RL  EL   + DL++ETL  I   N++Q+L+++I+FL+++ ++E++EL +L  +D+T EN++F++NE++ A+RDI+ EYD+  +    DME+ Y LK+QEI+T  +++N+E    +EE  RL+ QL+++R +L +LE+RN+ LE+ ++ L  ++E+  R ++   N+   ++   + E + +++ELQ+LLD K +L+ EI  YRKMLEGEE R   K              ++ V +T +I+Q+     T T+   V+KGE +++ SFQR+AKGNV+I E SPDGKFI+L+NT  +++E I  + L+R  D  R  + + +P   +L   GK    KI+AR    QG   P       +E ++G G  + T+L N +GEE+ATH QR
Sbjct:   24 GRTTGNVTSQDRMLKIVTEMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQ------------LVEQVVKTHAITQE-----TDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA-GKT--LKIFARN---QGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 571          
BLAST of Intermediate filament b vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0346460)

HSP 1 Score: 89.7373 bits (221), Expect = 2.510e-18
Identity = 73/246 (29.67%), Postives = 130/246 (52.85%), Query Frame = 2
Query:  269 NGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETI---DKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQ 997
            + R  EK ELQ+LNDR A YID+VRNLE EN RL+ E+   +D   +ET  IK  ++ ++++ RR LD     +A+ E+ I  L +   E + +L+  T+     +  +   +  A+ L++  ++    RK+L     E +   KE+ RL+++    +++LE+ETL  +   N +QSL +++ F  +I   E+            E++   + E ++    + +EYD KL     ++ AQY  ++Q
Sbjct:   49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEI-----------NESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQ 280          

HSP 2 Score: 76.6406 bits (187), Expect = 3.291e-14
Identity = 63/198 (31.82%), Postives = 93/198 (46.97%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTI-------LEPTGKNRYYKIWARGNRPQGSGDPECS----ESNWGFGAQIVTVLQNSKGEEKA 1825
            D K+SL+LEI AY K+L GEE R+N     N         ++ + TR + S++  + + K +   V + E  +   +    +AKGNV I+E  P+GKF+ L N GS+E  I G+ LQR       +I    PS T        +EP G      +W+   +   S +P  S       W       T+L NS+GE  A
Sbjct:  387 DIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQR-------LINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572          
BLAST of Intermediate filament b vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307059)

HSP 1 Score: 89.7373 bits (221), Expect = 2.510e-18
Identity = 73/246 (29.67%), Postives = 130/246 (52.85%), Query Frame = 2
Query:  269 NGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETI---DKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQ 997
            + R  EK ELQ+LNDR A YID+VRNLE EN RL+ E+   +D   +ET  IK  ++ ++++ RR LD     +A+ E+ I  L +   E + +L+  T+     +  +   +  A+ L++  ++    RK+L     E +   KE+ RL+++    +++LE+ETL  +   N +QSL +++ F  +I   E+            E++   + E ++    + +EYD KL     ++ AQY  ++Q
Sbjct:   49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEI-----------NESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQ 280          

HSP 2 Score: 76.6406 bits (187), Expect = 3.291e-14
Identity = 63/198 (31.82%), Postives = 93/198 (46.97%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTI-------LEPTGKNRYYKIWARGNRPQGSGDPECS----ESNWGFGAQIVTVLQNSKGEEKA 1825
            D K+SL+LEI AY K+L GEE R+N     N         ++ + TR + S++  + + K +   V + E  +   +    +AKGNV I+E  P+GKF+ L N GS+E  I G+ LQR       +I    PS T        +EP G      +W+   +   S +P  S       W       T+L NS+GE  A
Sbjct:  387 DIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQR-------LINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572          
BLAST of Intermediate filament b vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307058)

HSP 1 Score: 89.7373 bits (221), Expect = 2.510e-18
Identity = 73/246 (29.67%), Postives = 130/246 (52.85%), Query Frame = 2
Query:  269 NGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETI---DKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQ 997
            + R  EK ELQ+LNDR A YID+VRNLE EN RL+ E+   +D   +ET  IK  ++ ++++ RR LD     +A+ E+ I  L +   E + +L+  T+     +  +   +  A+ L++  ++    RK+L     E +   KE+ RL+++    +++LE+ETL  +   N +QSL +++ F  +I   E+            E++   + E ++    + +EYD KL     ++ AQY  ++Q
Sbjct:   49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEI-----------NESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQ 280          

HSP 2 Score: 76.6406 bits (187), Expect = 3.291e-14
Identity = 63/198 (31.82%), Postives = 93/198 (46.97%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTI-------LEPTGKNRYYKIWARGNRPQGSGDPECS----ESNWGFGAQIVTVLQNSKGEEKA 1825
            D K+SL+LEI AY K+L GEE R+N     N         ++ + TR + S++  + + K +   V + E  +   +    +AKGNV I+E  P+GKF+ L N GS+E  I G+ LQR       +I    PS T        +EP G      +W+   +   S +P  S       W       T+L NS+GE  A
Sbjct:  387 DIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQR-------LINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572          
BLAST of Intermediate filament b vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0079100)

HSP 1 Score: 89.7373 bits (221), Expect = 2.510e-18
Identity = 73/246 (29.67%), Postives = 130/246 (52.85%), Query Frame = 2
Query:  269 NGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETI---DKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQ 997
            + R  EK ELQ+LNDR A YID+VRNLE EN RL+ E+   +D   +ET  IK  ++ ++++ RR LD     +A+ E+ I  L +   E + +L+  T+     +  +   +  A+ L++  ++    RK+L     E +   KE+ RL+++    +++LE+ETL  +   N +QSL +++ F  +I   E+            E++   + E ++    + +EYD KL     ++ AQY  ++Q
Sbjct:   49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEI-----------NESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQ 280          

HSP 2 Score: 76.6406 bits (187), Expect = 3.291e-14
Identity = 63/198 (31.82%), Postives = 93/198 (46.97%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTI-------LEPTGKNRYYKIWARGNRPQGSGDPECS----ESNWGFGAQIVTVLQNSKGEEKA 1825
            D K+SL+LEI AY K+L GEE R+N     N         ++ + TR + S++  + + K +   V + E  +   +    +AKGNV I+E  P+GKF+ L N GS+E  I G+ LQR       +I    PS T        +EP G      +W+   +   S +P  S       W       T+L NS+GE  A
Sbjct:  387 DIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQR-------LINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572          
BLAST of Intermediate filament b vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0333166)

HSP 1 Score: 86.6557 bits (213), Expect = 2.274e-17
Identity = 78/275 (28.36%), Postives = 141/275 (51.27%), Query Frame = 2
Query:  212 SSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTL----EDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDF----WRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTT 1012
            SS  GATS       +     R++EK ELQ LNDR A YID++RNLE+EN RL+ EL   +D   +ET+ +K  Y+ ++   R+ LD+    KA++E+ I  L    +DL      +  +AT      +   ++       Y   +A+ RK+     +E   +N+   RL+ +L+ L++ LE ETL  +   N+ QSL +++ F  ++   E+ E  S    + +E        +  ++ Q+L++++ +Y+ ++     ++E  Y  +IQ ++  
Sbjct:   27 SSRVGATS-----PTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD-RKKFEDQAKELALENE---RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAA 292          

HSP 2 Score: 57.7658 bits (138), Expect = 2.717e-8
Identity = 45/151 (29.80%), Postives = 69/151 (45.70%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQ-HAAPSTKTQVTSVIKGEMSAKT----------------SFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTI 1672
            D K+SL+LEI AY K+L GEE R+N +S               H+T ++ S+     PS +   T  I G  + K                 S    AKG++ I E   +G+FI L N G++E +++G+ L R   +  +  K    SK +
Sbjct:  379 DIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVL 529          
BLAST of Intermediate filament b vs. Ensembl Zebrafish
Match: lmnb1 (lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2])

HSP 1 Score: 97.0561 bits (240), Expect = 1.537e-20
Identity = 87/309 (28.16%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  188 EMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTL----EDL----------ILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRD-NKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEV-----RELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREE 1054
            + S S G SSTP + + I           R +EK ELQ LNDR A YID VR+LE EN  L  ++ + +D   +E   ++T Y+ ++   R++LD     +A++++++  +    E L          +  +Q  L D   L  A +  ++   S     E+ +++L+ R+     + V D +  +++L+  L   K+ L  ETL  +   N  QSL++++EF K +FE E+     R    LV  DS    ++   ++AQAL D++ ++D ++     +ME  Y  K++ IR +    +      REE
Sbjct:   11 QQSLSRGTSSTPLSPARI----------SRLQEKEELQQLNDRLAAYIDTVRSLESENSVLQIQIREREDVRNRELTGLRTLYETELADARKALDDTARERARLQIELGKIKSEQEQLQHTYAKKDADLTSSQNRLKDVEALLNAKEAALNTAVSERKTLENTLSDLQIRVQEQNSDAVCDLSVCVIKLEGGLISAKKQLSDETLLRVDLENRCQSLMEELEFRKNMFEEEIKDTRRRHETRLVEVDSGRQMEY-EFKLAQALTDMRQQHDEQVKLYKEEMEQTYVSKLENIRLSSEMNSSSASMAREE 308          

HSP 2 Score: 63.5438 bits (153), Expect = 4.928e-10
Identity = 61/202 (30.20%), Postives = 91/202 (45.05%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSV----IKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE----CSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R+             S      VT +  S   +  +T+ +   V     +   S   +   +A GNV+I E   DGKFI L N   Q++ ++G+ L R    G +   +   +K  L+   K     IWA  N    S  P      ++ +WG G  I   L +  GEE A  +  TV++
Sbjct:  381 DVKLALDMEINAYRKLLEGEEERLKL-----------SPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSIAHSASATGNVSIDELDVDGKFIRLHNNSEQDQPMAGFQLTRTI--GEVTATYKFTAKYNLKAGQK---VTIWA-SNAGISSNPPADLIWKNQPSWGTGENIKVALLSPAGEEVAVRS--TVFK 563          
BLAST of Intermediate filament b vs. Ensembl Zebrafish
Match: lmnb1 (lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2])

HSP 1 Score: 93.2041 bits (230), Expect = 3.452e-20
Identity = 84/291 (28.87%), Postives = 146/291 (50.17%), Query Frame = 2
Query:  194 SKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTL----EDL----------ILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRD-NKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEV-----RELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIR 1006
            S S G SSTP + + I           R +EK ELQ LNDR A YID VR+LE EN  L  ++ + +D   +E   ++T Y+ ++   R++LD     +A++++++  +    E L          +  +Q  L D   L  A +  ++   S     E+ +++L+ R+     + V D +  +++L+  L   K+ L  ETL  +   N  QSL++++EF K +FE E+     R    LV  DS    + +  ++AQAL D++ ++D ++     +ME  Y  K++ IR
Sbjct:   13 SLSRGTSSTPLSPARI----------SRLQEKEELQQLNDRLAAYIDTVRSLESENSVLQIQIREREDVRNRELTGLRTLYETELADARKALDDTARERARLQIELGKIKSEQEQLQHTYAKKDADLTSSQNRLKDVEALLNAKEAALNTAVSERKTLENTLSDLQIRVQEQNSDAVCDLSVCVIKLEGGLISAKKQLSDETLLRVDLENRCQSLMEELEFRKNMFEEEIKDTRRRHETRLVEVDSGRQME-YEFKLAQALTDMRQQHDEQVKLYKEEMEQTYVSKLENIR 292          
BLAST of Intermediate filament b vs. Ensembl Zebrafish
Match: lmnb1 (lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2])

HSP 1 Score: 92.8189 bits (229), Expect = 3.125e-19
Identity = 85/308 (27.60%), Postives = 145/308 (47.08%), Query Frame = 2
Query:  188 EMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTL----EDL----------ILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEV-----RELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREE 1054
            + S S G SSTP + + I           R +EK ELQ LNDR A YID VR+LE EN  L  ++ + +D   +E   ++T Y+ ++   R++LD     +A++++++  +    E L          +  +Q  L D   L  A +  ++   S     E+ +++L+ R+  LE   +   K+              L  ETL  +   N  QSL++++EF K +FE E+     R    LV  DS    ++   ++AQAL D++ ++D ++     +ME  Y  K++ IR +    +      REE
Sbjct:   11 QQSLSRGTSSTPLSPARI----------SRLQEKEELQQLNDRLAAYIDTVRSLESENSVLQIQIREREDVRNRELTGLRTLYETELADARKALDDTARERARLQIELGKIKSEQEQLQHTYAKKDADLTSSQNRLKDVEALLNAKEAALNTAVSERKTLENTLSDLQIRVQELEGGLISAKKQ--------------LSDETLLRVDLENRCQSLMEELEFRKNMFEEEIKDTRRRHETRLVEVDSGRQMEY-EFKLAQALTDMRQQHDEQVKLYKEEMEQTYVSKLENIRLSSEMNSSSASMAREE 293          

