ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30033117
Length (bp)4592
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30033117) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30033117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30033117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30033117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033117h1SMcG0017660 SmedASXL_012884SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30033117h1SMcG0017660 SmedASXL_013803SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033117h1SMcG0017660 Contig8261newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033117h1SMcG0017660 Contig8261uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033117h1SMcG0017660 dd_Smed_v4_16174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033117h1SMcG0017660 dd_Smed_v6_16174_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 154.451 bits (389), Expect = 7.567e-37
Identity = 156/615 (25.37%), Postives = 275/615 (44.72%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +      +      N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H +A +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   78 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVKFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRAAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACK---------KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 640          

HSP 2 Score: 130.183 bits (326), Expect = 1.956e-29
Identity = 141/555 (25.41%), Postives = 230/555 (41.44%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   +    NN  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++    ++ I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    +    K  NGFT LH+A   N IK+++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH +A  GH DV   +++  +  + I      TPL  A     + + + L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+ R ANVN+ +KS            LTPL LA+    +++
Sbjct:  200 LHIAARKDDTKAAALLLQNDNNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLD-RAAPILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN-PNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 706          

HSP 3 Score: 96.6709 bits (239), Expect = 2.842e-19
Identity = 117/507 (23.08%), Postives = 221/507 (43.59%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV----VCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIR 2927
            D+ +C+  L ++   +D   +   T  H +       +  V L    NP  +   G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ ++ +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A     +  AT L++     +          G +++H A Q         +G + +  LL     NVN  +    TPL  AA     +  ++L+   A ++ +   G + LH     G+  +++ ++   S  V+ +  N  TPL  A    H  II+ L++  ++PN+  + G +    A   GY  ++D ++
Sbjct:  339 DHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLSAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVANLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVT-----RQGIASVHLAAQ---------EGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 810          

HSP 4 Score: 68.5514 bits (166), Expect = 1.064e-10
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   34 DANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 287          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 153.68 bits (387), Expect = 1.229e-36
Identity = 156/615 (25.37%), Postives = 275/615 (44.72%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +      +      N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H +A +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVKFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRAAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACK---------KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 129.413 bits (324), Expect = 3.093e-29
Identity = 141/555 (25.41%), Postives = 230/555 (41.44%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   +    NN  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   ++  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    +    K  NGFT LH+A   N IK+++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH +A  GH DV   +++  +  + I      TPL  A     + + + L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+ R ANVN+ +KS            LTPL LA+    +++
Sbjct:  189 LHIAARKDDTKAAALLLQNDNNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN-PNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 695          

HSP 3 Score: 96.2857 bits (238), Expect = 4.449e-19
Identity = 117/507 (23.08%), Postives = 221/507 (43.59%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV----VCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIR 2927
            D+ +C+  L ++   +D   +   T  H +       +  V L    NP  +   G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ ++ +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A     +  AT L++     +          G +++H A Q         +G + +  LL     NVN  +    TPL  AA     +  ++L+   A ++ +   G + LH     G+  +++ ++   S  V+ +  N  TPL  A    H  II+ L++  ++PN+  + G +    A   GY  ++D ++
Sbjct:  328 DHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLSAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVANLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVT-----RQGIASVHLAAQ---------EGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 799          

HSP 4 Score: 68.1662 bits (165), Expect = 1.455e-10
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 153.68 bits (387), Expect = 1.894e-36
Identity = 158/615 (25.69%), Postives = 275/615 (44.72%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+       N I  +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +      +      N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H +A +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   84 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVKFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA-----RNDI--TPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRAAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACK---------KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 646          

HSP 2 Score: 130.183 bits (326), Expect = 2.658e-29
Identity = 142/555 (25.59%), Postives = 235/555 (42.34%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   + L ++N + +ES    SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   ++  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    +    K  NGFT LH+A   N IK+++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH +A  GH DV   +++  +  + I      TPL  A     + + + L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+ R ANVN+ +KS            LTPL LA+    +++
Sbjct:  206 LHIAARKDDTKAAALL-LQNDNNADVES---KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN-PNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNV-RGETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 712          

HSP 3 Score: 94.3597 bits (233), Expect = 1.830e-18
Identity = 109/460 (23.70%), Postives = 204/460 (44.35%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV----VCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIR 2927
            NP  +   G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ ++ +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A     +  AT L++     +          G +++H A Q         +G + +  LL     NVN  +    TPL  AA     +  ++L+   A ++ +   G + LH     G+  +++ ++   S  V+ +  N  TPL  A    H  II+ L++  ++PN+  + G +    A   GY  ++D ++
Sbjct:  392 NPNAKALNGFTPLHIACKKNRIKVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLSAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAA-GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVT-----RQGIASVHLAAQ---------EGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 4 Score: 69.3218 bits (168), Expect = 7.587e-11
Identity = 67/252 (26.59%), Postives = 108/252 (42.86%), Query Frame = 3
Query: 2580 LWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K
Sbjct:   46 LRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVK 285          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 145.976 bits (367), Expect = 3.383e-34
Identity = 149/607 (24.55%), Postives = 264/607 (43.49%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            L   G  +D+    G T  H + L    +++ V +  G N   Q   G T ++++ + N +  ++ +     N    +S +   G TPL  A+Q G    V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F+  +       G +P+ +A K  +  M+  L++     +AK        +  TPLH    +   +  E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  T+LH A  C    +  L      +      N G + +H A +         +  I + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   ++ VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG + +L    G  PLH AA+ G  DV +LLL +    +         K G TPLH AA  N  +I   L++ GA  NI++K             +TPL LAS     D++
Sbjct:   62 LLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----QSTATEDGFTPLAVALQQGHNQAVAILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-------GITPLHVASKRGNTNMVKLLLDRGGQIDAK------TRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSA------GKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ-----------GVTPLHLASQEGHTDMV 616          

HSP 2 Score: 110.153 bits (274), Expect = 2.257e-23
Identity = 134/550 (24.36%), Postives = 227/550 (41.27%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLH---HCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            +H++ R +D  +   +    +N  V       SG TPL  A   G V++   LL     V+    N    T LH A    N  +  LLL    + D K     + +   A    D  + ++    +  +  T +       G SP+ +A +    + +  L++++    A ++ + +D    T LH   HC     TK    LL    +    +  NGFT LH+A   N IK+++LLVK G++ +     G T +H A      +++ L  +            G +A+H A ++         G + + + L  N   V+    + +TPL  A+ LG T+  Q+LL++ A  +    NG + LH +A  G  DV  +++   +    +      TPL  A     + +   L+++R+  +     G +  H AA K    I   +   G    +    G  PLH A++ G  D+  LLL+K         I+   K G+T LH AA  +   +  +L   GA+ +  +K           L  TPL +A
Sbjct:  175 LHIAARKDDTKSAALLLQNDHNADV----QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI--TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKN-------GLSPLHMAAQGDHVECVKHLLQHK----APVDDVTLD--YLTALHVAAHCGHYRVTK----LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR-GETALHMAARA---------GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAH-SLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGAN------IHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTK-----------LGYTPLIVA 673          

HSP 3 Score: 102.064 bits (253), Expect = 8.041e-21
Identity = 116/492 (23.58%), Postives = 199/492 (40.45%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D       + +   A            HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+   S     +  G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +         +G + +  +L       +       TPL  AA  G  D  ++LL+  A  +    NG + LH AA +    +   ++N +    +I      TPL  A    H  ++  L+++ +N +     G +  H AA +   ++ D++ K G         G  PL  A   G   +   LL +         +N   K G TPLH+AA   H  I  +L+  GA  N
Sbjct:  270 GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAH---------CGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR---------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLN-YGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 726          

HSP 4 Score: 81.2629 bits (199), Expect = 1.598e-14
Identity = 99/445 (22.25%), Postives = 177/445 (39.78%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDT--SLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G TPL  A +   + +++ L++   ++ A   +    T +H A F+ +  I  LLL+N A  D+ + + ++ +   A   +   +R +    +  +    +     P+      IA +    +++  L+++ +  +A            TPLH          A  LL+     SL  KK   GFT LH+A    ++ + +LL++  +       +G+T LH A             K    I   + N+GA                                  N V     TPL  A+  G TD   +LL+  A+++    +GL+ LH AA     +V D I+       D       TPL  A    ++ +++FL++Q +N N +   G +  H AA +G+  I++++ + G        NG+  L  A   G   V + L
Sbjct:  369 GFTPLHIACKKNRIKVMELLVKYGASIQAITESGL--TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL--LRNGALVDARAREEQTPLH-----IASRLGKTEIVQLLLQHMAHPDA------ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK---GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAA-----------KKNQMQIASTLLNYGAE--------------------------------TNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVAD-ILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 751          

HSP 5 Score: 70.0922 bits (170), Expect = 3.520e-11
Identity = 69/258 (26.74%), Postives = 109/258 (42.25%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            DS    L AA  G  D     L+   D+N  + NGL+ LH AA  GH  ++  ++   S  VD       T L  A       ++  L+++ +N N Q   G +  + AA + + D++  + + G + +    +G  PL  A + G      +LL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+            TA   +TPL +AS     +++K
Sbjct:    9 DSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGS-SVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDF-----------TARNGITPLHVASKRGNTNMVK 254          

HSP 6 Score: 62.003 bits (149), Expect = 1.171e-8
Identity = 81/344 (23.55%), Postives = 146/344 (42.44%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLAT------IAN---------------------------NIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
             +  L + G  + A    G T  H +  +  L+++ + L  G +P + +  GET +H++ R   +   E +     N +++++ +     TPL  A ++G  +IV+ LLQ   + +A   N Y  T LH +      ++ ++LL+  A   +   K  + +   A+Y   +  +++    ++      S   N   GY+P+ IA K +  Q+ S L+    +  A+ N+  V  +  TPLH       T     LL    + I    K+G T LHLA       +A+                           N+K+V  L+K G+N   +  +G+T LH A 
Sbjct:  384 VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQV---EVVRCLLRNGALVDARAREE-QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA----ADSAGKN---GYTPLHIAAKKNQMQIASTLL----NYGAETNI--VTKQGVTPLHLASQEGHTDMVTLLLDKGAN-IHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAA 707          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 145.591 bits (366), Expect = 3.613e-34
Identity = 149/607 (24.55%), Postives = 264/607 (43.49%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            L   G  +D+    G T  H + L    +++ V +  G N   Q   G T ++++ + N +  ++ +     N    +S +   G TPL  A+Q G    V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F+  +       G +P+ +A K  +  M+  L++     +AK        +  TPLH    +   +  E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  T+LH A  C    +  L      +      N G + +H A +         +  I + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   ++ VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG + +L    G  PLH AA+ G  DV +LLL +    +         K G TPLH AA  N  +I   L++ GA  NI++K             +TPL LAS     D++
Sbjct:   62 LLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----QSTATEDGFTPLAVALQQGHNQAVAILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-------GITPLHVASKRGNTNMVKLLLDRGGQIDAK------TRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSA------GKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ-----------GVTPLHLASQEGHTDMV 616          

HSP 2 Score: 109.768 bits (273), Expect = 2.996e-23
Identity = 133/550 (24.18%), Postives = 225/550 (40.91%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLH---HCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            +H++ R +D  +   +    +N  V       SG TPL  A   G V++   LL     V+    N    T LH A    N  +  LLL    + D K     + +   A    D  + ++    +  +  T +       G SP+ +A +    + +  L+++++  +       V  +  T LH   HC     TK    LL    +    +  NGFT LH+A   N IK+++LLVK G++ +     G T +H A      +++ L  +            G +A+H A ++         G + + + L  N   V+    + +TPL  A+ LG T+  Q+LL++ A  +    NG + LH +A  G  DV  +++   +    +      TPL  A     + +   L+++R+  +     G +  H AA K    I   +   G    +    G  PLH A++ G  D+  LLL+K         I+   K G+T LH AA  +   +  +L   GA+ +  +K           L  TPL +A
Sbjct:  175 LHIAARKDDTKSAALLLQNDHNADV----QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI--TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKN-------GLSPLHMAAQGDHVECVKHLLQHKAPVD------DVTLDYLTALHVAAHCGHYRVTK----LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR-GETALHMAARA---------GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAH-SLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGAN------IHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTK-----------LGYTPLIVA 673          

HSP 3 Score: 101.679 bits (252), Expect = 9.821e-21
Identity = 116/492 (23.58%), Postives = 199/492 (40.45%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D       + +   A            HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+   S     +  G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +         +G + +  +L       +       TPL  AA  G  D  ++LL+  A  +    NG + LH AA +    +   ++N +    +I      TPL  A    H  ++  L+++ +N +     G +  H AA +   ++ D++ K G         G  PL  A   G   +   LL +         +N   K G TPLH+AA   H  I  +L+  GA  N
Sbjct:  270 GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAH---------CGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR---------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLN-YGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 726          

HSP 4 Score: 80.8777 bits (198), Expect = 1.769e-14
Identity = 99/445 (22.25%), Postives = 177/445 (39.78%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDT--SLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G TPL  A +   + +++ L++   ++ A   +    T +H A F+ +  I  LLL+N A  D+ + + ++ +   A   +   +R +    +  +    +     P+      IA +    +++  L+++ +  +A            TPLH          A  LL+     SL  KK   GFT LH+A    ++ + +LL++  +       +G+T LH A             K    I   + N+GA                                  N V     TPL  A+  G TD   +LL+  A+++    +GL+ LH AA     +V D I+       D       TPL  A    ++ +++FL++Q +N N +   G +  H AA +G+  I++++ + G        NG+  L  A   G   V + L
Sbjct:  369 GFTPLHIACKKNRIKVMELLVKYGASIQAITESGL--TPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL--LRNGALVDARAREEQTPLH-----IASRLGKTEIVQLLLQHMAHPDA------ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK---GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAA-----------KKNQMQIASTLLNYGAE--------------------------------TNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVAD-ILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 751          

HSP 5 Score: 70.0922 bits (170), Expect = 3.557e-11
Identity = 69/258 (26.74%), Postives = 109/258 (42.25%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            DS    L AA  G  D     L+   D+N  + NGL+ LH AA  GH  ++  ++   S  VD       T L  A       ++  L+++ +N N Q   G +  + AA + + D++  + + G + +    +G  PL  A + G      +LL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+            TA   +TPL +AS     +++K
Sbjct:    9 DSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGS-SVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDF-----------TARNGITPLHVASKRGNTNMVK 254          

HSP 6 Score: 62.003 bits (149), Expect = 1.246e-8
Identity = 81/344 (23.55%), Postives = 146/344 (42.44%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLAT------IAN---------------------------NIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
             +  L + G  + A    G T  H +  +  L+++ + L  G +P + +  GET +H++ R   +   E +     N +++++ +     TPL  A ++G  +IV+ LLQ   + +A   N Y  T LH +      ++ ++LL+  A   +   K  + +   A+Y   +  +++    ++      S   N   GY+P+ IA K +  Q+ S L+    +  A+ N+  V  +  TPLH       T     LL    + I    K+G T LHLA       +A+                           N+K+V  L+K G+N   +  +G+T LH A 
Sbjct:  384 VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQV---EVVRCLLRNGALVDARAREE-QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA----ADSAGKN---GYTPLHIAAKKNQMQIASTLL----NYGAETNI--VTKQGVTPLHLASQEGHTDMVTLLLDKGAN-IHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAA 707          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: nphp-2 (NePHronoPhthisis (Human kidney disease) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVZ6])

HSP 1 Score: 165.622 bits (418), Expect = 1.948e-41
Identity = 126/406 (31.03%), Postives = 196/406 (48.28%), Query Frame = 3
Query: 2133 ELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSF-LSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMP-VDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDS---LTIDILKDF-RGKKATELKVESLSENYPIN 3332
            E +  +H+   + D K  + +   D SL+  KD  G T L  A +A  I+    L   G++ +  D  G  +LHWAVVC   D ++     + ++         + +HYAT S  ++PE  V   I+I  L        N +D D RTP+ W +S G  +  + L  +  DL  RD   L++LHCAAS G+++VI+  +   + P +D  D    T LFYA++  H      L++  +NPN QD +  + AH AA KG   +L L+++   S  ++N  GDLP HEA + G  DV E LL   E   ++      N  G T +H AA   + ++  LL ++   V+ L    ++I         TPLDLA+     + ++ L    R K + E   E + EN+  N
Sbjct:   35 EKKVAIHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYATCSEDIAPE--VSQAILITLLKHGADP--NAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLAVDESVLDIP-----NHNGRTAIHLAASVGNLEMVILLCTKKCFVDPLCSREKEI--------FTPLDLATKQNHVVVVEYLTKLCRAKSSKEFSPEYI-ENWKTN 422          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: nphp-2 (NePHronoPhthisis (Human kidney disease) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVZ6])

HSP 1 Score: 165.622 bits (418), Expect = 2.152e-41
Identity = 126/406 (31.03%), Postives = 196/406 (48.28%), Query Frame = 3
Query: 2133 ELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSF-LSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMP-VDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDS---LTIDILKDF-RGKKATELKVESLSENYPIN 3332
            E +  +H+   + D K  + +   D SL+  KD  G T L  A +A  I+    L   G++ +  D  G  +LHWAVVC   D ++     + ++         + +HYAT S  ++PE  V   I+I  L        N +D D RTP+ W +S G  +  + L  +  DL  RD   L++LHCAAS G+++VI+  +   + P +D  D    T LFYA++  H      L++  +NPN QD +  + AH AA KG   +L L+++   S  ++N  GDLP HEA + G  DV E LL   E   ++      N  G T +H AA   + ++  LL ++   V+ L    ++I         TPLDLA+     + ++ L    R K + E   E + EN+  N
Sbjct:   35 EKKVAIHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYATCSEDIAPE--VSQAILITLLKHGADP--NAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLAVDESVLDIP-----NHNGRTAIHLAASVGNLEMVILLCTKKCFVDPLCSREKEI--------FTPLDLATKQNHVVVVEYLTKLCRAKSSKEFSPEYI-ENWKTN 422          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.946 bits (315), Expect = 1.518e-28
Identity = 131/573 (22.86%), Postives = 250/573 (43.63%), Query Frame = 3
Query: 1683 SETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXN-----HGAS----------------AIHYATQSFLSP-EGSVQGPIV-IXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATELKVESLSENYPIN 3332
            S  +G   L  A + G  ++V++L++    V+A    +   TALH A       I T+L++N A  +++     + +   A+   +  ++ +  + +++  ST         G++P+ +A +    ++++ L+EN+S  + +L           P  H     D   A  LL  +        K+GFT LH+A    +  + QLL++ G+N   Q     + LH A     T++ +L       I     +     H A+                 I   T++ L+P   + QG  V   + L  ++  V+ V  D  TPL  AA  G     ++LL+ SAD N R  NG + LH A  +    V++L++  +   ++    +  TPL  A  +  ++I+ +L++Q +NP+ + ++G +  H AA     D++ ++ + G  +  +      PLH A+  G  D+  LLL      N         +   +PLH AA     ++  +L+   A+  +L+K              TPL LAS    +++++    ++ T + +E  ++  P++
Sbjct:   62 SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAA--TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED-------GFTPLAVALQQGHDRVVAVLLENDSKGKVRL-----------PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK-YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT------TRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-----------GFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVTPLH 595          

HSP 2 Score: 119.013 bits (297), Expect = 1.859e-26
Identity = 150/617 (24.31%), Postives = 253/617 (41.00%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENES--DSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   +  L +    +DA    G T  H + L     ++ + +  G N  +Q   G T ++++ + N    ++ +  +  N ++    S   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+    TLLL+N+   D+      + +   A Y  +N  +++    ++  +    N        SP+ +A K     M + L+   +  DS  K        +L TPLH C   S       LL +  + I  K KNG   LH+A   +++   + L+ + +   D   D  T LH A  C    +  L      D      N G + +H A +         +  I + +LL   +  +        TPL  AA +G  +    LL+  A+ +     G + LH AA     DV+ +++   +  VD +   L TPL  A  L +  I+  L++  +N N       S  H AA +G  ++  ++       TL    G  PLH A++ G  +V  LLL +         ++   K  +TPLH AAH N+ K+  LL+  GA+    +K+             TPL +A+    ++I
Sbjct:   76 EGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL----STEDGFTPLAVALQQGHDRVVAVLLEND------SKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHN-------ISPLHVATKWGRTNMANLLLSRGAIIDSRTK--------DLLTPLH-CAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALN-GFTPLHIACK---------KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-----------GYTPLHIAAKKNQMEI 638          

HSP 3 Score: 107.071 bits (266), Expect = 9.099e-23
Identity = 145/590 (24.58%), Postives = 239/590 (40.51%), Query Frame = 3
Query: 1575 DSEGET---IMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS-------FLSPEGS--------VQGPIVIXXXXXXXXXXV---------NCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAV--------------------------TLKH-------MSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            DS+G+     +H++ + +D  A   +    +NP V    +  SG TPL  A   G  ++ + LL+   NVN Q   ++  + LH A       +  LLL   A  D +     + +   A    D  + ++     + I +   N      G +P+ +A +         L+ +     A ++ + VD    TPLH        + A KLL   ++    +  NGFT LH+A   N IK+V+LL+K  +  +     G T LH A    A +++    +   +        G + +H A ++        L   G+        +Q P+ I   L N    +         N    D+ +PL  AA  G  +   ILL+++AD       G + LH A+  G+ +V+ L++   + PVDIE  N  TPL  A                           T  H       M I   L++ +++PN +   G +  H +A +G+ +I  L+ + G  +  + NNG   +H  A+     V ++L N   E      IN     G TPLH A H     + K L+  GA+V 
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV----TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA--RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKN------GLAPLHMAAQGDHVDAARTLLYHR----APVDDVTVD--YLTPLHVAAHCGHVRVA-KLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE------INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG 749          

HSP 4 Score: 86.2705 bits (212), Expect = 1.627e-16
Identity = 104/414 (25.12%), Postives = 163/414 (39.37%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEY--------------PKD-------NFLRIITHYSSSEIF-----STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
            NP ++   GET +HL+ R N    +    L  N   V     E    TPL  A ++G  DIV  LLQ   N NA   + Y  + LH A     EE+  +LL + A   +   K  + +   ++Y              P D         L +  HY++ ++      +  S       GY+P+ IA K +  ++ S L++ ++D  AK           TPLH        + +  L++ + S +G K  NG T +HL    +++ + Q+L  NG+    + N G+T LH   V C                           H+             G + + K L  N  +V      S TPL  AA  G  +C + LLEN A  N +   G + L  A   G+  V++ +
Sbjct:  450 NPDVETVRGETPLHLAARANQTDVVRV--LIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAK------SRAGFTPLHLSAQEGHKEISGLLIE-NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLH---VAC---------------------------HF-------------GQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 82.0333 bits (201), Expect = 3.879e-15
Identity = 65/225 (28.89%), Postives = 100/225 (44.44%), Query Frame = 3
Query: 2577 LLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLN----------------KMEECNELELI--NEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSN 3182
             L AA  G  +    LL    D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       I+  L+E  +N N Q + G +  + AA + + +++  + K G +  L   +G  PL  A + G   V  +LL                 K ++     L+  NE N     K G TPLH AAH  H  + +LL+ +GANVN  ++ N
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ-VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHN 260          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.946 bits (315), Expect = 1.518e-28
Identity = 131/573 (22.86%), Postives = 250/573 (43.63%), Query Frame = 3
Query: 1683 SETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXN-----HGAS----------------AIHYATQSFLSP-EGSVQGPIV-IXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATELKVESLSENYPIN 3332
            S  +G   L  A + G  ++V++L++    V+A    +   TALH A       I T+L++N A  +++     + +   A+   +  ++ +  + +++  ST         G++P+ +A +    ++++ L+EN+S  + +L           P  H     D   A  LL  +        K+GFT LH+A    +  + QLL++ G+N   Q     + LH A     T++ +L       I     +     H A+                 I   T++ L+P   + QG  V   + L  ++  V+ V  D  TPL  AA  G     ++LL+ SAD N R  NG + LH A  +    V++L++  +   ++    +  TPL  A  +  ++I+ +L++Q +NP+ + ++G +  H AA     D++ ++ + G  +  +      PLH A+  G  D+  LLL      N         +   +PLH AA     ++  +L+   A+  +L+K              TPL LAS    +++++    ++ T + +E  ++  P++
Sbjct:   62 SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAA--TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED-------GFTPLAVALQQGHDRVVAVLLENDSKGKVRL-----------PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK-YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT------TRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-----------GFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVTPLH 595          