HSP 2 Score: 63.929 bits (154), Expect = 4.000e-10
Identity = 61/202 (30.20%), Postives = 91/202 (45.05%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSV----IKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE----CSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R+             S      VT +  S   +  +T+ +   V     +   S   +   +A GNV+I E   DGKFI L N   Q++ ++G+ L R    G +   +   +K  L+   K     IWA  N    S  P      ++ +WG G  I   L +  GEE A  +  TV++
Sbjct:  366 DVKLALDMEINAYRKLLEGEEERLKL-----------SPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSIAHSASATGNVSIDELDVDGKFIRLHNNSEQDQPMAGFQLTRTI--GEVTATYKFTAKYNLKAGQK---VTIWA-SNAGISSNPPADLIWKNQPSWGTGENIKVALLSPAGEEVAVRS--TVFK 548          
BLAST of Intermediate filament b vs. Ensembl Zebrafish
Match: lmnb1 (lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2])

HSP 1 Score: 92.8189 bits (229), Expect = 3.125e-19
Identity = 85/308 (27.60%), Postives = 145/308 (47.08%), Query Frame = 2
Query:  188 EMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTL----EDL----------ILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEV-----RELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREE 1054
            + S S G SSTP + + I           R +EK ELQ LNDR A YID VR+LE EN  L  ++ + +D   +E   ++T Y+ ++   R++LD     +A++++++  +    E L          +  +Q  L D   L  A +  ++   S     E+ +++L+ R+  LE   +   K+              L  ETL  +   N  QSL++++EF K +FE E+     R    LV  DS    ++   ++AQAL D++ ++D ++     +ME  Y  K++ IR +    +      REE
Sbjct:   11 QQSLSRGTSSTPLSPARI----------SRLQEKEELQQLNDRLAAYIDTVRSLESENSVLQIQIREREDVRNRELTGLRTLYETELADARKALDDTARERARLQIELGKIKSEQEQLQHTYAKKDADLTSSQNRLKDVEALLNAKEAALNTAVSERKTLENTLSDLQIRVQELEGGLISAKKQ--------------LSDETLLRVDLENRCQSLMEELEFRKNMFEEEIKDTRRRHETRLVEVDSGRQMEY-EFKLAQALTDMRQQHDEQVKLYKEEMEQTYVSKLENIRLSSEMNSSSASMAREE 293          

HSP 2 Score: 63.929 bits (154), Expect = 4.000e-10
Identity = 61/202 (30.20%), Postives = 91/202 (45.05%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSV----IKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE----CSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R+             S      VT +  S   +  +T+ +   V     +   S   +   +A GNV+I E   DGKFI L N   Q++ ++G+ L R    G +   +   +K  L+   K     IWA  N    S  P      ++ +WG G  I   L +  GEE A  +  TV++
Sbjct:  366 DVKLALDMEINAYRKLLEGEEERLKL-----------SPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSIAHSASATGNVSIDELDVDGKFIRLHNNSEQDQPMAGFQLTRTI--GEVTATYKFTAKYNLKAGQK---VTIWA-SNAGISSNPPADLIWKNQPSWGTGENIKVALLSPAGEEVAVRS--TVFK 548          
BLAST of Intermediate filament b vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 91.6633 bits (226), Expect = 8.004e-19
Identity = 84/282 (29.79%), Postives = 150/282 (53.19%), Query Frame = 2
Query:  218 TPGATSNIVHNGVNNLMN----GREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEI----ANLRKRLG---GLEEEKVRDNK-EIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVREL-----ASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTT 1012
            TPG   +    GV N+++     R +EK +L +LNDR A YIDKVR+LE EN  L   + + + +  +E + +K  Y+ ++   R++LD     +A+++++++     + E   EL        AD E+     + L D E  +    A+L   LG    LE E VRD K ++ +L+  LN  K+ L+ E L  + A N +Q+L +++EF K I+  E+RE      + +V  DS   +D+  +++A AL D++ +++ +L     ++E  Y  K++  R++
Sbjct:    3 TPGQKRS-SRGGVTNVLSPTRISRLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSK----VREDYKELKARNGKKEADLES---ALARLKDLESLLNSKDASLSTALGEKRTLEVE-VRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRVVEIDSGRQQDY-ESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSS 274          

HSP 2 Score: 70.4774 bits (171), Expect = 3.417e-12
Identity = 62/215 (28.84%), Postives = 102/215 (47.44%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYR--------------VNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMS-AKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC-----SESNWGFGAQIVTVLQNSKGEEKATH-TQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R              V R S    +   R V +    T +  +++       +  +SV+ G ++  + S Q +A G VT+ E   +GKF+ L N   Q++ +  + ++R   +G  ++ +  P K  L+     +   IWA G    G+  P       ++++WG G    T L +S GEE A     RT++Q
Sbjct:  361 DIKLALDMEISAYRKLLEGEEERLRLSPSPPPARGVTVTRSSGSGSHT--RVVQSSTSRTSSGSAKKRRLNDNDSDASSVVGGTVTRTRISQQASASGRVTVDEVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIV-YKFPPKFNLKA---GQTVTIWAAG--AGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMAMRKVTRTLFQ 567          
BLAST of Intermediate filament b vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 115.931 bits (289), Expect = 1.334e-26
Identity = 146/554 (26.35%), Postives = 270/554 (48.74%), Query Frame = 2
Query:  212 SSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELN-------LLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELAS-----LVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQ-VTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHT 1834
            +STP + + I           R +EK EL+ LNDR A YID+VR+LE EN RL  ++ + ++   +E + IK  Y++++   R+ LD+    +A++++++          +++L++ T+ +      +      + D E         LG    EK     E+  L+ +L+       + K+ LEKETL  +   N +QSL ++++F K I+E E RE        +V  D     D+  +++AQAL +++ ++D ++     ++E  Y  K+  I+ +    +      REE T  + ++  +  +L  L+ + N  E  +  L + +     ++    ++  KE+   + +++  L E Q LLD KL+L++EI AYRK+LEGEE R+       L+ + +S  T+   T +S S    + S + + VTS          S Q +A G+++I+E   +GK++ L+N   +++ +  + L+R       ++    P K +L+     + Y   A       S     ++S WG G+ I T L N++ EE A  T
Sbjct:    8 TSTPLSPTRI----------SRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKF-------RSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDY-DSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERL------KLSPSPQSRVTVSRATSSSSSATRTSRSKRNRTVTSGQGSSTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTP-KYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAVRT 536          
BLAST of Intermediate filament b vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 114.005 bits (284), Expect = 5.966e-26
Identity = 144/553 (26.04%), Postives = 269/553 (48.64%), Query Frame = 2
Query:  212 SSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELN-------LLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELAS-----LVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHT 1834
            +STP + + I           R +EK EL+ LNDR A YID+VR+LE EN RL  ++ + ++   +E + IK  Y++++   R+ LD+    +A++++++          +++L++ T+ +      +      + D E         LG    EK     E+  L+ +L+       + K+ LEKETL  +   N +QSL ++++F K I+E E RE        +V  D     D+  +++AQAL +++ ++D ++     ++E  Y  K+  I+ +    +      REE T  + ++  +  +L  L+ + N  E  +  L + +     ++    ++  KE+   + +++  L E Q LLD KL+L++EI AYRK+LEGEE R+       L+ + +S  T+   T +S S       +K + T   +  +S + S    A G+++I+E   +GK++ L+N   +++ +  + L+R       ++    P K +L+     + Y   A       S     ++S WG G+ I T L N++ EE A  T
Sbjct:   21 TSTPLSPTRI----------SRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKF-------RSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDY-DSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERL------KLSPSPQSRVTVSRAT-SSSSSATRTSRSKRKRTGFTRFHLSQQAS----ATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTP-KYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAVRT 543          
BLAST of Intermediate filament b vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 114.005 bits (284), Expect = 8.040e-26
Identity = 152/584 (26.03%), Postives = 279/584 (47.77%), Query Frame = 2
Query:  164 GGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELN-------LLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELAS-----LVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVT-----------SVIKGEMSAKTSF----QRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHT 1834
            G S   T  M      +STP + + I           R +EK EL+ LNDR A YID+VR+LE EN RL  ++ + ++   +E + IK  Y++++   R+ LD+    +A++++++          +++L++ T+ +      +      + D E         LG    EK     E+  L+ +L+       + K+ LEKETL  +   N +QSL ++++F K I+E E RE        +V  D     D+  +++AQAL +++ ++D ++     ++E  Y  K+  I+ +    +      REE T  + ++  +  +L  L+ + N  E  +  L + +     ++    ++  KE+   + +++  L E Q LLD KL+L++EI AYRK+LEGEE R+       L+ + +S  T+   T +S S    + S + +V            +V  G+ S+ T F    Q +A G+++I+E   +GK++ L+N   +++ +  + L+R       ++    P K +L+     + Y   A       S     ++S WG G+ I T L N++ EE A  T
Sbjct:    3 GRSRSGTSSMQSPARGTSTPLSPTRI----------SRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKF-------RSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDY-DSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERL------KLSPSPQSRVTVSRATSSSSSATRTSRSKRKRVEEEYEEGGGSSRTVTSGQGSS-TRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTP-KYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAVRT 560          
BLAST of Intermediate filament b vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 112.464 bits (280), Expect = 2.441e-25
Identity = 145/581 (24.96%), Postives = 268/581 (46.13%), Query Frame = 2
Query:  212 SSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELN-------LLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELAS-----LVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRV----------------------------NRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHT 1834
            +STP + + I           R +EK EL+ LNDR A YID+VR+LE EN RL  ++ + ++   +E + IK  Y++++   R+ LD+    +A++++++          +++L++ T+ +      +      + D E         LG    EK     E+  L+ +L+       + K+ LEKETL  +   N +QSL ++++F K I+E E RE        +V  D     D+  +++AQAL +++ ++D ++     ++E  Y  K+  I+ +    +      REE T  + ++  +  +L  L+ + N  E  +  L + +     ++    ++  KE+   + +++  L E Q LLD KL+L++EI AYRK+LEGEE R+                             RK  +   + G +   +   T   +S   A+  +   VTS          S Q +A G+++I+E   +GK++ L+N   +++ +  + L+R       ++    P K +L+     + Y   A       S     ++S WG G+ I T L N++ EE A  T
Sbjct:   21 TSTPLSPTRI----------SRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKF-------RSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDY-DSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVTVSRATSSSSSATRTSRSKRKRVEEEYEEGGAGTGLHTGTSLGLSHITASEGSSRTVTSGQGSSTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTP-KYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAVRT 582          
BLAST of Intermediate filament b vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 112.079 bits (279), Expect = 2.985e-25
Identity = 142/553 (25.68%), Postives = 266/553 (48.10%), Query Frame = 2
Query:  212 SSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELN-------LLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELAS-----LVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHT 1834
            +STP + + I           R +EK EL+ LNDR A YID+VR+LE EN RL  ++ + ++   +E + IK  Y++++   R+ LD+    +A++++++          +++L++ T+ +      +      + D E         LG    EK     E+  L+ +L+       + K+ LEKETL  +   N +QSL ++++F K I+E E RE        +V  D     D+  +++AQAL +++ ++D ++     ++E  Y  K+  I+ +    +      REE T  + ++  +  +L  L+ + N  E  +  L + +     ++    ++  KE+   + +++  L E Q LLD KL+L++EI AYRK+LEGEE R+       L+ + +S  T+   T +S S    + S +  +T+               A G+++I+E   +GK++ L+N   +++ +  + L+R       ++    P K +L+     + Y   A       S     ++S WG G+ I T L N++ EE A  T
Sbjct:   21 TSTPLSPTRI----------SRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKF-------RSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDY-DSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERL------KLSPSPQSRVTVSRATSSSSSATRTSRSKRNHITAS-------------EATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTP-KYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAVRT 535          
BLAST of Intermediate filament b vs. Ensembl Mouse
Match: Lmnb2 (lamin B2 [Source:MGI Symbol;Acc:MGI:96796])

HSP 1 Score: 132.88 bits (333), Expect = 4.311e-32
Identity = 159/590 (26.95%), Postives = 274/590 (46.44%), Query Frame = 2
Query:  215 STPGATSNIV----HNGVNNLMN----GREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEA-------QTELNDATQLHLADKETI-----DKMASTLSD---YEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIF-----ESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVT---------------------RTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC---SESNWGFGAQIVTVLQNSKGEEKAT 1828
            S   ATS +     H G    ++     R +EK EL++LNDR A+YID+VR LE EN RL   + + ++   +E + IKT Y++++   RR LD+    +A+++++I  ++  + EA       + EL  A Q  + D E++      ++A+ LSD    E E+A LR +L      K  D   +          K+ LEKETL  +   N  QSL +++ F K +F     E+  R    LV  DS+  +++   +MAQAL D+++++D ++     ++E  Y  K+   +    Q +      REE    + ++  +  +L  L+ + +  E  +  L   +  +  +F    +   +E+   +  ++  L E Q LLD KL+L++EI AYRK+LEGEE R+       L+ +  S  T+   T                     R        +PS  ++V+S       ++ + Q  A G V I E  P+G+F+ L+N+  +++ +  + ++R    G  +     P K +L      +   +WA G     S        S++NWG G    T L ++ GEE A 
Sbjct:   12 SPAAATSAMASLPPHAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVA-QGRVKDLESLFHRSEAELATALSDKQGLETEVAELRAQLA-----KAEDGHAVA---------KKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEY-DFKMAQALEDLRSQHDEQVRLYRVELEQTYQAKLDNAKLLSDQNDKAAHAAREELKEARMRVESLSYQLLGLQKQASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEERL------KLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSPSRASRVSS------GSRLAQQTVATGVVNIDEVDPEGRFVRLKNSSDKDQSLGNWRIKRQVLEGEDIAYKFTP-KYVLRA---GQTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVAV 569          
BLAST of Intermediate filament b vs. Ensembl Mouse
Match: Lmnb2 (lamin B2 [Source:MGI Symbol;Acc:MGI:96796])

HSP 1 Score: 131.724 bits (330), Expect = 8.799e-32
Identity = 153/562 (27.22%), Postives = 265/562 (47.15%), Query Frame = 2
Query:  275 REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQT-------ELNDATQLHLADKETI-----DKMASTLSD---YEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIF-----ESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVT---------------------RTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC---SESNWGFGAQIVTVLQNSKGEEKAT 1828
            R +EK EL++LNDR A+YID+VR LE EN RL   + + ++   +E + IKT Y++++   RR LD+    +A+++++I  ++  + EA+        EL  A Q  + D E++      ++A+ LSD    E E+A LR +L      K  D   +          K+ LEKETL  +   N  QSL +++ F K +F     E+  R    LV  DS+  +++   +MAQAL D+++++D ++     ++E  Y  K+   +    Q +      REE    + ++  +  +L  L+ + +  E  +  L   +  +  +F    +   +E+   +  ++  L E Q LLD KL+L++EI AYRK+LEGEE R+       L+ +  S  T+   T                     R        +PS  ++V+S       ++ + Q  A G V I E  P+G+F+ L+N+  +++ +  + ++R    G  +     P K +L      +   +WA G     S        S++NWG G    T L ++ GEE A 
Sbjct:   21 RLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVA-QGRVKDLESLFHRSEAELATALSDKQGLETEVAELRAQLA-----KAEDGHAVA---------KKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEY-DFKMAQALEDLRSQHDEQVRLYRVELEQTYQAKLDNAKLLSDQNDKAAHAAREELKEARMRVESLSYQLLGLQKQASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEERL------KLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSPSRASRVSS------GSRLAQQTVATGVVNIDEVDPEGRFVRLKNSSDKDQSLGNWRIKRQVLEGEDIAYKFTP-KYVLRA---GQTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVAV 550          
BLAST of Intermediate filament b vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 90.5077 bits (223), Expect = 8.694e-19
Identity = 112/386 (29.02%), Postives = 190/386 (49.22%), Query Frame = 2
Query:  212 SSTPG------ATSNIVHNGVNN-LMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN 1345
            SS PG      +    + + +N    N R  EK ELQ+LNDRFANYIDKVR LE +NK L  EL  LK   G+  +R+   Y+ +M +LRR +DQ    KA++E++ + L + I+     L +  Q  +  +E  +   STL  +  ++                DN  + RL         DLE+          +++SL ++I FLKK+ + E++EL + + +   + + D  + ++  ALRD++ +Y+        + E  Y  K  ++    ++ N    Q ++E+   + Q+  +   +  L+  N  LER +  +      +   +      L+ E+ N K E+   L E Q LL+ K++L++EI  YRK+LEGEE R++
Sbjct:   72 SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLK---GQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIM----RLREKLQEEMLQREEAE---STLQSFRQDV----------------DNASLARL---------DLER----------KVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 412          
BLAST of Intermediate filament b vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 90.8929 bits (224), Expect = 8.760e-19
Identity = 114/386 (29.53%), Postives = 191/386 (49.48%), Query Frame = 2
Query:  212 SSTPG------ATSNIVHNGVNN-LMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN 1345
            SS PG      +    + + +N    N R  EK ELQ+LNDRFANYIDKVR LE +NK L  EL  LK Q GK  +R+   Y+ +M +LRR +DQ    KA++E++ + L + I+     L +  Q  +  +E  +   STL  +  ++                DN  + RL         DLE+          +++SL ++I FLKK+ + E++EL + + +   + + D  + ++  ALRD++ +Y+        + E  Y  K  ++    ++ N    Q ++E+   + Q+  +   +  L+  N  LER +  +      +   +      L+ E+ N K E+   L E Q LL+ K++L++EI  YRK+LEGEE R++
Sbjct:   72 SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQ-GK--SRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIM----RLREKLQEEMLQREEAE---STLQSFRQDV----------------DNASLARL---------DLER----------KVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 412          
BLAST of Intermediate filament b vs. Ensembl Mouse
Match: Lmnb1 (lamin B1 [Source:MGI Symbol;Acc:MGI:96795])

HSP 1 Score: 87.4261 bits (215), Expect = 1.513e-17
Identity = 85/273 (31.14%), Postives = 144/273 (52.75%), Query Frame = 2
Query:  272 GREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQA--EGAKAQMEM-KINTLEDLIL----EAQTELNDATQLHLADKETI-----DKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVREL-----ASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETV 1039
             R +EK EL++LNDR A YIDKVR+LE EN  L  ++ + ++  G+E   +K  Y+ ++   RR+LD    E AK Q+E+ K     D +L    + +++L+ A Q+ L + E         +A+ L D        +K L G + E ++D  +I +L+  L+  K+ L  ETL  +   N  QSL + +EF K ++E E+ E        LV  DS    ++   ++AQAL +++ ++D ++     ++E  Y  K++  R + S+ N  TV
Sbjct:   29 SRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLLNYAKKESDLSGA-QIKLREYEAALNSKDAALATALGD--------KKSLEG-DLEDLKD--QIAQLEASLSAAKKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEY-EYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLS-SEMNTSTV 287          