HSP 2 Score: 119.013 bits (297), Expect = 1.859e-26
Identity = 150/617 (24.31%), Postives = 253/617 (41.00%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENES--DSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   +  L +    +DA    G T  H + L     ++ + +  G N  +Q   G T ++++ + N    ++ +  +  N ++    S   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+    TLLL+N+   D+      + +   A Y  +N  +++    ++  +    N        SP+ +A K     M + L+   +  DS  K        +L TPLH C   S       LL +  + I  K KNG   LH+A   +++   + L+ + +   D   D  T LH A  C    +  L      D      N G + +H A +         +  I + +LL   +  +        TPL  AA +G  +    LL+  A+ +     G + LH AA     DV+ +++   +  VD +   L TPL  A  L +  I+  L++  +N N       S  H AA +G  ++  ++       TL    G  PLH A++ G  +V  LLL +         ++   K  +TPLH AAH N+ K+  LL+  GA+    +K+             TPL +A+    ++I
Sbjct:   76 EGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL----STEDGFTPLAVALQQGHDRVVAVLLEND------SKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHN-------ISPLHVATKWGRTNMANLLLSRGAIIDSRTK--------DLLTPLH-CAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALN-GFTPLHIACK---------KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-----------GYTPLHIAAKKNQMEI 638          

HSP 3 Score: 107.071 bits (266), Expect = 9.099e-23
Identity = 145/590 (24.58%), Postives = 239/590 (40.51%), Query Frame = 3
Query: 1575 DSEGET---IMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS-------FLSPEGS--------VQGPIVIXXXXXXXXXXV---------NCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAV--------------------------TLKH-------MSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            DS+G+     +H++ + +D  A   +    +NP V    +  SG TPL  A   G  ++ + LL+   NVN Q   ++  + LH A       +  LLL   A  D +     + +   A    D  + ++     + I +   N      G +P+ +A +         L+ +     A ++ + VD    TPLH        + A KLL   ++    +  NGFT LH+A   N IK+V+LL+K  +  +     G T LH A    A +++    +   +        G + +H A ++        L   G+        +Q P+ I   L N    +         N    D+ +PL  AA  G  +   ILL+++AD       G + LH A+  G+ +V+ L++   + PVDIE  N  TPL  A                           T  H       M I   L++ +++PN +   G +  H +A +G+ +I  L+ + G  +  + NNG   +H  A+     V ++L N   E      IN     G TPLH A H     + K L+  GA+V 
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV----TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA--RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKN------GLAPLHMAAQGDHVDAARTLLYHR----APVDDVTVD--YLTPLHVAAHCGHVRVA-KLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE------INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG 749          

HSP 4 Score: 86.2705 bits (212), Expect = 1.627e-16
Identity = 104/414 (25.12%), Postives = 163/414 (39.37%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEY--------------PKD-------NFLRIITHYSSSEIF-----STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
            NP ++   GET +HL+ R N    +    L  N   V     E    TPL  A ++G  DIV  LLQ   N NA   + Y  + LH A     EE+  +LL + A   +   K  + +   ++Y              P D         L +  HY++ ++      +  S       GY+P+ IA K +  ++ S L++ ++D  AK           TPLH        + +  L++ + S +G K  NG T +HL    +++ + Q+L  NG+    + N G+T LH   V C                           H+             G + + K L  N  +V      S TPL  AA  G  +C + LLEN A  N +   G + L  A   G+  V++ +
Sbjct:  450 NPDVETVRGETPLHLAARANQTDVVRV--LIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAK------SRAGFTPLHLSAQEGHKEISGLLIE-NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLH---VAC---------------------------HF-------------GQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 82.0333 bits (201), Expect = 3.879e-15
Identity = 65/225 (28.89%), Postives = 100/225 (44.44%), Query Frame = 3
Query: 2577 LLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLN----------------KMEECNELELI--NEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSN 3182
             L AA  G  +    LL    D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       I+  L+E  +N N Q + G +  + AA + + +++  + K G +  L   +G  PL  A + G   V  +LL                 K ++     L+  NE N     K G TPLH AAH  H  + +LL+ +GANVN  ++ N
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ-VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHN 260          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.561 bits (314), Expect = 1.672e-28
Identity = 131/573 (22.86%), Postives = 250/573 (43.63%), Query Frame = 3
Query: 1683 SETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXN-----HGAS----------------AIHYATQSFLSP-EGSVQGPIV-IXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATELKVESLSENYPIN 3332
            S  +G   L  A + G  ++V++L++    V+A    +   TALH A       I T+L++N A  +++     + +   A+   +  ++ +  + +++  ST         G++P+ +A +    ++++ L+EN+S  + +L           P  H     D   A  LL  +        K+GFT LH+A    +  + QLL++ G+N   Q     + LH A     T++ +L       I     +     H A+                 I   T++ L+P   + QG  V   + L  ++  V+ V  D  TPL  AA  G     ++LL+ SAD N R  NG + LH A  +    V++L++  +   ++    +  TPL  A  +  ++I+ +L++Q +NP+ + ++G +  H AA     D++ ++ + G  +  +      PLH A+  G  D+  LLL      N         +   +PLH AA     ++  +L+   A+  +L+K              TPL LAS    +++++    ++ T + +E  ++  P++
Sbjct:   62 SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAA--TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED-------GFTPLAVALQQGHDRVVAVLLENDSKGKVRL-----------PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK-YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT------TRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-----------GFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVTPLH 595          

HSP 2 Score: 119.013 bits (297), Expect = 1.961e-26
Identity = 150/617 (24.31%), Postives = 253/617 (41.00%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENES--DSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   +  L +    +DA    G T  H + L     ++ + +  G N  +Q   G T ++++ + N    ++ +  +  N ++    S   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+    TLLL+N+   D+      + +   A Y  +N  +++    ++  +    N        SP+ +A K     M + L+   +  DS  K        +L TPLH C   S       LL +  + I  K KNG   LH+A   +++   + L+ + +   D   D  T LH A  C    +  L      D      N G + +H A +         +  I + +LL   +  +        TPL  AA +G  +    LL+  A+ +     G + LH AA     DV+ +++   +  VD +   L TPL  A  L +  I+  L++  +N N       S  H AA +G  ++  ++       TL    G  PLH A++ G  +V  LLL +         ++   K  +TPLH AAH N+ K+  LL+  GA+    +K+             TPL +A+    ++I
Sbjct:   76 EGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQAL----STEDGFTPLAVALQQGHDRVVAVLLEND------SKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHN-------ISPLHVATKWGRTNMANLLLSRGAIIDSRTK--------DLLTPLH-CAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALN-GFTPLHIACK---------KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-----------GYTPLHIAAKKNQMEI 638          

HSP 3 Score: 107.071 bits (266), Expect = 9.265e-23
Identity = 145/590 (24.58%), Postives = 239/590 (40.51%), Query Frame = 3
Query: 1575 DSEGET---IMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS-------FLSPEGS--------VQGPIVIXXXXXXXXXXV---------NCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAV--------------------------TLKH-------MSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            DS+G+     +H++ + +D  A   +    +NP V    +  SG TPL  A   G  ++ + LL+   NVN Q   ++  + LH A       +  LLL   A  D +     + +   A    D  + ++     + I +   N      G +P+ +A +         L+ +     A ++ + VD    TPLH        + A KLL   ++    +  NGFT LH+A   N IK+V+LL+K  +  +     G T LH A    A +++    +   +        G + +H A ++        L   G+        +Q P+ I   L N    +         N    D+ +PL  AA  G  +   ILL+++AD       G + LH A+  G+ +V+ L++   + PVDIE  N  TPL  A                           T  H       M I   L++ +++PN +   G +  H +A +G+ +I  L+ + G  +  + NNG   +H  A+     V ++L N   E      IN     G TPLH A H     + K L+  GA+V 
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV----TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA--RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKN------GLAPLHMAAQGDHVDAARTLLYHR----APVDDVTVD--YLTPLHVAAHCGHVRVA-KLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE------INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG 749          

HSP 4 Score: 86.6557 bits (213), Expect = 1.350e-16
Identity = 104/414 (25.12%), Postives = 163/414 (39.37%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEY--------------PKD-------NFLRIITHYSSSEIF-----STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
            NP ++   GET +HL+ R N    +    L  N   V     E    TPL  A ++G  DIV  LLQ   N NA   + Y  + LH A     EE+  +LL + A   +   K  + +   ++Y              P D         L +  HY++ ++      +  S       GY+P+ IA K +  ++ S L++ ++D  AK           TPLH        + +  L++ + S +G K  NG T +HL    +++ + Q+L  NG+    + N G+T LH   V C                           H+             G + + K L  N  +V      S TPL  AA  G  +C + LLEN A  N +   G + L  A   G+  V++ +
Sbjct:  450 NPDVETVRGETPLHLAARANQTDVVRV--LIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAK------SRAGFTPLHLSAQEGHKEISGLLIE-NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLH---VAC---------------------------HF-------------GQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 82.0333 bits (201), Expect = 3.589e-15
Identity = 65/225 (28.89%), Postives = 100/225 (44.44%), Query Frame = 3
Query: 2577 LLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLN----------------KMEECNELELI--NEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSN 3182
             L AA  G  +    LL    D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       I+  L+E  +N N Q + G +  + AA + + +++  + K G +  L   +G  PL  A + G   V  +LL                 K ++     L+  NE N     K G TPLH AAH  H  + +LL+ +GANVN  ++ N
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQ-VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHN 260          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42534 (gene:FBgn0260487 transcript:FBtr0300898)

HSP 1 Score: 231.876 bits (590), Expect = 5.452e-61
Identity = 155/466 (33.26%), Postives = 239/466 (51.29%), Query Frame = 3
Query: 2019 GYSPVIIACKNSDF-QMLSDLIENESDSEAKLNMLKV-DNELRTPLHHCVDNSDTKCAEKLLKLDTS------LIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQ-SFLSPEGSVQGPI----------VIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA---SDSLTIDILKDFRGKKATELKVESLSENYPINNSNDKD 3350
            G + ++ AC+  D  Q+L+ + E       K  +L+  D   R  LH+C    D++ ++ L+   +       L+   D++GFT LHLA I  N+ +V LL+ N ++    DN+GH+ +HWA VC   + +         + K   N G + +HYA Q    S + S Q             ++  LL + + +V+  D D R PLLWAAS G       L++  A +   D +GL+ LHCA SRGH + ID ++     P D+ D+N CT L YAVTL H      L++  ++PN+QD KGR+ AHC   KG  + L L+++ G +L LRN  GDLPLHEAA +G+ ++ E LL         + +N  +  G + LH AA N++  +CKLL+  GA+VN        + + +  L LTPLD A       T   L+   G+ A ++++ S     P + +N  D
Sbjct:  123 GCTSLMYACQRGDIVQVLAQMRE-------KPELLRQRDRSHRNALHYCAAQ-DSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDAN-GGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLL-----AQRPKQVNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNA-------VYRNSRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKVRLSSRRTGNPFHETNATD 567          