HSP 2 Score: 66.2402 bits (160), Expect = 8.397e-11
Identity = 59/201 (29.35%), Postives = 98/201 (48.76%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSV----IKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC---SESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R+             S      VT +  S   +  +T+ +   V     +   S   S   +A GNV I+E   DGKFI L+NT  Q++ + G+ + R   +  +  K+   S+ +L+     +   +WA       S   +    ++++WG G  +  +L+NS+GEE A  +  TV++
Sbjct:  366 DVKLALDMEISAYRKLLEGEEERLKL-----------SPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYT--SRYVLKA---GQTVTVWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRS--TVFK 548          
BLAST of Intermediate filament b vs. UniProt/SwissProt
Match: sp|Q01241|NF70_DORPE (70 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 8.545e-112
Identity = 245/597 (41.04%), Postives = 384/597 (64.32%), Query Frame = 2
Query:   83 PPIQP-ISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAA--PSTKTQVT-SVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESN--WGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
              I P  SGY N   +   P  S++G+   +  R+ + S  YG ++ PG  +NI   GVN++   RE+EK +++DLN+RFANYI+KVR LE +NK+L+ EL +LK +WGKET+ IK  Y+ ++ + R+ +D     K  +++++  L D +   Q +L ++   H  D+E I +    L+D E EI+ LR+ +  LE+EK+R +  + ++ +E+  ++ DL  ET+ H+ A N  Q+L +++EF K +   E++ELA+L Y+D+T EN++FWRNE+AQA+RDIQ EYD K D +  D+EA Y LK+QE RT  +++N+E  + +EENT+LK  + E+RNRL +LEARN +LER  + L R++EEK+R+ +LE    ++E+   + E+E IL ELQ L+D KLSLELEI AYRK+LEGEE RV  K  Q + Q   +      V  T +++       +  +Q++  +++GE++AKT++QRT+KG+V+I+E    G FI LE    +EE+++G+ + R  D+ + V  + IP+  ++  TG     KIW++ ++ Q  GD   S  N  WG G+ +VT+LQN KGE+KA +TQ TVYQ
Sbjct:   33 AKIHPRTSGYINR--SSQSPFRSSMGS-NAAYTRSYDFS--YGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMK--QIVEQVVGARPNEAEVLSTILTRSEGGYEATGDSQISMKMMRGELAAKTTYQRTSKGSVSIKEADSQGCFIALET--KKEENLTGWKIVRKVDDNK-VYTYEIPN--LVLKTGT--VVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQNTVYQ 615          
BLAST of Intermediate filament b vs. UniProt/SwissProt
Match: sp|P23731|IFEB_ASCSU (Intermediate filament protein B OS=Ascaris suum OX=6253 PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.542e-93
Identity = 214/594 (36.03%), Postives = 346/594 (58.25%), Query Frame = 2
Query:   89 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGS--GDPEC----SESNWGFGAQIVTVLQNSKGEEKATHTQRTV 1846
            IQP +  R    +R     ST    GG   R ++M    G +S  G +  +  N   + +   +KEK E+Q LNDR  NYID+V+ LE++N++L  +L +L+ +WGK+T+ IK  Y + +   R+ +D     KA++++K+  L D + E +    D      +D+E I++    + D + E+  LR R   L EE+ R N +  R+ EEL   + DL++ETL  I   N++Q+L++++EFL+++ E EV+EL +L+ +   + ++F++NE+A A+RDI+ EYD        DME+ Y LK+ E++ + ++ N+E+   REE  R++D + ++R +L +LEA+N  LE+ ++ L  ++ +  R+++   N+    L   + E + ++ ELQ LLD K  L+ EI  YRKMLEGEE RV  +              ++ V +T S+ QQ    ST+      ++GE+S KT+FQR+AKGNVTI EC P+GKFI LENT  S++E++  + L+R  DN R ++ + IP  T+L+     R  KI+A   R QG     P+      E+ WG GA +VT L N  G+E+ATHTQ+T+
Sbjct:   19 IQPRTAVR--TQSRQSGAYSTGAVSGGGG-RVLKMVTEMGSASIGGISPALSANAAKSFLEATDKEKKEMQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGRWGKDTSEIKIQYSDSLRDARKEIDDGARRKAEIDVKVARLRDDLAELRNRYEDVQHRRESDREKINQWQHAIEDAQSELEMLRARWRQLTEEEKRLNGDNARIWEELQKARNDLDEETLGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDYIAKQGKQDMESWYKLKVSEVQGSANRANMESSYQREEVKRMRDNIGDLRGKLGDLEAKNALLEKEVQNLNYQLNDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEESRVGLRQ------------MVEQVVKTHSLQQQEDTDSTRN-----VRGEVSTKTTFQRSAKGNVTISECDPNGKFITLENTHRSKDENLGEHRLKRKLDNRREIV-YTIPPNTVLKA---GRTMKIYA---RDQGGIHNPPDTLVFDGENTWGIGANVVTSLINKDGDERATHTQKTI 585          
BLAST of Intermediate filament b vs. UniProt/SwissProt
Match: sp|P90901|IFA1_CAEEL (Intermediate filament protein ifa-1 OS=Caenorhabditis elegans OX=6239 GN=ifa-1 PE=1 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 5.716e-89
Identity = 210/577 (36.40%), Postives = 351/577 (60.83%), Query Frame = 2
Query:  134 GPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE-----CSESNWGFGAQIVTVLQNSKGEEKATHTQR 1840
            G T   V +Q        EM    G   +P        N  + + + RE+EK E+ DLNDR A+YI+KVR LE +N++L+ +L  L+ +WGK+T  I+  Y+ +++  ++ +D+    +  ME ++  ++D + E + +L DAT+    D+  ID +  TLS+ E EI+ L++R+  LE+E  R  +E  RL  EL   + DL++ETL  I   N++Q+L+++I+FL+++ ++E++EL +L  +D+T EN++F++NE++ A+RDI+ EYD+  +    DME+ Y LK+QEI+T  +++N+E    +EE  RL+ QL+++R +L +LE+RN+ LE+ ++ L  ++E+  R ++   N+   ++   + E + +++ELQ+LLD K +L+ EI  YRKMLEGEE R   K              ++ V +T +I+Q+     T T+   V+KGE +++ SFQR+AKGNV+I E SPDGKFI+L+NT  +++E I  + L+R  D  R  + + +P   +L   GK    KI+AR    QG   P       +E ++G G  + T+L N +GEE+ATH QR
Sbjct:   24 GRTTGNVTSQDRMLKIVTEMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQ------------LVEQVVKTHAITQE-----TDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA-GKT--LKIFARN---QGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 571          
BLAST of Intermediate filament b vs. UniProt/SwissProt
Match: sp|Q19289|IFB1_CAEEL (Intermediate filament protein ifb-1 OS=Caenorhabditis elegans OX=6239 GN=ifb-1 PE=1 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 3.812e-88
Identity = 207/597 (34.67%), Postives = 346/597 (57.96%), Query Frame = 2
Query:  107 YRNVVITRTGPTVSTVGTQGGSNI----------RTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQG--SGDPEC----SESNWGFGAQIVTVLQNSKGEEKATHTQRTV 1846
            YR+ +  RT   V +   Q G+ +          R ++M    G ++  G +  +  N   + +   +KEK  LQ LNDR  NYID+V+ LE++N++L  +L +L+ +WGK+T+ IK  Y   +   R+ +D A   KA++++K+    D + E ++   D  Q   +D+E I +  + ++D + E+  LR R   L +E+ R   +  R+ EEL   + DL+ ET+  I   N++Q+L++++EFL+++ E EV+EL +L+ +   + ++F++NE+A A+RDI+ EYD        DME+ Y LK+ E++ + ++ N+E+   R+E  R++D + ++R +L +LE +N+ LE+ ++ L  ++ +  R+++   N+    L   + E + ++ ELQ LLD K  L+ EI  YRKMLEGEE RV           G +      V   S+ QQ    ST++     ++GE+S KT+FQR+AKGNVTI EC P+GKFI LEN+  +++E++  + ++R  D GR  I + IP+  +++P GKN    I+A   R QG  +  PE      E+ WG GA +VT L N  GEE+ATHTQ+T+
Sbjct:   14 YRSTIQPRTA--VRSQSRQSGNYVSGGNGAGSGGRVLKMVTEMGSATVGGISPALSANAAKSFLEATDKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEMLRARFKQLTDEEKRVTADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRV-----------GLTQMVEQAVKTHSLQQQENTDSTRS-----VRGEVSTKTTFQRSAKGNVTISECDPNGKFIKLENSHRNKDENVGEHKIRRKLD-GRREIVYSIPANVVIKP-GKN--LTIYA---RDQGGINNPPESLVFDGENTWGIGANVVTSLVNKDGEERATHTQKTI 585          
BLAST of Intermediate filament b vs. UniProt/SwissProt
Match: sp|O02365|IFA2_CAEEL (Intermediate filament protein ifa-2 OS=Caenorhabditis elegans OX=6239 GN=mua-6 PE=1 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 4.887e-80
Identity = 200/545 (36.70%), Postives = 331/545 (60.73%), Query Frame = 2
Query:  245 HNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTM-DHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDP------ECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
             N  + + + RE+EK E+ +LNDR A+YI+KVR L+ +N++L  +L  L+ ++GK T  +K  Y+ ++      + Q      + E +I  L+D + E + +  +A +    D+  ID +  TLS+ E EI  L++R+  LEEE  R  KE  RL  EL  ++ +L++ETL  I   N++++++++I+F+K+ FE+E++EL +   +D+T EN+++++NE+A A+RDI+ EYD+ ++    DME+ Y L++QEI T  +++N E    +EE  RL++Q +E+R +L +LE+RN  LE+ +E L  ++E+  R ++   N+   ++   + E + +++ELQ+LLD K +L+ E+  YR+MLEG             N  G  +  + + V RTS   + A     T+   V+KGE S++TS+QR+AKGNV I+E SP+GKF+ILENT  ++EE +  + L+R  D  R ++    PS  IL P    +  KI+ARG   QG  +P      E  E+ +G GA + T+L N+KGEE+ATH QR   Q
Sbjct:   58 QNAASTIRDNREREKKEIMELNDRLASYIEKVRFLDAQNRKLDADLKMLQGRFGKSTGSVKVMYEMEITTATNVVKQTGKDHGETEKEIRKLQDQLDELRKKFEEAQRGRAEDRLKIDDLLVTLSNLEAEINLLKRRIALLEEEVARLKKENFRLTSELQRVRIELDQETLLRIDNQNKVKTILEEIDFMKRGFETELKELQAQAARDTTSENREYFKNELANAMRDIRAEYDQIMNGNRNDMESWYQLRVQEINTQSNRQNAENNYQKEEVKRLRNQTSELRQKLSDLESRNLLLEKQIEDLNYQLEDDQRSYEAALNDKDAQIRKLREECQALMVELQMLLDTKQTLDGELKVYRQMLEG-------------NSEGNGLRQLVEKVVRTSAINEEA----DTETMRVVKGEHSSRTSYQRSAKGNVAIKETSPEGKFVILENTHRAKEEPLGDWKLKRKIDGKREIV-FTFPSDYILHPF---QSVKIFARG---QGIANPPEVLIFEGDET-FGVGANVQTILYNNKGEERATHIQRQSQQ 577          
BLAST of Intermediate filament b vs. TrEMBL
Match: Q95P01 (Intermediate filament b OS=Dugesia japonica OX=6161 GN=DjIFb PE=2 SV=1)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 502/589 (85.23%), Postives = 551/589 (93.55%), Query Frame = 2
Query:   89 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL 1855
            IQPISGYRNVVITRTGP +ST G Q  S+IRTIEM KSYG+S+TPGATSNIVH+GVNNLMNGREKEKNELQ+LNDRFANYIDKVR+LEDENKRL+DEL DLKDQWGKETARIK  YD+DM QLRRSLDQAE +KAQ+EMKINTLEDLI EA  ELNDATQLH ADKETIDKM STLSDYEHEI NLRKRL  LEEEK+RDNKEI+RLKE++N LK+DL+KETLEHITAHNE+QSL+DQIEFLKKIFESE+RELA+LVYKDS+E KDFWRNEMAQALRDIQ+EYD+K++ LH+DMEAQYTLKIQE+RT QS+ENVETVQLREENTRLKDQLA+MRNRLPELEARNNELERLLELLRREIEEKNR+FD+EK NLRKEL+NR++ELE ILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSN   NQTGR++D+MDH+TR++ISQQ A PSTKTQVTS++KGEMSAKTSFQRTAKGNVTIQECS DGKFIILENTGSQ+EDISGYIL RNTDNGRI++KHVI  K+ILEPTGKNRYYKIWARGN+PQGS D ECSESNWG+GA IVT LQNSKGEEKATHTQRTVYQL
Sbjct:   22 IQPISGYRNVVITRTGPAISTAGNQNASSIRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAHVELNDATQLHTADKETIDKMTSTLSDYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEDINQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSETKDFWRNEMAQALRDIQSEYDKKMEALHFDMEAQYTLKIQEVRTNQSKENVETVQLREENTRLKDQLADMRNRLPELEARNNELERLLELLRREIEEKNRDFDMEKANLRKELMNRQSELESILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNSTFNQTGRNIDSMDHITRSTISQQQAVPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILSRNTDNGRIIVKHVISPKSILEPTGKNRYYKIWARGNKPQGSNDAECSESNWGYGAHIVTTLQNSKGEEKATHTQRTVYQL 610          
BLAST of Intermediate filament b vs. TrEMBL
Match: T1E1E3 (LaminB OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 401/599 (66.94%), Postives = 497/599 (82.97%), Query Frame = 2
Query:   89 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHV-TRTSISQQHAA-------PSTKTQVT--SVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL 1855
            +QPISG RNVVI RT PTV T G Q  +++R IEM KSYG S TPGA+SNIV  GVN+LMNGREKE+ EL +LNDRFANYIDKV++LEDEN+RL++EL++LK+QWGKET RIK  +D+DM +LR+SLD AE AK Q+EMKIN+ ED I E++ ELN+  QLH ADKETIDKM + L+DYE+E  +LR+RL GLE+EK++D+KEI RLK+E+  LK+DL+KETL+HI A NE+QSL D+IEFLKKI+ESEVREL +L YKD TE+KDFWRNEM+QALRDIQ+EYDR++D++ +DMEAQY LKIQE R TQ++++ ET+ LREENT+LK+QL+++RNRLPELEARNNELER+LELLRREI+E+NR +DLE+ NLRKEL NR+A+LE I+ ELQILLDAKLSLELEI+AYRKMLEGEE+RVN+K+  + +Q  R +D  D V TR++  Q HAA        +TKTQ+T  S +KGEMSAKTSFQRTAKGNVTIQECSPDGK+IILENTGSQ E++SG+ + RN D GRIV+ + IP   ILE TGK R  KIWA+G +P G+ D EC ++NWG G+ IVT+L N KGEEKATHTQRTVYQ+
Sbjct:   21 VQPISGPRNVVINRTAPTVQTTGGQTATSVRRIEMKKSYGASVTPGASSNIVQTGVNSLMNGREKERQELHELNDRFANYIDKVKHLEDENRRLTEELIELKNQWGKETERIKEQFDSDMWELRKSLDAAEAAKVQIEMKINSFEDFIQESELELNEVNQLHNADKETIDKMNNLLADYENEAVSLRRRLTGLEDEKIKDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTALAYKDPTESKDFWRNEMSQALRDIQSEYDRRIDSIQHDMEAQYNLKIQEYRITQTKDSQETILLREENTKLKEQLSDLRNRLPELEARNNELERMLELLRREIDERNRNYDLERANLRKELSNRQAQLENIIAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPSQ-ARRMDVEDSVITRSTAGQSHAAGQSLGASSTTKTQITSSSTVKGEMSAKTSFQRTAKGNVTIQECSPDGKYIILENTGSQPENLSGFKVDRNVDTGRIVVVYAIPEGVILEATGKKRSLKIWAKGCKPSGTDDLECQDANWGIGSLIVTILINKKGEEKATHTQRTVYQM 618          
BLAST of Intermediate filament b vs. TrEMBL
Match: A0A5J6BTN2 (Intermediate filament b-like protein 1 (Fragment) OS=Minona ileanae OX=60013 PE=2 SV=1)

HSP 1 Score: 520.776 bits (1340), Expect = 7.459e-175
Identity = 317/591 (53.64%), Postives = 427/591 (72.25%), Query Frame = 2
Query:   89 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYG-LSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRT-SISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            I+P++  R VVITRT       G   GS +R +EM +S G LSS  G T+  VHNGV+N+M  REKEK +++DLN+RFANYI+KVR LE +NK+L++EL  L+D+WGKET RIK  YD +M QLR+ LD A  +KA++E+K+N+LE+ + E Q +L+ A QLH +D+E ID++ S +SD E E++ LR+R+   E +  RD  E+ RL++E+  L+ DL++ETL HI +  E  SL D+IEFLKK+ +SE++ELA+L Y+D+T EN++FWR+EM+Q LRDIQ EYD KLD +  +ME  Y LKIQE RT  ++   E    +EEN R+K QL+E+R+R+PELEARN +LERLLE LRR+ EEK R+++LE+++LRK L + +AELE +L+ELQ LLDAKLSLELEI AYRK+LEGEE R   +   NL +      +    TR     + +A P +      +IKGEMSAKT++QRTAKGN++IQEC+PDGKF+ +ENTG + EDISG  + RN DNGR +I+   P KT LEP G+ +  K+WARG +P GS D EC+E+ WG GA I TVL +S GEEKATHTQRTVYQ
Sbjct:   34 IKPVATPRTVVITRTAHGGG--GNSTGSVVREVEMRRSTGALSSVNGHTAG-VHNGVSNIMENREKEKKDMRDLNERFANYIEKVRFLEAQNKKLANELATLRDRWGKETERIKQMYDVEMTQLRKLLDDAMKSKAELEVKVNSLEETVDELQKQLDAANQLHNSDREMIDRLNSQVSDQESELSVLRRRISSFESDHSRDKAEVQRLRDEIRRLRMDLDQETLNHINSEQEAHSLRDEIEFLKKVHDSELKELAALAYRDTTQENREFWRSEMSQCLRDIQNEYDNKLDVMQSEMETHYNLKIQESRTNNTRGGAELQHTKEENIRIKQQLSELRDRIPELEARNAQLERLLEELRRDNEEKLRDWELERSSLRKTLSDNQAELESVLVELQTLLDAKLSLELEIAAYRKLLEGEESRAGLR---NLVEETMKRSSDYETTRVIETRKTNAMPPSN---MGIIKGEMSAKTTYQRTAKGNISIQECAPDGKFLTIENTGKKREDISGMRITRNVDNGRQIIRFTFPDKTFLEPEGRAKSIKVWARGLKPPGSSDMECNENTWGNGANIHTVLISSDGEEKATHTQRTVYQ 615          
BLAST of Intermediate filament b vs. TrEMBL
Match: W0GAA8 (Intermediate filament b-like protein OS=Macrostomum lignano OX=282301 GN=if1 PE=2 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 1.723e-167
Identity = 309/590 (52.37%), Postives = 427/590 (72.37%), Query Frame = 2
Query:   95 PISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNG--VNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNR--KSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVY 1849
            PIS  + VVI RT P     G   G    T++  KS  ++ +  + S I      VNN++NGREKEK ++Q+LN+RFANYI+KVR LE +NK+LS+EL  LKD+WGKET R+K  Y+ ++ QLR+ LD +E  KA+ E++I++LED + E Q  L++A + H  D+ETIDK+   L+DY+ EI+ LR+R+   +EE+ RD KEI RL++E+N L+ DL+ ETL HI A NE QSL +Q+EF+K+I ESE++ELA+L Y+D+T EN++FW+NEMAQAL +IQ EYD K+D +  ++E+QY++K+QE RTT +++N+E   LREEN R+K Q+ + RNR+PELEARN +LER LE LRRE+EE  RE ++EK  LR +L N +A LE  L ELQ L+D KLSLELEI AYRK+LEGEE R+N+  ++ + ++Q   +V++       ++ QQ        Q  S+IKGEMSAKT++QRTAKGNV+IQECS DGK+I+LENTG ++EDISG+ L RN DNGR VIK  +P+  +L   G ++  +IWARG +P GS D E +ES+WG GA I T L N++GEE+ATHTQ+TVY
Sbjct:   23 PISAPKTVVINRTLPGF---GIGRGD---TVDSVKSVRVTRSMASASGIQQTNAEVNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQVLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSF----AVEQQAMHQGQNKQQMSLIKGEMSAKTTYQRTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVL-GDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATHTQKTVY 601          
BLAST of Intermediate filament b vs. TrEMBL
Match: A0A267FSC2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010052g3 PE=3 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 1.879e-167
Identity = 309/590 (52.37%), Postives = 427/590 (72.37%), Query Frame = 2
Query:   95 PISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNG--VNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNR--KSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVY 1849
            PIS  + VVI RT P     G   G    T++  KS  ++ +  + S I      VNN++NGREKEK ++Q+LN+RFANYI+KVR LE +NK+LS+EL  LKD+WGKET R+K  Y+ ++ QLR+ LD +E  KA+ E++I++LED + E Q  L++A + H  D+ETIDK+   L+DY+ EI+ LR+R+   +EE+ RD KEI RL++E+N L+ DL+ ETL HI A NE QSL +Q+EF+K+I ESE++ELA+L Y+D+T EN++FW+NEMAQAL +IQ EYD K+D +  ++E+QY++K+QE RTT +++N+E   LREEN R+K Q+ + RNR+PELEARN +LER LE LRRE+EE  RE ++EK  LR +L N +A LE  L ELQ L+D KLSLELEI AYRK+LEGEE R+N+  ++ + ++Q   +V++       ++ QQ        Q  S+IKGEMSAKT++QRTAKGNV+IQECS DGK+I+LENTG ++EDISG+ L RN DNGR VIK  +P+  +L   G ++  +IWARG +P GS D E +ES+WG GA I T L N++GEE+ATHTQ+TVY
Sbjct:   23 PISAPKTVVINRTLPGF---GIGRGD---TVDSVKSVRVTRSMASASGIQQTNAEVNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQVLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDRKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSF----AVEQQAMHQGQNKQQMSLIKGEMSAKTTYQRTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVL-GDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATHTQKTVY 601          
BLAST of Intermediate filament b vs. Ensembl Cavefish
Match: lmnb1 (lamin B1 [Source:NCBI gene;Acc:103034386])

HSP 1 Score: 95.9005 bits (237), Expect = 2.613e-20
Identity = 88/293 (30.03%), Postives = 142/293 (48.46%), Query Frame = 2
Query:  209 LSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQA--EGAKAQMEM-KINTLEDLILEAQTELND---ATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEV-----RELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREE 1054
            +SSTP + + I           R +EK EL +LNDR A YIDKVR+LE EN  L  ++ + ++   +E   +K  Y+ ++   RRSLD    E A+ Q+E+ KI T  + +L++  + +      Q  L D E +      L+  E  +A        LE        +I  L+  L   ++ L  ETL  +   N  QSLV+++EF K +FE E+     R    LV  DS    ++   ++AQAL D++ ++D ++     +ME  Y  K++ +R +    +      REE
Sbjct:   13 MSSTPLSPTRIT----------RLQEKEELSNLNDRLAIYIDKVRSLESENSVLHLQISEKEEVRSRELTGLKALYETELADARRSLDDTAKERARLQIELGKIRTEHEQLLQSYAKKDSDLAGCQARLKDVEAL------LNSKEASLATALSERKALEGSLADLQAQIHELEASLASARKQLGDETLLRVDLENRCQSLVEELEFRKNMFEEEIKDTRRRHETRLVEVDSGRQVEY-EFKLAQALTDMRQQHDDQVKVYKEEMEQTYMAKLENVRLSSEMNSSSASMAREE 288          

HSP 2 Score: 69.707 bits (169), Expect = 5.615e-12
Identity = 64/202 (31.68%), Postives = 91/202 (45.05%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSV----IKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE----CSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R+             S      VT +  S   +  +T+ +   V     +   S   +   +A GNV I E   DGKFI L NT  Q++ + G+ + R   +     K     K +L+   K     IWA  N    S  P      S+S+WG G  +  VL N  GEE A  +  TV++
Sbjct:  380 DVKLALDMEINAYRKLLEGEEERLKL-----------SPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSIAHSASATGNVCIDELDVDGKFIRLHNTSDQDQPMVGFEMTRTIGDSSATYK--FTPKYVLKAGQK---VTIWA-SNAGVSSSPPTDLIWKSQSSWGTGENVKVVLTNGDGEEVAVRS--TVFK 562          
BLAST of Intermediate filament b vs. Ensembl Cavefish
Match: lmnb1 (lamin B1 [Source:NCBI gene;Acc:103034386])

HSP 1 Score: 95.5153 bits (236), Expect = 3.100e-20
Identity = 88/293 (30.03%), Postives = 142/293 (48.46%), Query Frame = 2
Query:  209 LSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQA--EGAKAQMEM-KINTLEDLILEAQTELND---ATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEV-----RELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREE 1054
            +SSTP + + I           R +EK EL +LNDR A YIDKVR+LE EN  L  ++ + ++   +E   +K  Y+ ++   RRSLD    E A+ Q+E+ KI T  + +L++  + +      Q  L D E +      L+  E  +A        LE        +I  L+  L   ++ L  ETL  +   N  QSLV+++EF K +FE E+     R    LV  DS    ++   ++AQAL D++ ++D ++     +ME  Y  K++ +R +    +      REE
Sbjct:   13 MSSTPLSPTRIT----------RLQEKEELSNLNDRLAIYIDKVRSLESENSVLHLQISEKEEVRSRELTGLKALYETELADARRSLDDTAKERARLQIELGKIRTEHEQLLQSYAKKDSDLAGCQARLKDVEAL------LNSKEASLATALSERKALEGSLADLQAQIHELEASLASARKQLGDETLLRVDLENRCQSLVEELEFRKNMFEEEIKDTRRRHETRLVEVDSGRQVEY-EFKLAQALTDMRQQHDDQVKVYKEEMEQTYMAKLENVRLSSEMNSSSASMAREE 288          

HSP 2 Score: 69.707 bits (169), Expect = 4.432e-12
Identity = 63/202 (31.19%), Postives = 92/202 (45.54%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSV----IKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE----CSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            D KL+L++EI AYRK+LEGEE R+    + +             VT +  S   +  +T+ +   V     +   S   +   +A GNV I E   DGKFI L NT  Q++ + G+ + R   +     K     K +L+   K     IWA  N    S  P      S+S+WG G  +  VL N  GEE A  +  TV++
Sbjct:  361 DVKLALDMEINAYRKLLEGEEERLKLSPSPS-----------SRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSIAHSASATGNVCIDELDVDGKFIRLHNTSDQDQPMVGFEMTRTIGDSSATYK--FTPKYVLKAGQK---VTIWA-SNAGVSSSPPTDLIWKSQSSWGTGENVKVVLTNGDGEEVAVRS--TVFK 543          
BLAST of Intermediate filament b vs. Ensembl Cavefish
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:103035120])

HSP 1 Score: 92.8189 bits (229), Expect = 1.356e-19
Identity = 135/467 (28.91%), Postives = 212/467 (45.40%), Query Frame = 2
Query:   98 ISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMS-----KSYGLSSTPGA--TSNIVHNG------VNNLMNG-----REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELA-SLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETV-QLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYR--VNRKSNQNLNQTGRSVDTM----DHVTRTSI 1420
            +S YR     R GP  ST      S + T  +S     +   LSS PGA  TS +   G       ++L+       R  EK E+  LNDRFA+YI+KVR LE +NK L  EL  L+   GKE +R+   Y  ++ +LRR +D     KA++E++ + L   ++  +  L D T L                                   +  DN         LN  +QD+++  +  +    ++++L D+I FLKK+ E E++EL   L+ +    + D  + ++  ALRDI+ +Y+    +   + E  Y  K  ++ T  +  N E++ Q ++E    + Q+  +   L  L   N  LER L  +      +   +      L  E+   K E+   L E Q LL+ KL+L++EI  YRK+LEGEE R  V  +S  NL     S+DT      HV R+ +
Sbjct:    7 LSSYRK----RFGPQGSTGSPALSSRLSTGRLSLHSTPRHLTLSS-PGALSTSRLSLGGERLDFSADSLLKAQYRETRTNEKVEMMGLNDRFASYIEKVRFLEQQNKMLVAELNQLR---GKEPSRLGDIYQEELRELRRQVDGLNAGKARLEIERDNLAADLVTLKQRLQDETALR----------------------------------QEADNN--------LNGFRQDVDEAAMNRVQLERKIEALQDEINFLKKVHEEEMKELQEQLMAQQVHVDLDVSKPDLTAALRDIRVQYEAMASSNMQETEEWYRSKFADL-TDAANRNAESLRQAKQEANDYRRQIQALTCDLESLRGTNESLERQLREMEERFSIETAAYQDTVVRLEDEIQTLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITVPVQSFANLQFRETSMDTKLTPEAHVKRSIV 422          
BLAST of Intermediate filament b vs. Ensembl Cavefish
Match: inab (alpha-internexin-like [Source:NCBI gene;Acc:103040041])

HSP 1 Score: 92.4337 bits (228), Expect = 2.342e-19
Identity = 90/329 (27.36%), Postives = 154/329 (46.81%), Query Frame = 2
Query:  104 GYRNVVITRTGPTVSTVGT---QGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQL 1078
            GYR++ +TRTG   S++G+    G S + +  MS   GL +   A S++++N    +   R  EK ++Q LNDRFA +I+KVRNLE  NK L  ELV L+ Q   E +R+   Y  ++ +LR  L++A G K QM  + + +E+                                   E+  LR+R     E++VR   E  R    L   ++D++  +L  +    +++SL+D+I FL++  + EV EL + +         +  + ++  AL++I+ +Y+          E  Y  K  ++    ++ N      REE    + QL
Sbjct:   38 GYRSLSVTRTG--ASSLGSYKRAGRSALSSGPMS--LGLDTLDFAQSSVLNNEFKII---RTNEKEQMQGLNDRFAMFIEKVRNLEQHNKVLETELVTLR-QRQSEPSRLAELYQQEIRELRSQLEEAHGEKNQMMFERDNVEE-----------------------------------ELQKLRERY----EDEVRARDESERT---LKAFRKDVDDASLARLDLEKKVESLLDEIAFLRRAHDEEVAELMNAIQASQVSVEMEVAKPDLTSALKEIRGQYESLASKNLQSAEEWYKSKFADLSEQANRSNEAIRASREEVNEFRRQL 316          
BLAST of Intermediate filament b vs. Ensembl Cavefish
Match: inab (alpha-internexin-like [Source:NCBI gene;Acc:103040041])

HSP 1 Score: 90.8929 bits (224), Expect = 1.561e-18
Identity = 81/283 (28.62%), Postives = 140/283 (49.47%), Query Frame = 2
Query:  104 GYRNVVITRTGPTVSTVGT---QGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYD 940
            GYR++ +TRTG   S++G+    G S + +  MS   GL +   A S++++N    +   R  EK ++Q LNDRFA +I+KVRNLE  NK L  ELV L+ Q   E +R+   Y  ++ +LR  L++A G K QM  + + +E+                                   E+  LR+R     E++VR   E  R    L   ++D++  +L  +    +++SL+D+I FL++  + EV EL + +         +  + ++  AL++I+ +Y+
Sbjct:  333 GYRSLSVTRTG--ASSLGSYKRAGRSALSSGPMS--LGLDTLDFAQSSVLNNEFKII---RTNEKEQMQGLNDRFAMFIEKVRNLEQHNKVLETELVTLR-QRQSEPSRLAELYQQEIRELRSQLEEAHGEKNQMMFERDNVEE-----------------------------------ELQKLRERY----EDEVRARDESERT---LKAFRKDVDDASLARLDLEKKVESLLDEIAFLRRAHDEEVAELMNAIQASQVSVEMEVAKPDLTSALKEIRGQYE 565          
BLAST of Intermediate filament b vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 73.1738 bits (178), Expect = 8.275e-14
Identity = 58/199 (29.15%), Postives = 99/199 (49.75%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHA---APSTKTQVTSVIKGEMSAKTSFQR------TAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPE----CSESNWGFGAQIVTVLQNSKGEEKAT 1828
            D KL+L++EI AYRK+LEGEE R+N    + +  +         V +TS S  H+    P  + +V   ++G + +    QR      +A G++ I+E   +GK + + N   +++ + G++L+R  ++ +  I +   S+ +L+     +   IWA  N       P      ++S+WG G  I T L NS GEE A 
Sbjct:  361 DIKLALDMEIAAYRKLLEGEESRLNLSPEKGVQSS---------VVQTSTSASHSIRTMPGKRKRVQ--LEGFVDSMAQSQRSVSQHASASGSIGIKEVDMEGKSVTMVNNSEKDQPLGGWVLKRQIED-QAEIAYKFSSRYVLKA---GQTVTIWA-ANAGVSHNPPSDLLWKTQSSWGTGDDIRTSLLNSDGEEVAV 543          