HSP 2 Score: 71.633 bits (174), Expect = 5.817e-12
Identity = 120/521 (23.03%), Postives = 188/521 (36.08%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNA-QENNKYKRTALHYALFID------------------------NEEIFT---------------LLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI----VNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDI---KGRSVAHCAALKGYCDILDLIRKAGGSL--TLRNNNGDL--PLHEAAETGKFDVCELL-LNKMEECNELELINEFNKKGMTPLHK 3101
            G T L+YA Q G  DIV+ L Q+       ++ ++  R ALHY    D                        +E+ FT               LLL NKA  +  D +  SV+       +   LR +    +S   + P  N   P+ Y+  +      D +  +    +   S   L +                         LL    S +  +DK+G   L  A  A + K V  LVK G+  +  D DG T+LH A     T+ ID    +      +ID++G +A+HYA                                           +LG  D    LL+  AD N +D  G +  HC  S+G ++ + L+     N W     + +     PL  A       ++ +L+ QR  P Q +     GRS+ H AA   Y D+  L+   G  +    RN+ G +  PL  A + G     + L  N  +  N++ L    +++   P H+
Sbjct:  123 GCTSLMYACQRG--DIVQVLAQMREKPELLRQRDRSHRNALHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGAS--VAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGI-------------------------LLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAV------------------------------------------TLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLW-----LRNAKGDLPLHEAAASGRRELLEWLLAQR--PKQVNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNAVYRNSRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKVRL---SSRRTGNPFHE 562          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42534 (gene:FBgn0260487 transcript:FBtr0309307)

HSP 1 Score: 227.639 bits (579), Expect = 9.770e-60
Identity = 146/432 (33.80%), Postives = 223/432 (51.62%), Query Frame = 3
Query: 2115 MLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTS------LIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQ-SFLSPEGSVQGPI----------VIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA---SDSLTIDILKDFRGKKATELKVESLSENYPINNSNDKD 3350
            + + D   R  LH+C    D++ ++ L+   +       L+   D++GFT LHLA I  N+ +V LL+ N ++    DN+GH+ +HWA VC   + +         + K   N G + +HYA Q    S + S Q             ++  LL + + +V+  D D R PLLWAAS G       L++  A +   D +GL+ LHCA SRGH + ID ++     P D+ D+N CT L YAVTL H      L++  ++PN+QD KGR+ AHC   KG  + L L+++ G +L LRN  GDLPLHEAA +G+ ++ E LL         + +N  +  G + LH AA N++  +CKLL+  GA+VN        + + +  L LTPLD A       T   L+   G+ A ++++ S     P + +N  D
Sbjct:   25 LRQRDRSHRNALHYCAAQ-DSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDAN-GGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLL-----AQRPKQVNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNA-------VYRNSRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKVRLSSRRTGNPFHETNATD 442          

HSP 2 Score: 71.633 bits (174), Expect = 6.357e-12
Identity = 104/444 (23.42%), Postives = 165/444 (37.16%), Query Frame = 3
Query: 1806 TALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI----VNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIK---GRSVAHCAALKGYCDILDLIRKAGGSL--TLRNNNGDL--PLHEAAETGKFDVCELL-LNKMEECNELELINEFNKKGMTPLHK 3101
            T LH A+   N  +  LLL NKA  +  D +  SV+       +   LR +    +S   + P  N   P+ Y+  +      D +  +    +   S   L +                         LL    S +  +DK+G   L  A  A + K V  LVK G+  +  D DG T+LH A     T+ ID    +      +ID++G +A+HYA                                           +LG  D    LL+  AD N +D  G +  HC  S+G ++ + L+     N W     + +     PL  A       ++ +L+ QR  P Q +     GRS+ H AA   Y D+  L+   G  +    RN+ G +  PL  A + G     + L  N  +  N++ L    +++   P H+
Sbjct:   73 TPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGAS--VAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGI-------------------------LLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAV------------------------------------------TLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLW-----LRNAKGDLPLHEAAASGRRELLEWLLAQR--PKQVNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNAVYRNSRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKVRL---SSRRTGNPFHE 437          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 134.806 bits (338), Expect = 3.471e-31
Identity = 158/585 (27.01%), Postives = 254/585 (43.42%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHY--SSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA-VVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS----------------FLSPEG-------SVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF 3272
            +H++ + ND+ A + +  +  N  ++      SG TPL  A   G VDI   LL    +VN     K+  T LH A       + TLLL   AK D       + +   +   +   + +I H    ++ I +   N      G S + +A +    +    L++N++  +      +V  +  T LH        K A+ LL    +    +  NGFT LH+A   N IK+V+LL+K+G+N       G T LH A  + C   +I L        +  I   G + +H A ++                 ++ EG       S  G I I  LL  +   +N    D  + L  AA  G  +  Q+LLEN A+ N     G + LH A   G  +V+ +++   +  +D +  N  TPL  A    + SI+  L++  S+PN     G+   H A  K Y +I   + + G  + + + +G  PLH AA+ G  D+ +LLL       E  +I+   K G+TPLH AA   H  + ++L+  GAN          I++ T N   TPL +A+    +D++K F
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSK----SGFTPLHIAAHYGNVDIATLLLNNKADVNYVA--KHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCAS---RSGHVEVIKHLLQQNAPILTKTKN------GLSALHMAAQGEHDEAAHLLLDNKAPVD------EVTVDYLTALHVAAHCGHVKVAKLLLDYKAN-PNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTI--RGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGA-SIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL-------EYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGAN----------ISERTRN-GYTPLHMAAHYGHLDLVKFF 746          

HSP 2 Score: 112.849 bits (281), Expect = 1.860e-24
Identity = 124/472 (26.27%), Postives = 211/472 (44.70%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSP-EGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDL 2972
            NP  +   G T +H++ + N +  +E +  +  N       +  SG TPL  A  +G ++IV  LLQ   +  A        T LH A   +  +I  +LL++ AK D    + ++ +   +     N + ++  + +    +  SN+      YS + IA K     ++  L+EN +++ A      V  +  TPLH           + LL+   S I  + KN  T LH+AT  NN  +V+LL+KNGS+      +G  ++H A             K   +I   +  HGA  ++  ++S  SP   + QG  V    L      ++    +  TPL  AA  G     QILLE+ A+++ R  NG + LH AA  GH D++   +      +++  N   TPL  A    H+ II+ L+  ++NPN     G +  H A+  GY  +++ ++    +  + +N G +
Sbjct:  391 NPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGA----TTESGLTPLHVASFMGCINIVIYLLQHEAS--ADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAE--INAQSNDK-----YSALHIAAKEGQENIVQVLLENGAENNA------VTKKGFTPLHLACKYGKQNVVQILLQNGAS-IDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIAC-----------KKNYLEIAMQLLQHGAD-VNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIEN-DADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAI 828          

HSP 3 Score: 105.916 bits (263), Expect = 2.444e-22
Identity = 125/524 (23.85%), Postives = 220/524 (41.98%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTP-LHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            G   L  A + G VDI  +LL+  + ++     K   TALH A      ++   L+   A  +++     + +   A+   DN  R +    ++   ST         G++P+ +A +    ++++ L+EN+           V  ++R P LH     +D   A+ LL+ D +      K+GFT LH+A    N+ +  LL+ N ++                                     +  H  + +H A +          G + +  LL      ++    D  TPL  A+  G  +  + LL+ +A +  +  NGLS LH AA   H +   L+++  + PVD    +  T L  A    H+ +   L++ ++NPN + + G +  H A  K    +++L+ K G ++     +G  PLH A+  G  ++   LL + E   +L  I     +G TPLH AA  N   I ++L+ R A V+ +++  Q           TPL +AS    I+I+
Sbjct:   73 GLNALHLAAKDGYVDICCELLRRGIKID--NATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTED-------GFTPLAVAMQQGHDKIVAVLLEND-----------VRGKVRLPALHIAAKKNDVNAAKLLLQHDPN-ADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVN----------------------------------YVAKHNITPLHVACK---------WGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKA-PVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLL-QHEASADLPTI-----RGETPLHLAARANQADIIRILL-RSAKVDAIAREGQ-----------TPLHVASRLGNINII 513          

HSP 4 Score: 83.5741 bits (205), Expect = 1.436e-15
Identity = 125/531 (23.54%), Postives = 212/531 (39.92%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESD----SEAKLNMLKVDNEL-----------------------RTPLHHCVDNSDTKCAEKLL---KLDT----------------------------SLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAA 3107
            G TPL  A + G V+++K LLQ N  +  +  N    +ALH A   +++E   LLL NKA  D       + +   A        +++  Y +         NPN     G++P+ IACK +  +M+  LI++ ++    +E+ L  L V + +                        TPLH     +       LL   K+D                             + I  +  + ++ LH+A       +VQ+L++NG+        G T LH A      +++ +  +    I     N   + +H AT  + +P         I +LL  N  + N    + +  +  A      +    LL++ AD+N    +G S LH AA  G+ D++ L++      +     N  TPL  A    H+ +   L+E  +N +++   G +  H AA  G+ D++    +    + + +N G  PLH+AA+ G   +  LLL      N L       K G T LH A+
Sbjct:  300 GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGL--SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKA---------NPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKN-DVTPLHVATH-YNNPS--------IVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV--ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNAL------TKDGNTALHIAS 801          

HSP 5 Score: 72.4034 bits (176), Expect = 3.909e-12
Identity = 76/305 (24.92%), Postives = 127/305 (41.64%), Query Frame = 3
Query: 2460 ATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPN--------------------------QQDIKGR---SVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKA 3287
            AT SFL    S     V++ L      ++N  + +    L  AA  G  D C  LL     +++    G + LH A+  G +DVI+ ++  ++  V+++  N  TPL+ A    H +    L+   +NP+                          + D++G+      H AA K   +   L+ +   +  + + +G  PLH AA  G  D+  LLLN   +      +N   K  +TPLH A       +C LL+ RGA ++  ++             LTPL  AS S  ++++K    + A
Sbjct:   38 ATISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLI-LYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKAD------VNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD-----------GLTPLHCASRSGHVEVIKHLLQQNA 324          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 134.806 bits (338), Expect = 3.471e-31
Identity = 158/585 (27.01%), Postives = 254/585 (43.42%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHY--SSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA-VVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS----------------FLSPEG-------SVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF 3272
            +H++ + ND+ A + +  +  N  ++      SG TPL  A   G VDI   LL    +VN     K+  T LH A       + TLLL   AK D       + +   +   +   + +I H    ++ I +   N      G S + +A +    +    L++N++  +      +V  +  T LH        K A+ LL    +    +  NGFT LH+A   N IK+V+LL+K+G+N       G T LH A  + C   +I L        +  I   G + +H A ++                 ++ EG       S  G I I  LL  +   +N    D  + L  AA  G  +  Q+LLEN A+ N     G + LH A   G  +V+ +++   +  +D +  N  TPL  A    + SI+  L++  S+PN     G+   H A  K Y +I   + + G  + + + +G  PLH AA+ G  D+ +LLL       E  +I+   K G+TPLH AA   H  + ++L+  GAN          I++ T N   TPL +A+    +D++K F
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSK----SGFTPLHIAAHYGNVDIATLLLNNKADVNYVA--KHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCAS---RSGHVEVIKHLLQQNAPILTKTKN------GLSALHMAAQGEHDEAAHLLLDNKAPVD------EVTVDYLTALHVAAHCGHVKVAKLLLDYKAN-PNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTI--RGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGA-SIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL-------EYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGAN----------ISERTRN-GYTPLHMAAHYGHLDLVKFF 746          