HSP 2 Score: 64.6994 bits (156), Expect = 3.165e-11
Identity = 63/218 (28.90%), Postives = 101/218 (46.33%), Query Frame = 2
Query:  275 REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWG--------------KETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLE-------DLILEAQTELNDA------TQLHLADKETIDKMASTLSDY-EHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRE 844
            R +EK  L +LNDR A YI++VR+LE +  RL   +      W               + T  ++  YD ++ ++RR+LD A GAKA +E+++   +           + + E N A       ++ L  KE     AS   +Y E E+ +LR ++  LE   V                KQ LE+ETL  +   N + +L +++EF K+I E E+ E
Sbjct:   16 RLQEKESLVELNDRLAAYIERVRSLEVDKARLLARV----SMWEEEEEEQRQKSERQREATGGLRAAYDAELAEVRRALDDALGAKAALEIQLRLAQVERDEGRSRCSKYEQEWNVALGRIRDMEVQLCAKEASLSTASGDKEYLETEVDDLRNQVNQLEGVLVSS--------------KQQLEEETLARVDLENRMLTLQEELEFTKRIHEQEIHE 215          
BLAST of Intermediate filament b vs. Ensembl Sea Lamprey
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 70.0922 bits (170), Expect = 5.027e-13
Identity = 76/256 (29.69%), Postives = 115/256 (44.92%), Query Frame = 2
Query:  194 SKSYGLSSTPGATSNIVHNGVNNLMNG-----REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDS--TENKDFWRNEMAQALRDIQTEYD 940
            S  YG S         V   +   +N      R  EK ELQ+LNDRFANYIDKVR LE +NK L  EL  LK   G+E  R+   Y+ ++ +LR  +++  G KA+                    D  + +L D                E+  L++RL      +    K        L   +QD++  TL  +    +++SL ++I FLKKI + E+RE+   V + +   E     + ++  ALRDI+ EY+
Sbjct:   53 SSLYGRSYVKAMPGQSVDFSLAEALNADYRTTRTNEKVELQELNDRFANYIDKVRYLEQQNKALLAELALLK---GREPTRVGPLYEQELRELRAQVERLTGEKAR-------------------GDVERANLLD----------------ELQRLQQRLQEETAAREEAEK-------NLQAFRQDVDDATLARVDLERKVESLQEEIAFLKKIHDEELREVQVQVQEQTVHVEYDVGTKPDLTAALRDIRAEYE 263          
BLAST of Intermediate filament b vs. Ensembl Sea Lamprey
Match: neflb (neurofilament, light polypeptide b [Source:ZFIN;Acc:ZDB-GENE-060312-44])

HSP 1 Score: 68.1662 bits (165), Expect = 1.849e-12
Identity = 76/278 (27.34%), Postives = 125/278 (44.96%), Query Frame = 2
Query:  125 TRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIV-----HNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVREL-ASLVYKDSTENKDFWRNEMAQALRDIQTEYD 940
            TR+    ST+G   GS  RT      Y   S P ATS+++      +  N L + R +EK++LQDLNDRFA +I++V +LE +NK L  E + L+ Q     + IK  Y                     E +I  L  L  E ++E N A       K   D+M                 LG L  +   + +     +  L+ +++  ++  ++ +    ++ SL+D+I FLKK+ + E+ +L A +     T      R ++  ALRDI+ +Y+
Sbjct:   42 TRSVSVGSTLGVPVGSFRRT---HSRYSSMSIP-ATSDMIDLSQAESLGNELKSIRTQEKDQLQDLNDRFAGFIERVHHLEQQNKVLEAEALILR-QKEMRPSNIKQLY---------------------EQEIRDLRALAEECKSEYNSA-------KGGRDQMEGA--------------LGALRAKHDEERRRREESEGALDEVRKAADEAAVQRVALEQKVGSLLDEIAFLKKVQQEEIADLQAQIQSAHITVEMSVARPDLTSALRDIRAQYE 272          
BLAST of Intermediate filament b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007836.1 (pep scaffold:Pmarinus_7.0:GL477602:49686:51609:1 gene:ENSPMAG00000007086.1 transcript:ENSPMAT00000007836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 7.021e-12
Identity = 62/230 (26.96%), Postives = 110/230 (47.83%), Query Frame = 2
Query:  266 MNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKD-QWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKD--STENKDFWRNEMAQALRDIQTEYDRK 946
            M  R  EK+ LQDLN+RF+ YI KV +LE  NK L D++  LK  Q G   + I   Y+ ++ +LR  ++   G K  ++M+   LE+                                   +I  L ++ G  +E ++R + +     E   +  ++++  +L  ++   ++Q+LVD+I FLKK  E E+ +L + +     S E  D+    +A+ALR+I+ ++  K
Sbjct:   17 MQARVNEKHLLQDLNERFSAYITKVHDLEQNNKDLDDQISALKQRQSGTTRSGINDVYECEIKELRELIEHINGEKTSVQMEQERLEE-----------------------------------DIKKLEEKCG--QEVRLRSDAD-----ELFKMFSKNIDAASLVRMSNEKQIQALVDEIAFLKKNHEEEMDQLMAQIKSSTVSVEKVDYEEAGIAEALREIRGKFQLK 204          
BLAST of Intermediate filament b vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 65.855 bits (159), Expect = 8.172e-12
Identity = 51/191 (26.70%), Postives = 90/191 (47.12%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVN----RKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC---SESNWGFGAQIVTVLQNSKGEEK 1822
            + KL+L++EI AYRKMLEGEE R++      S   + ++  +V T     R  +  Q +  ++   VT             + +A G + + E    G+F+ L N   Q++ + G+ ++R+  +G   I +    +TI++         IWA G   Q +   +      S WG G ++  V+ N+ GEE+
Sbjct:  153 EVKLALDMEISAYRKMLEGEEERLHLSPSPSSRVTVTRSSETVRTSGGAKRKRLDVQESEATSSVSVTQ------------RASASGVIAVDEIDAGGRFVKLINDSQQDQAVGGWTVKRSI-HGHADIVYKFTGRTIVKAGDS---ITIWAGGAGVQHNPPRDLLMKQHSTWGSGDEVRVVVLNANGEEQ 327          
BLAST of Intermediate filament b vs. Ensembl Nematostella
Match: EDO37225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD1])

HSP 1 Score: 139.428 bits (350), Expect = 6.639e-35
Identity = 159/576 (27.60%), Postives = 269/576 (46.70%), Query Frame = 2
Query:  218 TPGATSNIVHNGV-NNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQA--EGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIM--------------RLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTEN-------KDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSE-------SNWGFGAQIVTVLQNSKGEEKATHTQRTVYQ 1852
            TP ++S I+ +    +    R +EK ELQ LNDR A YID+V+NLE EN +L  E+   +    +E   +K+ Y+ ++   RR LD+   E AK Q+E   N+            NDA +     K   DK A+     E E+ ++RK L   E +  R N+E +               LK+ L   K  LE+ETL  +   N  QSL ++  F K++++ E+ ++ S +    T+        KD +   MA+ L++++ +YD    +   + E  Y+ K +E+R  + +++    +LREEN  L   + E+ +++ +LEA+NN L   +  L+    +   + D E      E+   +  ++  L + + L+  K++L++EI AYRK+LE EE R+      +    G S          S+SQ      T+         E  +  +   TA+G +   E  PDGK+I + N+G ++E + G+ +QR        +    P K +L+      +  +W+     QG G  +           +WG G +  T L N+ GEE AT  +  V+Q
Sbjct:   17 TPVSSSRIMGSSPPGSAKFTRAQEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADARRLLDETAKEKAKQQIESSKNS------------NDAQEF----KNKFDKEAAARKKAEKELNDVRKLLHDKENQLTRRNQEALNLESVLRELQGECEELKDALKAAKYALEQETLTRVDLENRCQSLQEEQNFKKQMYDKELSDIRSQLKTVETKRVVVETDYKDKYEGLMAEKLQELREDYDSDARSFKEETELLYSSKFEELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGLRAQDKEKHDNEILLRENEIAELRTSIDDALRDYEDLMGVKVALDMEITAYRKLLESEETRLEITPPASPVLGGSS----------SVSQ------TRRGNKRARTEETESTMTTTTTAEGAIQFTEADPDGKYIKIYNSGEKDEALGGWTIQRQVGTEDPSVYKFTP-KYVLKSQS---HVTVWS----AQGGGTHKPPSDLVFKQLPSWGSGNEARTALVNAGGEEMATLLEEKVFQ 552          
BLAST of Intermediate filament b vs. Ensembl Nematostella
Match: EDO39801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W1])

HSP 1 Score: 46.2098 bits (108), Expect = 2.053e-6
Identity = 31/104 (29.81%), Postives = 54/104 (51.92%), Query Frame = 2
Query: 1517 GNVTIQECSPDGKFIILENTGS-QEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPEC---SESNWGFGAQIVTVLQNSKGE 1816
            GNV I E +PDG ++ L NT + ++E+I GY++Q+N   GR V     P +T L+      +  +W+ G+  + +   +     +  WG G +  T+L    G+
Sbjct:    5 GNVRILEVNPDGNYVRLFNTSAHRDEEIGGYMIQQNV-AGRPVTVFRFPPRTRLKALS---HTTVWSAGSLSRHNPPSDFLWKEQHKWGTGPECTTILCKPNGQ 104          
BLAST of Intermediate filament b vs. Ensembl Medaka
Match: lmnl3 (lamin-L(III) [Source:NCBI gene;Acc:101168604])

HSP 1 Score: 108.227 bits (269), Expect = 2.602e-24
Identity = 144/555 (25.95%), Postives = 260/555 (46.85%), Query Frame = 2
Query:  212 SSTPGATSNIVHNGVNNLMNG---REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKET-IDKMASTLSDYEHEIANL---RKRLGGLEEEKVRDNKEIMRLKEELNLL---KQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELAS-----LVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESN--WGFGAQIVTVLQNSKGEEKA 1825
            +STP A       G  +   G   R +E+ EL+ LNDR ANYI +V+ LE E   +   L + ++   +ET  ++  Y+ ++  +RR+LD+    +A+++++     + IL+ Q+  N   +  LA   T   K+ + LS  E E   L     RLGG    +V D +  ++L+    LL   K  L  E L  +   N++Q+L +Q+E  K I   E+ E+ S     LV  +S   ++F  +++A+ ++ ++ ++  +L      ME  ++ K+Q  +    +  V     REE    +++L  +R++L + +     LE   + L+R ++++   +    +   +ELL+ + ++   L   Q LLD KL+L++EI AYRKMLE EE R+             S     H +   + + H     K +     +   + K   + T KG VT+ E    GK++ ++N   QE+ + G++++R   +   V     PS  +       +   IW+ G   +        E+N  WG    +  VL N   EE++
Sbjct:    5 TSTPAARGG--RRGACSPSPGQPPRVQERGELRHLNDRLANYIQRVQELEQEKGAMLLRLQEQEEATARETRGVRRLYEEELADVRRALDELAAERARLQIEQGNQREDILKLQSR-NQKKENDLAAAVTQRRKVEAVLSSKEAENRKLLSENGRLGG----EVADLQ--VQLENAERLLAETKNQLSSEILRRVEMENQVQTLKEQLELQKNISRQEILEVRSRQETRLVEVESGRRREF-ESKLAETMQQLREDHTLQLQQYKEAMEKTFSTKLQNAQQAAEENGVSVSTAREELEASREKLESLRSQLQQNQKDKLVLEERFQELQRTLDQERDAWQQRLSLKERELLSMRTQMNSQLENHQNLLDVKLALDMEINAYRKMLEVEEQRLQ-----------LSPTPPRHTSVARVQEHHQLRGKKRKHEEATRSSPAYKICRRSTRKGGVTVAEVDVGGKYVQIQNNSDQEQPLGGWVVRRVYPHSGDVSFQFPPSCVL----AGGQTLTIWSSGAADEAEPGDMVLENNGSWGAVGDMRVVLLNPSHEEES 534          
BLAST of Intermediate filament b vs. Ensembl Medaka
Match: lmnl3 (lamin-L(III) [Source:NCBI gene;Acc:101168604])