HSP 2 Score: 112.849 bits (281), Expect = 1.860e-24
Identity = 124/472 (26.27%), Postives = 211/472 (44.70%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSP-EGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDL 2972
            NP  +   G T +H++ + N +  +E +  +  N       +  SG TPL  A  +G ++IV  LLQ   +  A        T LH A   +  +I  +LL++ AK D    + ++ +   +     N + ++  + +    +  SN+      YS + IA K     ++  L+EN +++ A      V  +  TPLH           + LL+   S I  + KN  T LH+AT  NN  +V+LL+KNGS+      +G  ++H A             K   +I   +  HGA  ++  ++S  SP   + QG  V    L      ++    +  TPL  AA  G     QILLE+ A+++ R  NG + LH AA  GH D++   +      +++  N   TPL  A    H+ II+ L+  ++NPN     G +  H A+  GY  +++ ++    +  + +N G +
Sbjct:  391 NPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGA----TTESGLTPLHVASFMGCINIVIYLLQHEAS--ADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAE--INAQSNDK-----YSALHIAAKEGQENIVQVLLENGAENNA------VTKKGFTPLHLACKYGKQNVVQILLQNGAS-IDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIAC-----------KKNYLEIAMQLLQHGAD-VNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIEN-DADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAI 828          

HSP 3 Score: 105.916 bits (263), Expect = 2.444e-22
Identity = 125/524 (23.85%), Postives = 220/524 (41.98%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTP-LHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            G   L  A + G VDI  +LL+  + ++     K   TALH A      ++   L+   A  +++     + +   A+   DN  R +    ++   ST         G++P+ +A +    ++++ L+EN+           V  ++R P LH     +D   A+ LL+ D +      K+GFT LH+A    N+ +  LL+ N ++                                     +  H  + +H A +          G + +  LL      ++    D  TPL  A+  G  +  + LL+ +A +  +  NGLS LH AA   H +   L+++  + PVD    +  T L  A    H+ +   L++ ++NPN + + G +  H A  K    +++L+ K G ++     +G  PLH A+  G  ++   LL + E   +L  I     +G TPLH AA  N   I ++L+ R A V+ +++  Q           TPL +AS    I+I+
Sbjct:   73 GLNALHLAAKDGYVDICCELLRRGIKID--NATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTED-------GFTPLAVAMQQGHDKIVAVLLEND-----------VRGKVRLPALHIAAKKNDVNAAKLLLQHDPN-ADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVN----------------------------------YVAKHNITPLHVACK---------WGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKA-PVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLL-QHEASADLPTI-----RGETPLHLAARANQADIIRILL-RSAKVDAIAREGQ-----------TPLHVASRLGNINII 513          

HSP 4 Score: 83.5741 bits (205), Expect = 1.436e-15
Identity = 125/531 (23.54%), Postives = 212/531 (39.92%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESD----SEAKLNMLKVDNEL-----------------------RTPLHHCVDNSDTKCAEKLL---KLDT----------------------------SLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAA 3107
            G TPL  A + G V+++K LLQ N  +  +  N    +ALH A   +++E   LLL NKA  D       + +   A        +++  Y +         NPN     G++P+ IACK +  +M+  LI++ ++    +E+ L  L V + +                        TPLH     +       LL   K+D                             + I  +  + ++ LH+A       +VQ+L++NG+        G T LH A      +++ +  +    I     N   + +H AT  + +P         I +LL  N  + N    + +  +  A      +    LL++ AD+N    +G S LH AA  G+ D++ L++      +     N  TPL  A    H+ +   L+E  +N +++   G +  H AA  G+ D++    +    + + +N G  PLH+AA+ G   +  LLL      N L       K G T LH A+
Sbjct:  300 GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGL--SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKA---------NPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKN-DVTPLHVATH-YNNPS--------IVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV--ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNAL------TKDGNTALHIAS 801          

HSP 5 Score: 72.4034 bits (176), Expect = 3.909e-12
Identity = 76/305 (24.92%), Postives = 127/305 (41.64%), Query Frame = 3
Query: 2460 ATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPN--------------------------QQDIKGR---SVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKA 3287
            AT SFL    S     V++ L      ++N  + +    L  AA  G  D C  LL     +++    G + LH A+  G +DVI+ ++  ++  V+++  N  TPL+ A    H +    L+   +NP+                          + D++G+      H AA K   +   L+ +   +  + + +G  PLH AA  G  D+  LLLN   +      +N   K  +TPLH A       +C LL+ RGA ++  ++             LTPL  AS S  ++++K    + A
Sbjct:   38 ATISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLI-LYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKAD------VNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD-----------GLTPLHCASRSGHVEVIKHLLQQNA 324          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 134.806 bits (338), Expect = 3.471e-31
Identity = 158/585 (27.01%), Postives = 254/585 (43.42%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHY--SSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA-VVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS----------------FLSPEG-------SVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF 3272
            +H++ + ND+ A + +  +  N  ++      SG TPL  A   G VDI   LL    +VN     K+  T LH A       + TLLL   AK D       + +   +   +   + +I H    ++ I +   N      G S + +A +    +    L++N++  +      +V  +  T LH        K A+ LL    +    +  NGFT LH+A   N IK+V+LL+K+G+N       G T LH A  + C   +I L        +  I   G + +H A ++                 ++ EG       S  G I I  LL  +   +N    D  + L  AA  G  +  Q+LLEN A+ N     G + LH A   G  +V+ +++   +  +D +  N  TPL  A    + SI+  L++  S+PN     G+   H A  K Y +I   + + G  + + + +G  PLH AA+ G  D+ +LLL       E  +I+   K G+TPLH AA   H  + ++L+  GAN          I++ T N   TPL +A+    +D++K F
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSK----SGFTPLHIAAHYGNVDIATLLLNNKADVNYVA--KHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCAS---RSGHVEVIKHLLQQNAPILTKTKN------GLSALHMAAQGEHDEAAHLLLDNKAPVD------EVTVDYLTALHVAAHCGHVKVAKLLLDYKAN-PNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTI--RGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGA-SIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL-------EYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGAN----------ISERTRN-GYTPLHMAAHYGHLDLVKFF 746          

HSP 2 Score: 112.849 bits (281), Expect = 1.860e-24
Identity = 124/472 (26.27%), Postives = 211/472 (44.70%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSP-EGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDL 2972
            NP  +   G T +H++ + N +  +E +  +  N       +  SG TPL  A  +G ++IV  LLQ   +  A        T LH A   +  +I  +LL++ AK D    + ++ +   +     N + ++  + +    +  SN+      YS + IA K     ++  L+EN +++ A      V  +  TPLH           + LL+   S I  + KN  T LH+AT  NN  +V+LL+KNGS+      +G  ++H A             K   +I   +  HGA  ++  ++S  SP   + QG  V    L      ++    +  TPL  AA  G     QILLE+ A+++ R  NG + LH AA  GH D++   +      +++  N   TPL  A    H+ II+ L+  ++NPN     G +  H A+  GY  +++ ++    +  + +N G +
Sbjct:  391 NPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGA----TTESGLTPLHVASFMGCINIVIYLLQHEAS--ADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAE--INAQSNDK-----YSALHIAAKEGQENIVQVLLENGAENNA------VTKKGFTPLHLACKYGKQNVVQILLQNGAS-IDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIAC-----------KKNYLEIAMQLLQHGAD-VNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIEN-DADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAI 828          

HSP 3 Score: 105.916 bits (263), Expect = 2.444e-22
Identity = 125/524 (23.85%), Postives = 220/524 (41.98%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTP-LHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            G   L  A + G VDI  +LL+  + ++     K   TALH A      ++   L+   A  +++     + +   A+   DN  R +    ++   ST         G++P+ +A +    ++++ L+EN+           V  ++R P LH     +D   A+ LL+ D +      K+GFT LH+A    N+ +  LL+ N ++                                     +  H  + +H A +          G + +  LL      ++    D  TPL  A+  G  +  + LL+ +A +  +  NGLS LH AA   H +   L+++  + PVD    +  T L  A    H+ +   L++ ++NPN + + G +  H A  K    +++L+ K G ++     +G  PLH A+  G  ++   LL + E   +L  I     +G TPLH AA  N   I ++L+ R A V+ +++  Q           TPL +AS    I+I+
Sbjct:   73 GLNALHLAAKDGYVDICCELLRRGIKID--NATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTED-------GFTPLAVAMQQGHDKIVAVLLEND-----------VRGKVRLPALHIAAKKNDVNAAKLLLQHDPN-ADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVN----------------------------------YVAKHNITPLHVACK---------WGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKA-PVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLL-QHEASADLPTI-----RGETPLHLAARANQADIIRILL-RSAKVDAIAREGQ-----------TPLHVASRLGNINII 513          

HSP 4 Score: 83.5741 bits (205), Expect = 1.436e-15
Identity = 125/531 (23.54%), Postives = 212/531 (39.92%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESD----SEAKLNMLKVDNEL-----------------------RTPLHHCVDNSDTKCAEKLL---KLDT----------------------------SLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAA 3107
            G TPL  A + G V+++K LLQ N  +  +  N    +ALH A   +++E   LLL NKA  D       + +   A        +++  Y +         NPN     G++P+ IACK +  +M+  LI++ ++    +E+ L  L V + +                        TPLH     +       LL   K+D                             + I  +  + ++ LH+A       +VQ+L++NG+        G T LH A      +++ +  +    I     N   + +H AT  + +P         I +LL  N  + N    + +  +  A      +    LL++ AD+N    +G S LH AA  G+ D++ L++      +     N  TPL  A    H+ +   L+E  +N +++   G +  H AA  G+ D++    +    + + +N G  PLH+AA+ G   +  LLL      N L       K G T LH A+
Sbjct:  300 GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGL--SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKA---------NPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKN-DVTPLHVATH-YNNPS--------IVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV--ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNAL------TKDGNTALHIAS 801          

HSP 5 Score: 72.4034 bits (176), Expect = 3.909e-12
Identity = 76/305 (24.92%), Postives = 127/305 (41.64%), Query Frame = 3
Query: 2460 ATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPN--------------------------QQDIKGR---SVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKA 3287
            AT SFL    S     V++ L      ++N  + +    L  AA  G  D C  LL     +++    G + LH A+  G +DVI+ ++  ++  V+++  N  TPL+ A    H +    L+   +NP+                          + D++G+      H AA K   +   L+ +   +  + + +G  PLH AA  G  D+  LLLN   +      +N   K  +TPLH A       +C LL+ RGA ++  ++             LTPL  AS S  ++++K    + A
Sbjct:   38 ATISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLI-LYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKAD------VNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD-----------GLTPLHCASRSGHVEVIKHLLQQNA 324          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 150.599 bits (379), Expect = 7.712e-36
Identity = 163/646 (25.23%), Postives = 288/646 (44.58%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ-----DITKETANLN------LTPLDLASDSLTIDILKDFRGKKA 3287
            E +   +  L + G ++DA    G T  H + L    +++   +  G N   Q   G T ++++ + N L  +    L  NN S  +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F   ++        +P+ +A K  +  M+  L++  S  EAK        +  TPLH    +   +  E LL     ++  K KNG + LH+AT  +++  VQLL+++ +   D  ND  T+LH A  C    +  +      +      N G + +H A +         +  + + +LL  +  ++  V     TP+  AA +G  +  + L  + A  N  +  G + LH AA  G  DV+  ++   +  VDI+  +  T L  A  L  + I+  L+++ + PN     G +  H +A +G+ +I  L+ + G SL+     G  PLH AA+ G+ +V  LLL K    +         K G+TPLH AAH ++ ++  LL+ +GA+           ++I +K NQ      + +  A  N      ++PL LA+   ++D++     K+A
Sbjct:   85 EGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRF--LLENNSS--QSIATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARND-------ITPLHVASKRGNGNMVKLLLDRGSKIEAKTK------DGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALN-GFTPLHIACK---------KNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAK-VDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAA------GKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQA 689          

HSP 2 Score: 92.8189 bits (229), Expect = 2.722e-18
Identity = 117/508 (23.03%), Postives = 216/508 (42.52%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLF-----YAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIR 2927
            D+ +C+  L ++   +D   +   T  H +       +  V +    NP  +   G T +H++ + N +  +E   L   + + L++ +E SG TP+  A  +G  +IVK+L     + N    N    TALH A      ++   LL+N AK DIK   D++ +   +   K   ++ +    +    +T S       GY+P+ ++ +    ++ + L+E  S   A         +  TPLH        + A  LL+   +      K+G T LH+A   +N ++  LL+  G++      +G+T LH A        I             +   G S +H A Q     EGSV     +  LL   + NVN  + +  TPL  AA        ++LL + A+++ +  +G + LH A   G+  + + ++   + P + +   +    F     ++    H  II+ L++  ++PN+  + G +    A   GY  ++D +R
Sbjct:  346 DHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVME---LLLKHGASLQAVTE-SGLTPIHVAAFMGHENIVKQLTHHGASPNT--TNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTS-------GYTPLHLSAREGHQEIAALLLEQGSSLSA------ATKKGFTPLHVAAKYGQLEVANLLLQ-KKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKK-NQLEIGTTLLEYGAECNTVTRQGISPLHLAAQ-----EGSVD----LVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKP-NAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLR 822          

HSP 3 Score: 75.8702 bits (185), Expect = 3.789e-13
Identity = 74/299 (24.75%), Postives = 127/299 (42.47%), Query Frame = 3
Query: 2439 GASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIV-NTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRS-----------------------------NPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDS 3245
            G +A+H A++         +G + +   L     NV+       T L  A+  G T+  + L+ N A++N +  NG + L+ AA   H DV+  ++ N  S  +  ED    TPL  A+   H  ++  L+E  +                             N + +   G +  H AA  G  ++  L+   G ++     N   PLH A++ G  ++ +LLL++  +      I    K G+TPLH  A + H ++ ++L+ RGA   ILSK+            L+PL +A+  
Sbjct:   75 GLNALHLASK---------EGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDG--FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSK------IEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA--PILSKTKN---------GLSPLHMATQG 345          

HSP 4 Score: 67.0106 bits (162), Expect = 2.338e-10
Identity = 66/249 (26.51%), Postives = 108/249 (43.37%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            DS    L AA  G  +     L+   D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + D++  + +   S ++   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+ ++++           ++TPL +AS
Sbjct:   41 DSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGAN-VDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARN-----------DITPLHVAS 277          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 150.214 bits (378), Expect = 9.510e-36
Identity = 163/646 (25.23%), Postives = 288/646 (44.58%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ-----DITKETANLN------LTPLDLASDSLTIDILKDFRGKKA 3287
            E +   +  L + G ++DA    G T  H + L    +++   +  G N   Q   G T ++++ + N L  +    L  NN S  +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F   ++        +P+ +A K  +  M+  L++  S  EAK        +  TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++ +   D  ND  T+LH A  C    +  +      +      N G + +H A +         +  + + +LL  +  ++  V     TP+  AA +G  +  + L  + A  N  +  G + LH AA  G  DV+  ++   +  VDI+  +  T L  A  L  + I+  L+++ + PN     G +  H +A +G+ +I  L+ + G SL+     G  PLH AA+ G+ +V  LLL K    +         K G+TPLH AAH ++ ++  LL+ +GA+           ++I +K NQ      + +  A  N      ++PL LA+   ++D++     K+A
Sbjct:   85 EGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRF--LLENNSS--QSIATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARND-------ITPLHVASKRGNGNMVKLLLDRGSKIEAKTK------DGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALN-GFTPLHIACK---------KNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAK-VDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAA------GKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQA 689          

HSP 2 Score: 109.768 bits (273), Expect = 2.142e-23
Identity = 126/541 (23.29%), Postives = 223/541 (41.22%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEE 3041
            D+ +C+  L ++   +D   +   T  H +       +  V +    NP  +   G T +H++ + N +  +E   L   + + L++ +E SG TP+  A  +G  +IVK+L     + N    N    TALH A      ++   LL+N AK DIK   D++ +   +   K   ++ +    +    +T S       GY+P+ ++ +    ++ + L+E  S   A         +  TPLH        + A  LL+   +      K+G T LH+A   +N ++  LL+  G++      +G+T LH A                    K     G + + Y  +                          N V     +PL  AA  G  D   +LL   A++N  + NGL+ LH AA      V ++++N  +  +D +  +  TPL  A    +M + +FL+E ++ PN +   G +  H AA +G+  I++++ + G S      NG+  L  A   G   V + L    +E
Sbjct:  346 DHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVME---LLLKHGASLQAVTE-SGLTPIHVAAFMGHENIVKQLTHHGASPNT--TNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTS-------GYTPLHLSAREGHQEIAALLLEQGSSLSA------ATKKGFTPLHVAAKYGQLEVANLLLQ-KKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAA------------------KKNQLEIGTTLLEYGAE-------------------------CNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGA-EIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTDE 822          

HSP 3 Score: 106.686 bits (265), Expect = 1.585e-22
Identity = 131/501 (26.15%), Postives = 206/501 (41.12%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSD--IKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSK 3176
            G TPL    + G   +V+ LL     + ++  N    + LH A   D+     LLL++ A  D    DY        VA +          HY  +++      NPN     G++P+ IACK +  +++  L+++ +  +A      V     TP+H           ++L     S     +  G T LH+A  A  I +V+ L++NG+    +  D  T+LH A        I         +       G + +H + +         +G   I  LL     +++       TPL  AA  G  +   +LL+  A  +    +GL+ LH AA   HYD   V  L+++  + P     N   TPL  A     + I   L+E  +  N    +G S  H AA +G  D++ L+     ++ + N NG  PLH AA+  K  V E+LLN   E      I+   K G TPLH A H  + K+   L+   A  N  +K
Sbjct:  302 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGL--SPLHMATQGDHLNCVQLLLQHNAPVDDVTNDY---LTALHVAAH--------CGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQA------VTESGLTPIHVAAFMGHENIVKQLTHHGAS-PNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRL-GKLEIVQQLLQKGALPNAATTSGYTPLHLSAR---------EGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAA---HYDNQRVALLLLDQGASPHSPAKNGY-TPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAE------IDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTK 762          

HSP 4 Score: 75.8702 bits (185), Expect = 4.482e-13
Identity = 74/299 (24.75%), Postives = 127/299 (42.47%), Query Frame = 3
Query: 2439 GASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIV-NTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRS-----------------------------NPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDS 3245
            G +A+H A++         +G + +   L     NV+       T L  A+  G T+  + L+ N A++N +  NG + L+ AA   H DV+  ++ N  S  +  ED    TPL  A+   H  ++  L+E  +                             N + +   G +  H AA  G  ++  L+   G ++     N   PLH A++ G  ++ +LLL++  +      I    K G+TPLH  A + H ++ ++L+ RGA   ILSK+            L+PL +A+  
Sbjct:   75 GLNALHLASK---------EGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDG--FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSK------IEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA--PILSKTKN---------GLSPLHMATQG 345          

HSP 5 Score: 66.6254 bits (161), Expect = 2.958e-10
Identity = 66/249 (26.51%), Postives = 108/249 (43.37%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            DS    L AA  G  +     L+   D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + D++  + +   S ++   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+ ++++           ++TPL +AS
Sbjct:   41 DSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGAN-VDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARN-----------DITPLHVAS 277          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 150.214 bits (378), Expect = 9.510e-36
Identity = 163/646 (25.23%), Postives = 288/646 (44.58%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ-----DITKETANLN------LTPLDLASDSLTIDILKDFRGKKA 3287
            E +   +  L + G ++DA    G T  H + L    +++   +  G N   Q   G T ++++ + N L  +    L  NN S  +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F   ++        +P+ +A K  +  M+  L++  S  EAK        +  TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++ +   D  ND  T+LH A  C    +  +      +      N G + +H A +         +  + + +LL  +  ++  V     TP+  AA +G  +  + L  + A  N  +  G + LH AA  G  DV+  ++   +  VDI+  +  T L  A  L  + I+  L+++ + PN     G +  H +A +G+ +I  L+ + G SL+     G  PLH AA+ G+ +V  LLL K    +         K G+TPLH AAH ++ ++  LL+ +GA+           ++I +K NQ      + +  A  N      ++PL LA+   ++D++     K+A
Sbjct:   85 EGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRF--LLENNSS--QSIATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARND-------ITPLHVASKRGNGNMVKLLLDRGSKIEAKTK------DGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALN-GFTPLHIACK---------KNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAK-VDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAA------GKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQA 689          

HSP 2 Score: 109.768 bits (273), Expect = 2.142e-23
Identity = 126/541 (23.29%), Postives = 223/541 (41.22%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEE 3041
            D+ +C+  L ++   +D   +   T  H +       +  V +    NP  +   G T +H++ + N +  +E   L   + + L++ +E SG TP+  A  +G  +IVK+L     + N    N    TALH A      ++   LL+N AK DIK   D++ +   +   K   ++ +    +    +T S       GY+P+ ++ +    ++ + L+E  S   A         +  TPLH        + A  LL+   +      K+G T LH+A   +N ++  LL+  G++      +G+T LH A                    K     G + + Y  +                          N V     +PL  AA  G  D   +LL   A++N  + NGL+ LH AA      V ++++N  +  +D +  +  TPL  A    +M + +FL+E ++ PN +   G +  H AA +G+  I++++ + G S      NG+  L  A   G   V + L    +E
Sbjct:  346 DHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVME---LLLKHGASLQAVTE-SGLTPIHVAAFMGHENIVKQLTHHGASPNT--TNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTS-------GYTPLHLSAREGHQEIAALLLEQGSSLSA------ATKKGFTPLHVAAKYGQLEVANLLLQ-KKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAA------------------KKNQLEIGTTLLEYGAE-------------------------CNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGA-EIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTDE 822          

HSP 3 Score: 106.686 bits (265), Expect = 1.585e-22
Identity = 131/501 (26.15%), Postives = 206/501 (41.12%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSD--IKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSK 3176
            G TPL    + G   +V+ LL     + ++  N    + LH A   D+     LLL++ A  D    DY        VA +          HY  +++      NPN     G++P+ IACK +  +++  L+++ +  +A      V     TP+H           ++L     S     +  G T LH+A  A  I +V+ L++NG+    +  D  T+LH A        I         +       G + +H + +         +G   I  LL     +++       TPL  AA  G  +   +LL+  A  +    +GL+ LH AA   HYD   V  L+++  + P     N   TPL  A     + I   L+E  +  N    +G S  H AA +G  D++ L+     ++ + N NG  PLH AA+  K  V E+LLN   E      I+   K G TPLH A H  + K+   L+   A  N  +K
Sbjct:  302 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGL--SPLHMATQGDHLNCVQLLLQHNAPVDDVTNDY---LTALHVAAH--------CGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQA------VTESGLTPIHVAAFMGHENIVKQLTHHGAS-PNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRL-GKLEIVQQLLQKGALPNAATTSGYTPLHLSAR---------EGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAA---HYDNQRVALLLLDQGASPHSPAKNGY-TPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAE------IDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTK 762          

HSP 4 Score: 75.8702 bits (185), Expect = 4.482e-13
Identity = 74/299 (24.75%), Postives = 127/299 (42.47%), Query Frame = 3
Query: 2439 GASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIV-NTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRS-----------------------------NPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDS 3245
            G +A+H A++         +G + +   L     NV+       T L  A+  G T+  + L+ N A++N +  NG + L+ AA   H DV+  ++ N  S  +  ED    TPL  A+   H  ++  L+E  +                             N + +   G +  H AA  G  ++  L+   G ++     N   PLH A++ G  ++ +LLL++  +      I    K G+TPLH  A + H ++ ++L+ RGA   ILSK+            L+PL +A+  
Sbjct:   75 GLNALHLASK---------EGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDG--FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSK------IEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA--PILSKTKN---------GLSPLHMATQG 345          