HSP 1 Score: 108.612 bits (270), Expect = 2.819e-24
Identity = 144/555 (25.95%), Postives = 260/555 (46.85%), Query Frame = 2
Query:  212 SSTPGATSNIVHNGVNNLMNG---REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKET-IDKMASTLSDYEHEIANL---RKRLGGLEEEKVRDNKEIMRLKEELNLL---KQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELAS-----LVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESN--WGFGAQIVTVLQNSKGEEKA 1825
            +STP A       G  +   G   R +E+ EL+ LNDR ANYI +V+ LE E   +   L + ++   +ET  ++  Y+ ++  +RR+LD+    +A+++++     + IL+ Q+  N   +  LA   T   K+ + LS  E E   L     RLGG    +V D +  ++L+    LL   K  L  E L  +   N++Q+L +Q+E  K I   E+ E+ S     LV  +S   ++F  +++A+ ++ ++ ++  +L      ME  ++ K+Q  +    +  V     REE    +++L  +R++L + +     LE   + L+R ++++   +    +   +ELL+ + ++   L   Q LLD KL+L++EI AYRKMLE EE R+             S     H +   + + H     K +     +   + K   + T KG VT+ E    GK++ ++N   QE+ + G++++R   +   V     PS  +       +   IW+ G   +        E+N  WG    +  VL N   EE++
Sbjct:    5 TSTPAARGG--RRGACSPSPGQPPRVQERGELRHLNDRLANYIQRVQELEQEKGAMLLRLQEQEEATARETRGVRRLYEEELADVRRALDELAAERARLQIEQGNQREDILKLQSR-NQKKENDLAAAVTQRRKVEAVLSSKEAENRKLLSENGRLGG----EVADLQ--VQLENAERLLAETKNQLSSEILRRVEMENQVQTLKEQLELQKNISRQEILEVRSRQETRLVEVESGRRREF-ESKLAETMQQLREDHTLQLQQYKEAMEKTFSTKLQNAQQAAEENGVSVSTAREELEASREKLESLRSQLQQNQKDKLVLEERFQELQRTLDQERDAWQQRLSLKERELLSMRTQMNSQLENHQNLLDVKLALDMEINAYRKMLEVEEQRLQ-----------LSPTPPRHTSVARVQEHHQLRGKKRKHEEATRSSPAYKICRRSTRKGGVTVAEVDVGGKYVQIQNNSDQEQPLGGWVVRRVYPHSGDVSFQFPPSCVL----AGGQTLTIWSSGAADEAEPGDMVLENNGSWGAVGDMRVVLLNPSHEEES 534          
BLAST of Intermediate filament b vs. Ensembl Medaka
Match: desmb (desmin [Source:NCBI gene;Acc:101174730])

HSP 1 Score: 89.7373 bits (221), Expect = 1.511e-18
Identity = 106/361 (29.36%), Postives = 172/361 (47.65%), Query Frame = 2
Query:  263 LMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRV 1342
             +  R  EK ELQ LNDRFA+YI+KVR LE +N+ LS E+  L+   G+E  RI   Y+ +M +LRR ++     ++++E++ + L                      E +DK+             LR +   L++E   +N         L   + D++  TL  +     +++L ++I FLKKI E E+REL + + +   +   D  + ++  ALRDI+T+Y+        D E  Y  K+ ++    S+ N    Q R+E    + Q+      +  L+  N  L R +  L      +   F      L  E+ N K E+   L E Q LL+ K++L++EI  YRK+LEGEE R+
Sbjct:  100 FLATRTNEKAELQHLNDRFASYIEKVRFLEQQNQALSVEVERLR---GREPTRIADLYEEEMRELRRQVEILTNQRSRVEVERDNL---------------------AEDLDKL------------KLRLQEEILQKEDAENN---------LAAFRADVDAATLARLDLERRIETLQEEIAFLKKIHEEEIRELQTQMQETQVQIQMDMSKPDLTAALRDIRTQYEGIAAKNIADAEDWYKSKVSDLNQAVSKNNEALKQARQETMEFRHQIQAYTCEIDSLKGTNESLMRQMRELEDRHGCEAARFQDTIARLEAEIANMKDEMARHLREYQDLLNIKMALDVEIATYRKLLEGEESRI 415          
BLAST of Intermediate filament b vs. Ensembl Medaka
Match: desmb (desmin [Source:NCBI gene;Acc:101174730])

HSP 1 Score: 88.1965 bits (217), Expect = 4.194e-18
Identity = 106/360 (29.44%), Postives = 171/360 (47.50%), Query Frame = 2
Query:  263 LMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTE-NKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYR 1339
             +  R  EK ELQ LNDRFA+YI+KVR LE +N+ LS E+  L+   G+E  RI   Y+ +M +LRR ++     ++++E++ + L                      E +DK+             LR +   L++E   +N         L   + D++  TL  +     +++L ++I FLKKI E E+REL + + +   +   D  + ++  ALRDI+T+Y+        D E  Y  K+ ++    S+ N    Q R+E    + Q+      +  L+  N  L R +  L      +   F      L  E+ N K E+   L E Q LL+ K++L++EI  YRK+LEGEE R
Sbjct:  100 FLATRTNEKAELQHLNDRFASYIEKVRFLEQQNQALSVEVERLR---GREPTRIADLYEEEMRELRRQVEILTNQRSRVEVERDNL---------------------AEDLDKL------------KLRLQEEILQKEDAENN---------LAAFRADVDAATLARLDLERRIETLQEEIAFLKKIHEEEIRELQTQMQETQVQIQMDMSKPDLTAALRDIRTQYEGIAAKNIADAEDWYKSKVSDLNQAVSKNNEALKQARQETMEFRHQIQAYTCEIDSLKGTNESLMRQMRELEDRHGCEAARFQDTIARLEAEIANMKDEMARHLREYQDLLNIKMALDVEIATYRKLLEGEESR 414          
BLAST of Intermediate filament b vs. Ensembl Medaka
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:101173548])

HSP 1 Score: 85.5001 bits (210), Expect = 2.686e-17
Identity = 74/230 (32.17%), Postives = 115/230 (50.00%), Query Frame = 2
Query:  275 REKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEE---LNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRE-----LASLVYKDSTENKDFWRNEMAQALRDIQTEYD 940
            R  EK E+  LNDRFA+YI+KVR LE +NK L  EL  L+   GKE +R+   Y +++ +LRR +D     KA++E++ + L                   AD                 +A L++RL            EI++ +E    LN  +QD+++ +L  +    +++SL D+I FLKKI E E+RE     LA  V+ D     D  + ++  ALRDI+ +Y+
Sbjct:   83 RTNEKMEMMGLNDRFASYIEKVRMLEQQNKVLVAELNQLR---GKEPSRLGDIYQDELRELRRQVDNLTTGKARLEIERDNL------------------AAD-----------------LATLKQRL----------QDEIVQRQEAENNLNAFRQDVDEASLSRVQLERKIESLQDEINFLKKIHEEELRESQEKVLAQQVHVDL----DVSKPDLTAALRDIRLQYE 260          
BLAST of Intermediate filament b vs. Planmine SMEST
Match: SMESG000062826.1 (SMESG000062826.1)

HSP 1 Score: 1075.46 bits (2780), Expect = 0.000e+0
Identity = 591/591 (100.00%), Postives = 591/591 (100.00%), Query Frame = 2
Query:   83 PPIQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL 1855
            PPIQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL
Sbjct:   20 PPIQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL 610          
BLAST of Intermediate filament b vs. Planmine SMEST
Match: SMESG000046289.1 (SMESG000046289.1)

HSP 1 Score: 447.588 bits (1150), Expect = 1.499e-150
Identity = 260/578 (44.98%), Postives = 392/578 (67.82%), Query Frame = 2
Query:  119 VITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVY 1849
            + +RT    +    +    ++  EM +SY  S  P   S  +H+ V++ + GRE+EK E+QDLN+R ANYI+KVR LE +NKRL++EL  L+++WGKE  RI+  Y+ +M QL++ LD+AE A++++  KIN LE+ + E    +++A   H  D+E I+K+   LS+ E EI  LR+R+  LEEE+ R  K I RL++E+   + DL++ET+ HI + +E+QS  D+I+F+K   ++E++ELA+L Y+DST EN+DFWR+EM  +LR++Q EYDRKL+ +  D+E  + +K+QE+R +  +E VE++ L+EEN RLK+QL+ +R++ PE+EA+N +LER LE LRR+++ +  +F+ E++ LR +L   + EL+ I+ E Q ++D KLSLELEI AYRK+LEGEE R   +            + M+     +         +KT V++++K E +AK + QRTAKGNV I E S DGKFIILENTG ++EDISG+ + RN DN R +I++ IP+ TIL+P G+ ++ KIW++GNRP GS D ECS +NWG G  I T L N   EE+ATHTQ+T +
Sbjct:    1 MASRTSARSTVTINKSSPAVKEYEMRQSYNFSGAPMGGSVQIHSNVSSAVEGREREKREMQDLNERLANYIEKVRFLEAQNKRLTNELNTLRERWGKEAERIRALYEIEMDQLKKLLDEAEAARSELLPKINKLEEQLHEYLQGIDEANNQHGMDQEMIEKLNRQLSECEGEIGLLRRRIAALEEERGRSKKTISRLRDEIKRTRMDLDQETMNHIASESEVQSRKDEIDFMKDSHDNEMKELAALAYRDSTAENRDFWRSEMGSSLRELQIEYDRKLEAMRGDLENHHNVKVQELRHSSPREGVESIHLKEENIRLKNQLSNLRSKCPEMEAKNAQLERFLEELRRDLDRQINDFESERDKLRSDLQRTQDELDSIMKEFQNVMDMKLSLELEIAAYRKLLEGEESRSGLR------------NMMEQTIFKTSGGIEGNIISKTAVSNLMKNERNAKVNHQRTAKGNVIIHETSADGKFIILENTGKKDEDISGFKIIRNIDNDRSIIRYEIPNSTILKPEGQQKFLKIWSKGNRPTGSNDLECSSANWGTGTHIFTALLNKSNEERATHTQKTTF 566          
BLAST of Intermediate filament b vs. Planmine SMEST
Match: SMESG000046938.1 (SMESG000046938.1)

HSP 1 Score: 341.658 bits (875), Expect = 7.058e-109
Identity = 229/592 (38.68%), Postives = 374/592 (63.18%), Query Frame = 2
Query:   89 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXAXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKS-----NQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTV 1846
            + PIS  R ++I RT   V +         + I+ S +Y     P  ++   +  V N    REK+K+++++LN++ A YI++VR LE +NK+ S EL +LKD+WGK+T  +K  Y+ +M  L++ L +AE  + + E  +  LE  + +A+ ELN +  +     + I+     LS+ E  I+ L+KRLG LEE K +D  EI++L++E+  L++DL  +T++++    ELQ  +D++EFLK+I ++++ EL++L Y+D+T +NKDFW+ E++ A++DIQ++YD ++  L   +E+QY +++Q+ +T  ++  +E   +++EN R+K++    R+R+P+LE +   LER L  LR E EE  R++++E ++  KEL    + +    I+L+ LLD KLSL+LEI AYRK+LEGEE R   KS     ++N   T      ++ V + +I Q+     T T  T    GE+SAK++F RT KGNV+I EC+ DG+ IILEN G  +E+IS  ++ R+ D+GR ++K VIP KT ++    N+  KIWA+G +P G+ D E  E+NWG G+ I T+L N+ GEE+AT+TQ+TV
Sbjct:   39 VSPISSQRTIIINRTNNQVPS---------QIIQRSFNYETRVIPSKSA--AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAEISLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKK-VQETNTSAT----GEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDG---NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATYTQKTV 611          
BLAST of Intermediate filament b vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 213.772 bits (543), Expect = 3.575e-60
Identity = 123/310 (39.68%), Postives = 201/310 (64.84%), Query Frame = 2
Query:  161 QGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEM 1087
            QG SNI  I               S  + +GV ++  GR +EK +LQDLN+RFA+YI+K R LE +NK+L++E+  LK    ++ ++IK  Y+ ++ QLR  ++++E +KA +E ++++LE  I + +  L     ++   K TIDK    +S +E E+  LR+  G    +  ++ +E+  L+++L  L+QD EKE L H+T  +ELQSL + +EF K+I ++EV+ELA++ Y+D T EN  +W++EM +ALRDIQTEY+ KL  +  ++EA Y L++QEIRT+++++NVET   +EEN+R+K Q+  M
Sbjct:  121 QGSSNIPLIR------------GDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSM 418          

HSP 2 Score: 83.5741 bits (205), Expect = 1.735e-16
Identity = 65/198 (32.83%), Postives = 87/198 (43.94%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEM---------SAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQ 1837
            DAKL LELEI AY K+LE EE RVN  ++ N   +     T                S      S     M         S +  F+RT KGN++I E    G  IILEN G++ E + G  ++R  D     I   I  K  L    K     + A+G       + E  +++WG G  +VT L +S+G EKA H Q
Sbjct:  480 DAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMSFTSSSGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK---ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 674          
BLAST of Intermediate filament b vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 213.386 bits (542), Expect = 4.491e-60
Identity = 123/310 (39.68%), Postives = 201/310 (64.84%), Query Frame = 2
Query:  161 QGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEM 1087
            QG SNI  I               S  + +GV ++  GR +EK +LQDLN+RFA+YI+K R LE +NK+L++E+  LK    ++ ++IK  Y+ ++ QLR  ++++E +KA +E ++++LE  I + +  L     ++   K TIDK    +S +E E+  LR+  G    +  ++ +E+  L+++L  L+QD EKE L H+T  +ELQSL + +EF K+I ++EV+ELA++ Y+D T EN  +W++EM +ALRDIQTEY+ KL  +  ++EA Y L++QEIRT+++++NVET   +EEN+R+K Q+  M
Sbjct:  126 QGSSNIPLIR------------GDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSM 423          