HSP 5 Score: 66.6254 bits (161), Expect = 2.958e-10
Identity = 66/249 (26.51%), Postives = 108/249 (43.37%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            DS    L AA  G  +     L+   D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + D++  + +   S ++   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+ ++++           ++TPL +AS
Sbjct:   41 DSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGAN-VDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARN-----------DITPLHVAS 277          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 147.902 bits (372), Expect = 3.119e-35
Identity = 165/637 (25.90%), Postives = 275/637 (43.17%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ-----DITKETANLN------LTPLDLASDSLTIDILKDFRGKKA 3287
            L  NG DL+     G T  H + L     ++A  +  G N   Q  +G + ++++ + N L  ++ +  +  N S+   P+E  G TPL  A+Q G  ++V  L      +N     K +  ALH A   D+     +LL+N    D+      + +   A Y   +  +++ +  ++  F TP N      G +P+ IA +  +  M+  L++  +  +AK       +EL TPLH    N   +  E LL     L  K  KNG + +H+A   +++  V+ L++  +   D   D  T LH A  C    ++ +             N G + +H A +         +  +    LL  +  ++  V     TPL  AA +G  +  + LL+  A  N  +    + LH AA  GH +V   ++   +  VD +  +  TPL  A  + H  ++  L+E ++NP+     G +  H AA +G+     ++       T     G  PLH A + GK DV ELLL +          N   K G+TPLH A H+N+  + KLL+S+G +           ++I +K NQ      + +  AN N      +TPL LAS     D++     K+A
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSL---PTE-DGFTPLAVALQQGHENVVALL------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNF-TPKN------GITPLHIASRRGNVIMVRLLLDRGAQIDAK-----TKDEL-TPLHCAARNGHVRVVEILLDQGAPLQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN-GFTPLHIACK---------KNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQ-VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANP------NAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQA 600          

HSP 2 Score: 123.635 bits (309), Expect = 1.019e-27
Identity = 123/486 (25.31%), Postives = 210/486 (43.21%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEE 3041
            G T +H++ + N + +++ +  +S   + LE+ +E SG TPL  A  +G ++IVK LLQ   + NA  +N    T LH A    + E+   LL+N A+ D K   D++ +   A       ++++  + ++   +T +       G++P+ IA +    Q    L++  +         K+  +  TPLH           E LL+   +      KNG T LH+A   NN+ +V+LLV  G +      +G+T+LH A             +   ++   +  +GA+A                                N       TPL  A+  G  D   +L+   A++N  + NGL+ LH  A  GH  + D++V   +  V        TPL  A    ++ ++ FL++Q+++ N +   G +  H AA +G+ DI+ L+ K G        NG  PL  A   G   V ++L    EE
Sbjct:  312 GFTPLHIACKKNHMRSMDLLLKHS---ASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNA--SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTA-------GHTPLHIAAREGHAQTTRILLDENAQQT------KMTKKGFTPLHVACKYGKVDVVELLLERGAN-PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAA-----------KQNQLEVASSLLQYGANA--------------------------------NSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEE 733          

HSP 3 Score: 114.005 bits (284), Expect = 9.411e-25
Identity = 126/527 (23.91%), Postives = 215/527 (40.80%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLR----IITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            G +P+  A Q   +D V++LLQ N  ++    +    T LH A    +  +  +LL   AK++ +     + +       K N +R    ++ H +S E  +          G +P+ +A       ++  L++  +   A       + ++ TPLH        + A+ LL+ + + +  K K+  T LH A    + +LV+LL+++ +N       GHT LH A                           A   H  T   L  E + Q                  +     TPL  A   G  D  ++LLE  A+ N    NGL+ LH A    + DV+ L+V+    P     N   T L  A     + +   L++  +N N + ++G +  H A+ +G  D++ L+     ++ L N NG  PLH  A+ G   + ++L+ +         +   ++ G TPLH A H  + K+ K L+ + A+VN  SK+          L  TPL  A+     DI+
Sbjct:  246 GLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHL--TPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIAC---KKNHMRSMDLLLKHSASLEAVTES--------GLTPLHVAAFMGHLNIVKSLLQRGASPNAS------NVKVETPLHMAARAGHCEVAQFLLQ-NNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIA---------------------------AREGHAQTTRILLDENAQQ----------------TKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGY-TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGAS------VYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN--SKT---------RLGYTPLHQAAQQGHTDIV 691          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 147.902 bits (372), Expect = 5.048e-35
Identity = 165/637 (25.90%), Postives = 275/637 (43.17%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ-----DITKETANLN------LTPLDLASDSLTIDILKDFRGKKA 3287
            L  NG DL+     G T  H + L     ++A  +  G N   Q  +G + ++++ + N L  ++ +  +  N S+   P+E  G TPL  A+Q G  ++V  L      +N     K +  ALH A   D+     +LL+N    D+      + +   A Y   +  +++ +  ++  F TP N      G +P+ IA +  +  M+  L++  +  +AK       +EL TPLH    N   +  E LL     L  K  KNG + +H+A   +++  V+ L++  +   D   D  T LH A  C    ++ +             N G + +H A +         +  +    LL  +  ++  V     TPL  AA +G  +  + LL+  A  N  +    + LH AA  GH +V   ++   +  VD +  +  TPL  A  + H  ++  L+E ++NP+     G +  H AA +G+     ++       T     G  PLH A + GK DV ELLL +    N         K G+TPLH A H+N+  + KLL+S+G +           ++I +K NQ      + +  AN N      +TPL LAS     D++     K+A
Sbjct:   67 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSL---PTE-DGFTPLAVALQQGHENVVALL------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNF-TPKN------GITPLHIASRRGNVIMVRLLLDRGAQIDAK-----TKDEL-TPLHCAARNGHVRVVEILLDQGAPLQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN-GFTPLHIACK---------KNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQ-VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAA------GKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQA 662          

HSP 2 Score: 122.865 bits (307), Expect = 2.073e-27
Identity = 123/486 (25.31%), Postives = 210/486 (43.21%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEE 3041
            G T +H++ + N +    +++L   + + LE+ +E SG TPL  A  +G ++IVK LLQ   + NA  +N    T LH A    + E+   LL+N A+ D K   D++ +   A       ++++  + ++   +T +       G++P+ IA +    Q    L++  +         K+  +  TPLH           E LL+   +      KNG T LH+A   NN+ +V+LLV  G +      +G+T+LH A             +   ++   +  +GA+A   + Q                                  TPL  A+  G  D   +L+   A++N  + NGL+ LH  A  GH  + D++V   +  V        TPL  A    ++ ++ FL++Q+++ N +   G +  H AA +G+ DI+ L+ K G        NG  PL  A   G   V ++L    EE
Sbjct:  374 GFTPLHIACKKNHM---RSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNA--SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTA-------GHTPLHIAAREGHAQTTRILLDENAQQT------KMTKKGFTPLHVACKYGKVDVVELLLERGAN-PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAA-----------KQNQLEVASSLLQYGANANSESLQGI--------------------------------TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEE 795          

HSP 3 Score: 114.775 bits (286), Expect = 6.280e-25
Identity = 123/497 (24.75%), Postives = 208/497 (41.85%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQ 3185
            G   L  A + G V +V +LL   +++  +   K   TALH A     E++   L+   A  + +  K  S +   A+      ++ +  + +++  S P+ +     G++P+ +A +     +++ LI   +  + +L            LH    N DT+ A  LL+ D +      K GFT LH+A    N+ + QLL+  G+N      +G T LH A                                           S +G +++ +LL +    ++    D  TPL  AA  G     +ILL+  A L  +  NGLS +H AA   H D +  ++   +   DI  ++L TPL  A    H  ++  L+++ +  N + + G +  H A  K +   +DL+ K   SL     +G  PLH AA  G  ++ + LL +          N  N K  TPLH AA   H ++ + L+   A V+  +K +Q
Sbjct:   48 GLNGLHLASKEGHVKMVLELLHNGIDL--ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQ--SLPTED-----GFTPLAVALQQGHENVVALLINYGTKGKVRL----------PALHIAARNDDTRTAAVLLQNDPN-PDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIA-------------------------------------------SRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHL-TPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP------NASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQ 474          

HSP 4 Score: 114.005 bits (284), Expect = 1.125e-24
Identity = 126/527 (23.91%), Postives = 215/527 (40.80%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLR----IITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            G +P+  A Q   +D V++LLQ N  ++    +    T LH A    +  +  +LL   AK++ +     + +       K N +R    ++ H +S E  +          G +P+ +A       ++  L++  +   A       + ++ TPLH        + A+ LL+ + + +  K K+  T LH A    + +LV+LL+++ +N       GHT LH A                           A   H  T   L  E + Q  +                     TPL  A   G  D  ++LLE  A+ N    NGL+ LH A    + DV+ L+V+    P     N   T L  A     + +   L++  +N N + ++G +  H A+ +G  D++ L+     ++ L N NG  PLH  A+ G   + ++L+ +         +   ++ G TPLH A H  + K+ K L+ + A+VN  SK+          L  TPL  A+     DI+
Sbjct:  308 GLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHL--TPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIAC---KKNHMRSMDLLLKHSASLEAVTES--------GLTPLHVAAFMGHLNIVKSLLQRGASPNAS------NVKVETPLHMAARAGHCEVAQFLLQ-NNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIA---------------------------AREGHAQTTRILLDENAQQTKMT----------------KKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGY-TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGAS------VYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN--SKT---------RLGYTPLHQAAQQGHTDIV 753          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 147.517 bits (371), Expect = 1.006e-34
Identity = 152/618 (24.60%), Postives = 274/618 (44.34%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELR---TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L + G D+DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F+  ++        +P+ +A K  +  M+  L++  S         K+D + R   TPLH    +   +    LL     ++  K KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +      +      N G + +H A +         +  + + +LL  +  ++  V     TP+  AA +G  +    L  + A  N  +  G + LH AA  G  +V+  ++   +  V+ +  +  TPL  +  L    I+  L++Q + P+     G +  H ++ +G+ D+  ++ + G S  +    G  PLH AA+ GK +V +LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVKFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARND-------ITPLHVASKRGNANMVKLLLDRGS---------KIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACK---------KNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 120.939 bits (302), Expect = 1.273e-26
Identity = 127/526 (24.14%), Postives = 216/526 (41.06%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF 3272
            G   L  A + G V+IV +L+Q   +V+A  + K   TALH A      E+  +L+ N A  + +     + +   A+      ++ +    +S+  +T         G++P+ +A +    Q++S L+EN++  + +L  L          H      DTK A  LL+ D +    + K+GFT LH+A    NI +  LL+  G+       +  T LH A                                           S +G   + KLL +    ++    D  TPL   A  G      +LL+  A +  +  NGLS LH A    H + + L++   ++PVD   N+  T L  A    H  +   L+++++NPN + + G +  H A  K    +++L+ K G S+     +G  P+H AA  G  ++   L +     N        N +G T LH AA     ++ + L+  GA V   +K +Q           TPL +++     DI++  
Sbjct:   57 GLNALHLASKEGHVEIVSELIQRGADVDA--STKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATED-------GFTPLAVALQQGHDQVVSLLLENDTKGKVRLPAL----------HIAARKDDTKAAALLLQNDHN-ADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVA-------------------------------------------SKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ-HNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTT------NVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQ-----------TPLHISARLGKADIVQQL 501          