HSP 2 Score: 83.1889 bits (204), Expect = 2.301e-16
Identity = 65/196 (33.16%), Postives = 93/196 (47.45%), Query Frame = 2
Query: 1271 DAKLSLELEIIAYRKMLEGEEYRVNRKSNQN------LNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAK-TSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQ 1837
            DAKL LELEI AY K+LE EE RVN  ++ N      ++ T  S       +      +    S  + +T     +  +K   F+RT KGN++I E    G  IILEN G++ E + G  ++R  D     I   I  K  L    K     + A+G       + E  +++WG G  +VT L +S+G EKA H Q
Sbjct:  485 DAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMSFTSSSGAGGAGGSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK---ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 677          
The following BLAST results are available for this feature:
BLAST of Intermediate filament b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMNB21.498e-3026.93lamin B2 [Source:HGNC Symbol;Acc:HGNC:6638][more]
VIM1.710e-1929.05vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM1.710e-1929.05vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM2.045e-1929.79vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
LMNB16.945e-1831.50lamin B1 [Source:HGNC Symbol;Acc:HGNC:6637][more]
back to top
BLAST of Intermediate filament b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifa-14.494e-9036.40Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-15.066e-9036.40Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-15.066e-9036.40Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-15.066e-9036.40Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-15.550e-9036.40Intermediate filament protein ifa-1 [Source:UniPr... [more]
back to top
BLAST of Intermediate filament b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lam2.510e-1829.67gene:FBgn0002525 transcript:FBtr0346460[more]
Lam2.510e-1829.67gene:FBgn0002525 transcript:FBtr0307059[more]
Lam2.510e-1829.67gene:FBgn0002525 transcript:FBtr0307058[more]
Lam2.510e-1829.67gene:FBgn0002525 transcript:FBtr0079100[more]
LamC2.274e-1728.36gene:FBgn0010397 transcript:FBtr0333166[more]
back to top
BLAST of Intermediate filament b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb11.537e-2028.16lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2][more]
lmnb13.452e-2028.87lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2][more]
lmnb13.125e-1927.60lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2][more]
lmnb13.125e-1927.60lamin B1 [Source:ZFIN;Acc:ZDB-GENE-020424-2][more]
lmna8.004e-1929.79lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
back to top
BLAST of Intermediate filament b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
timm131.334e-2626.35translocase of inner mitochondrial membrane 13 hom... [more]
timm135.966e-2626.04translocase of inner mitochondrial membrane 13 hom... [more]
timm138.040e-2626.03translocase of inner mitochondrial membrane 13 hom... [more]
timm132.441e-2524.96translocase of inner mitochondrial membrane 13 hom... [more]
timm132.985e-2525.68translocase of inner mitochondrial membrane 13 hom... [more]
back to top
BLAST of Intermediate filament b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmnb24.311e-3226.95lamin B2 [Source:MGI Symbol;Acc:MGI:96796][more]
Lmnb28.799e-3227.22lamin B2 [Source:MGI Symbol;Acc:MGI:96796][more]
Vim8.694e-1929.02vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Vim8.760e-1929.53vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Lmnb11.513e-1731.14lamin B1 [Source:MGI Symbol;Acc:MGI:96795][more]
back to top
BLAST of Intermediate filament b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01241|NF70_DORPE8.545e-11241.0470 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|P23731|IFEB_ASCSU1.542e-9336.03Intermediate filament protein B OS=Ascaris suum OX... [more]
sp|P90901|IFA1_CAEEL5.716e-8936.40Intermediate filament protein ifa-1 OS=Caenorhabdi... [more]
sp|Q19289|IFB1_CAEEL3.812e-8834.67Intermediate filament protein ifb-1 OS=Caenorhabdi... [more]
sp|O02365|IFA2_CAEEL4.887e-8036.70Intermediate filament protein ifa-2 OS=Caenorhabdi... [more]
back to top
BLAST of Intermediate filament b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q95P010.000e+085.23Intermediate filament b OS=Dugesia japonica OX=616... [more]
T1E1E30.000e+066.94LaminB OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A5J6BTN27.459e-17553.64Intermediate filament b-like protein 1 (Fragment) ... [more]
W0GAA81.723e-16752.37Intermediate filament b-like protein OS=Macrostomu... [more]
A0A267FSC21.879e-16752.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Intermediate filament b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb12.613e-2030.03lamin B1 [Source:NCBI gene;Acc:103034386][more]
lmnb13.100e-2030.03lamin B1 [Source:NCBI gene;Acc:103034386][more]
gfap1.356e-1928.91glial fibrillary acidic protein [Source:NCBI gene;... [more]
inab2.342e-1927.36alpha-internexin-like [Source:NCBI gene;Acc:103040... [more]
inab1.561e-1828.62alpha-internexin-like [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of Intermediate filament b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb28.275e-1429.15lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
desmb5.027e-1329.69desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
neflb1.849e-1227.34neurofilament, light polypeptide b [Source:ZFIN;Ac... [more]
ENSPMAT00000007836.17.021e-1226.96pep scaffold:Pmarinus_7.0:GL477602:49686:51609:1 g... [more]
lmnb28.172e-1226.70lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
back to top
BLAST of Intermediate filament b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intermediate filament b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO372256.639e-3527.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398012.053e-629.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intermediate filament b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnl32.602e-2425.95lamin-L(III) [Source:NCBI gene;Acc:101168604][more]
lmnl32.819e-2425.95lamin-L(III) [Source:NCBI gene;Acc:101168604][more]
desmb1.511e-1829.36desmin [Source:NCBI gene;Acc:101174730][more]
desmb4.194e-1829.44desmin [Source:NCBI gene;Acc:101174730][more]
gfap2.686e-1732.17glial fibrillary acidic protein [Source:NCBI gene;... [more]
back to top
BLAST of Intermediate filament b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062826.10.000e+0100.00SMESG000062826.1[more]
SMESG000046289.11.499e-15044.98SMESG000046289.1[more]
SMESG000046938.17.058e-10938.68SMESG000046938.1[more]
SMESG000030598.13.575e-6039.68SMESG000030598.1[more]
SMESG000030598.14.491e-6039.68SMESG000030598.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033119 ID=SMED30033119|Name=Intermediate filament b|organism=Schmidtea mediterranea sexual|type=transcript|length=1930bp
CTTCTTCCGAAATTAAGATACAATCATGTTAACGTCGAAAACAACAACAA
GTAAGACGAACTACAAATCCACAACAAATTCGCCACCAATTCAGCCAATA
TCTGGCTATAGAAATGTTGTCATAACGAGAACTGGACCAACAGTGTCAAC
CGTTGGAACGCAGGGGGGTTCTAACATTCGAACGATTGAAATGAGTAAGA
GCTACGGACTCAGTTCAACTCCTGGCGCTACATCAAACATTGTTCATAAT
GGTGTTAATAATCTAATGAACGGTCGAGAAAAAGAAAAAAATGAACTTCA
AGACCTGAATGATAGATTCGCAAATTATATTGATAAAGTGCGAAATCTAG
AAGACGAAAATAAAAGGCTGAGTGATGAATTAGTTGATTTAAAAGATCAA
TGGGGAAAAGAAACTGCAAGAATCAAAACCTTTTATGACAATGATATGAT
ACAACTGAGACGGTCTCTGGATCAGGCTGAAGGTGCAAAAGCACAAATGG
AAATGAAAATAAATACTTTGGAAGATCTTATCCTAGAAGCTCAGACCGAA
TTAAATGATGCTACACAATTGCATTTGGCGGATAAAGAGACGATAGATAA
AATGGCTAGCACTTTGTCAGATTATGAACACGAAATAGCAAACCTTCGAA
AAAGACTTGGTGGATTAGAAGAGGAGAAGGTTAGAGATAACAAAGAAATA
ATGAGGTTAAAAGAAGAGCTCAATTTATTGAAACAAGATCTTGAGAAAGA
AACGCTCGAACATATTACCGCTCACAACGAACTTCAGTCACTAGTAGACC
AAATTGAATTTTTAAAGAAAATATTCGAATCGGAAGTTCGAGAACTTGCA
TCATTGGTTTATAAAGATTCTACAGAAAATAAAGACTTCTGGCGAAACGA
AATGGCTCAAGCGTTGAGGGATATTCAGACGGAATACGATAGAAAACTAG
ATACGTTACATTACGACATGGAGGCTCAATATACTCTCAAAATCCAAGAA
ATTCGAACGACACAAAGCCAAGAAAATGTTGAAACGGTTCAACTGAGGGA
AGAAAACACCCGACTTAAAGATCAATTGGCTGAAATGAGAAATAGATTAC
CGGAGTTAGAAGCTCGAAACAACGAACTAGAACGGCTGTTAGAACTTTTA
CGTCGAGAAATTGAAGAGAAAAATCGTGAATTTGACTTGGAGAAAAATAA
TTTGAGAAAGGAACTGTTGAACCGAAAGGCTGAACTTGAAGGCATTCTTA
TTGAGCTGCAGATATTATTAGATGCAAAATTAAGCTTGGAACTAGAAATT
ATTGCTTACAGAAAAATGCTGGAAGGCGAAGAATATCGGGTGAATCGAAA
ATCCAATCAAAATCTTAATCAAACTGGAAGAAGTGTAGATACGATGGATC
ATGTAACTAGAACATCTATTAGTCAACAACATGCTGCTCCATCTACCAAA
ACTCAAGTCACAAGTGTCATCAAAGGAGAAATGTCCGCCAAAACTTCATT
CCAAAGAACAGCTAAAGGTAACGTAACCATTCAGGAATGTTCGCCAGATG
GAAAATTTATTATTCTTGAAAATACCGGATCACAAGAAGAAGATATATCT
GGTTACATACTACAACGAAATACTGACAACGGAAGAATCGTAATTAAACA
TGTTATTCCTTCAAAAACAATTCTGGAACCAACGGGAAAAAATAGATATT
ATAAAATTTGGGCACGAGGCAACCGACCGCAAGGTTCAGGTGATCCGGAA
TGTTCAGAATCCAACTGGGGTTTTGGTGCTCAAATAGTAACGGTTCTACA
AAATTCTAAGGGAGAAGAAAAGGCTACCCACACTCAACGAACTGTATATC
AATTATAATTCAACTGACGCTTTCACTGACAATTTTCTAGCTTGACTCTT
TCTAGATGATTTTATAATTTTACTTAACCC
back to top

protein sequence of SMED30033119-orf-1

>SMED30033119-orf-1 ID=SMED30033119-orf-1|Name=SMED30033119-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=611bp
MLTSKTTTSKTNYKSTTNSPPIQPISGYRNVVITRTGPTVSTVGTQGGSN
IRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFAN
YIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQ
AEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDY
EHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAH
NELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDI
QTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQ
LAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNR
KAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQT
GRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNV
TIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTIL
EPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKA
THTQRTVYQL*
back to top
Aliases
The feature 'Intermediate filament b' has the following synonyms
Synonym
H.106.2e
lamin-B
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000033epidermal progenitor cell
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000421tail
PLANA:0002032epidermal cell
PLANA:0007538adhesion gland
Vocabulary: INTERPRO
TermDefinition
IPR039008IF_rod_dom
IPR036415Lamin_tail_dom_sf
IPR042180IF_rod_dom_coil1B
IPR001664IF
IPR016451Intermed_filament_ifa/ifb
IPR001322Lamin_tail_dom
IPR018039IF_conserved
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 141..182
NoneNo IPR availableCOILSCoilCoilcoord: 77..125
NoneNo IPR availableCOILSCoilCoilcoord: 337..414
NoneNo IPR availableCOILSCoilCoilcoord: 190..245
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 357..439
e-value: 1.6E-10
score: 43.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availablePANTHERPTHR45721:SF12INTERMEDIATE FILAMENT PROTEIN IFA-1coord: 30..608
NoneNo IPR availablePANTHERPTHR45721FAMILY NOT NAMEDcoord: 30..608
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 86..119
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 367..438
IPR039008Intermediate filament, rod domainSMARTSM01391Filament_2coord: 86..438
e-value: 3.1E-15
score: 66.6
IPR039008Intermediate filament, rod domainPFAMPF00038Filamentcoord: 86..438
e-value: 4.8E-44
score: 151.2
IPR039008Intermediate filament, rod domainPROSITEPS51842IF_ROD_2coord: 87..439
score: 37.937
IPR036415Lamin tail domain superfamilyGENE3DG3DSA:2.60.40.1260coord: 486..608
e-value: 6.8E-29
score: 102.2
IPR036415Lamin tail domain superfamilySUPERFAMILYSSF74853Lamin A/C globular tail domaincoord: 467..608
IPR001322Lamin tail domainPFAMPF00932LTDcoord: 494..604
e-value: 2.6E-11
score: 43.8
IPR001322Lamin tail domainPROSITEPS51841LTDcoord: 488..606
score: 21.367
IPR016451Intermediate filament, ifa/ifbPIRSFPIRSF005546Ifb-2coord: 1..610
e-value: 1.4E-222
score: 738.1
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 82..176
e-value: 1.6E-20
score: 75.4
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 186..279
e-value: 2.0E-6
score: 29.9
IPR018039Intermediate filament protein, conserved sitePROSITEPS00226IF_ROD_1coord: 425..433