HSP 3 Score: 100.908 bits (250), Expect = 1.635e-20
Identity = 125/524 (23.85%), Postives = 214/524 (40.84%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSD--IKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNK-----------------MEECNELELI----------NEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            G TPL    + G   +V  LL     + ++  N    + LH A   D+     LLL++    D    DY        VA +          HY  +++      NPN     G++P+ IACK +  +++  L+++ +  +A      V     TP+H            +L     S     +  G T LH+A  A   ++V+ L++NG+  + +  D  T LH +      D++    K          + G + +H +++         +G   +  +L  +  +   V     TPL  AA  G  +  ++LL+ +A  +    +GL+ LH AA   HYD   V  L+++  + P     N   TPL  A     M I   L+E  ++ N    +G +  H AA +G+ D++ L+     ++ + N +G  PLH AA+  +  V E+L N+                       ++++          N   K G TPLH+AA   H  I  +L+  GA+ N
Sbjct:  284 GLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGL--SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTAL---HVAAH--------CGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQA------VTESGLTPIHVAAFMGHVNIVSQLNHHGAS-PNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTS-GYTPLHLSSR---------EGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAA---HYDNQKVALLLLDKGASPHGAAKNGY-TPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPN 773          

HSP 4 Score: 98.5969 bits (244), Expect = 6.920e-20
Identity = 125/535 (23.36%), Postives = 221/535 (41.31%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            D+ +C+  L ++   +D   +   T  H +       +  V L    NP  +   G T +H++ + N L  +E   L   + + +++ +E SG TP+  A  +G V+IV +L     + N    N    TALH A      E+   LL+N A+ + K   D++ +   A   K + ++ +    +    +T S       GY+P+ ++ +     + S L+E+ +      +   V  +  TPLH        +  + LL+ + S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A             K   DI   +  +GA A                                N +      P+  AA  G  D   +LL  SA++N  + +GL+ LH AA      V +++ N  ++ +D       TPL  A    ++ ++ FL++  S  N +   G +  H AA +G+  I++++ + G S      NG+  L  A   G   V + L
Sbjct:  328 DHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLNHHGASPNT--TNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTS-------GYTPLHLSSREGHDDVASVLLEHGA------SFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAA-----------KKNQMDIATTLLEYGADA--------------------------------NAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAV-IDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 73.9442 bits (180), Expect = 2.598e-12
Identity = 72/266 (27.07%), Postives = 114/266 (42.86%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     L+N  D+N  + NGL+ LH A+  GH +++  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGA-DVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGSK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 147.517 bits (371), Expect = 1.069e-34
Identity = 154/607 (25.37%), Postives = 269/607 (44.32%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF--LRIITHYSSSEIFSTPSNNPNNPI------GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            L E G  +D+    G T  H + L    +++ + +  G N   Q   G T ++++ + N +  ++ +     N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++    K +++R  E     F  L I  HY +  + +T   N    +      G +P+ +A K  +  M+  L++     +AK        +  TPLH    +   +  E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  TSLH A  C    +  L      +      N G + +H A +         +  I + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   ++ VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG + +L    G  PLH AA+ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+  +           TA    TPL +AS
Sbjct:   83 LMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGAN----QSTATEDGFTPLAVALQQGHNQVVAILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQS---KMMVNRTTE---SGFTPLHIAAHYGNVNV-ATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTR------DGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAA------GKNGLTPLHVAAHYDNQKVALLLLDKGASPQV-----------TAKNGYTPLHIAS 637          

HSP 2 Score: 98.9821 bits (245), Expect = 6.269e-20
Identity = 130/524 (24.81%), Postives = 214/524 (40.84%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKD-NFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL------LNKMEECNELELI---------------------NEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNI 3167
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D          D   +Y    +      HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+   S     +  G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +         +G + +  +L       +       TPL  AA  G  D  ++LL+  A  +    NGL+ LH AA   HYD   V  L+++  + P  +   N  TPL  A     M I   L+   +  N    +G +  H AA +G+ D++ L+     ++ +   NG  PLH AA+  +  V E+L      L+   +     LI                     N   K G TPLH+AA   H  I  +L+  GA  N+
Sbjct:  299 GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVD----------DVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR---------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAA---HYDNQKVALLLLDKGASP-QVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNV 789          

HSP 3 Score: 90.5077 bits (223), Expect = 2.637e-17
Identity = 113/488 (23.16%), Postives = 196/488 (40.16%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            NP  +   G T +H++ + N +  +E +  Y  +   +      SG TP+  A  +G ++IV  LLQ   + +    N    TALH A      E+   LL+N A  D +  ++++ +   +   K   ++++  +      + P     N  GY+P+ I+ +     + S L+E         + L       TPLH          A KLL    +      KNG T LH+A   +N K+  LL+  G++ +    +G+T LH A             K    I   + N+GA                                  N +     TPL  AA  G  D   +LL   A+++    NGL+ LH AA      ++  I++     +D +     +PL  A    ++ +++FL+   +N N +   G +  H AA +G+  I++++ + G    +  +NG+  L  A   G   V + L
Sbjct:  390 NPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITE----SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH-----MAHPDAATTN--GYTPLHISAREGQVDVASVLLEA-----GAAHSLATKKGF-TPLHVAAKYGSLDVA-KLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIA-----------SKKNQMQIATTLLNYGAE--------------------------------TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV-IVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTL 813          

HSP 4 Score: 73.9442 bits (180), Expect = 2.370e-12
Identity = 66/266 (24.81%), Postives = 107/266 (40.23%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-------------------------------NKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            DS    L AA  G  D     L+   D+N  + NGL+ LH AA  GH  ++  ++   S  VD       T L  A       ++  L++Q +N N Q   G +  + AA + + D++  + + G + +    +G  PL  A + G   V  +LL                               +   +     ++N   + G TPLH AAH  +  +  LL++RGA V+            TA   +TPL +AS     +++K
Sbjct:   30 DSNASFLRAARSGNLDKVVEYLKGGIDINTSNQNGLNALHLAAKEGHIGLVQELMERGSA-VDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGANQSTATEDGFTPLAVALQQGHNQVVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-----------TARNGITPLHVASKRGNTNMVK 283          

HSP 5 Score: 57.3806 bits (137), Expect = 3.094e-7
Identity = 77/307 (25.08%), Postives = 135/307 (43.97%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
            L  NG  +DA+    +T  H +  L   +++ + L    +P    + G T +H+S R   +  + ++ L +     L +     G TPL  A + G++D+ K LLQ     +A   N    T LH A   DN+++  LLL   A   +      + +   +   K N ++I T   +   +   +N   N  G +P+ +A +     M++ L+  +++       +   N L TPLH           E L K   +L  +  K G++ L +A    NIK+V  L+ +G+N   +  +G+T LH A 
Sbjct:  483 LLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQV-DVASVLLEAGAAHSLAT---KKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGL--TPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIAS---KKNQMQIATTLLN---YGAETNILTNQ-GVTPLHLAAQEGHADMVTLLLNKQANIH-----VGTKNGL-TPLHLAAQEDRVIVGEILSKNGANLDAQT-KLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAA 769          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 147.132 bits (370), Expect = 1.344e-34
Identity = 154/607 (25.37%), Postives = 269/607 (44.32%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF--LRIITHYSSSEIFSTPSNNPNNPI------GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            L E G  +D+    G T  H + L    +++ + +  G N   Q   G T ++++ + N +  ++ +     N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++    K +++R  E     F  L I  HY +  + +T   N    +      G +P+ +A K  +  M+  L++     +AK        +  TPLH    +   +  E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  TSLH A  C    +  L      +      N G + +H A +         +  I + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   ++ VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG + +L    G  PLH AA+ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+  +           TA    TPL +AS
Sbjct:   62 LMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGAN----QSTATEDGFTPLAVALQQGHNQVVAILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQS---KMMVNRTTE---SGFTPLHIAAHYGNVNV-ATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTR------DGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAA------GKNGLTPLHVAAHYDNQKVALLLLDKGASPQV-----------TAKNGYTPLHIAS 616          

HSP 2 Score: 98.9821 bits (245), Expect = 6.543e-20
Identity = 130/524 (24.81%), Postives = 214/524 (40.84%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKD-NFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL------LNKMEECNELELI---------------------NEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNI 3167
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D          D   +Y    +      HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+   S     +  G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +         +G + +  +L       +       TPL  AA  G  D  ++LL+  A  +    NGL+ LH AA   HYD   V  L+++  + P  +   N  TPL  A     M I   L+   +  N    +G +  H AA +G+ D++ L+     ++ +   NG  PLH AA+  +  V E+L      L+   +     LI                     N   K G TPLH+AA   H  I  +L+  GA  N+
Sbjct:  278 GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVD----------DVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR---------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAA---HYDNQKVALLLLDKGASP-QVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNV 768          

HSP 3 Score: 90.1225 bits (222), Expect = 2.943e-17
Identity = 113/488 (23.16%), Postives = 196/488 (40.16%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            NP  +   G T +H++ + N +  +E +  Y  +   +      SG TP+  A  +G ++IV  LLQ   + +    N    TALH A      E+   LL+N A  D +  ++++ +   +   K   ++++  +      + P     N  GY+P+ I+ +     + S L+E         + L       TPLH          A KLL    +      KNG T LH+A   +N K+  LL+  G++ +    +G+T LH A             K    I   + N+GA                                  N +     TPL  AA  G  D   +LL   A+++    NGL+ LH AA      ++  I++     +D +     +PL  A    ++ +++FL+   +N N +   G +  H AA +G+  I++++ + G    +  +NG+  L  A   G   V + L
Sbjct:  369 NPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITE----SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH-----MAHPDAATTN--GYTPLHISAREGQVDVASVLLEA-----GAAHSLATKKGF-TPLHVAAKYGSLDVA-KLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIA-----------SKKNQMQIATTLLNYGAE--------------------------------TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV-IVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTL 792          

HSP 4 Score: 73.9442 bits (180), Expect = 2.782e-12
Identity = 66/266 (24.81%), Postives = 107/266 (40.23%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-------------------------------NKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            DS    L AA  G  D     L+   D+N  + NGL+ LH AA  GH  ++  ++   S  VD       T L  A       ++  L++Q +N N Q   G +  + AA + + D++  + + G + +    +G  PL  A + G   V  +LL                               +   +     ++N   + G TPLH AAH  +  +  LL++RGA V+            TA   +TPL +AS     +++K
Sbjct:    9 DSNASFLRAARSGNLDKVVEYLKGGIDINTSNQNGLNALHLAAKEGHIGLVQELMERGSA-VDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGANQSTATEDGFTPLAVALQQGHNQVVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-----------TARNGITPLHVASKRGNTNMVK 262          

HSP 5 Score: 56.9954 bits (136), Expect = 3.511e-7
Identity = 77/307 (25.08%), Postives = 135/307 (43.97%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
            L  NG  +DA+    +T  H +  L   +++ + L    +P    + G T +H+S R   +  + ++ L +     L +     G TPL  A + G++D+ K LLQ     +A   N    T LH A   DN+++  LLL   A   +      + +   +   K N ++I T   +   +   +N   N  G +P+ +A +     M++ L+  +++       +   N L TPLH           E L K   +L  +  K G++ L +A    NIK+V  L+ +G+N   +  +G+T LH A 
Sbjct:  462 LLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQV-DVASVLLEAGAAHSLAT---KKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGL--TPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIAS---KKNQMQIATTLLN---YGAETNILTNQ-GVTPLHLAAQEGHADMVTLLLNKQANIH-----VGTKNGL-TPLHLAAQEDRVIVGEILSKNGANLDAQT-KLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAA 748          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 147.132 bits (370), Expect = 1.363e-34
Identity = 154/607 (25.37%), Postives = 269/607 (44.32%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF--LRIITHYSSSEIFSTPSNNPNNPI------GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            L E G  +D+    G T  H + L    +++ + +  G N   Q   G T ++++ + N +  ++ +     N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++    K +++R  E     F  L I  HY +  + +T   N    +      G +P+ +A K  +  M+  L++     +AK        +  TPLH    +   +  E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  TSLH A  C    +  L      +      N G + +H A +         +  I + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   ++ VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG + +L    G  PLH AA+ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+  +           TA    TPL +AS
Sbjct:   62 LMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGAN----QSTATEDGFTPLAVALQQGHNQVVAILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQS---KMMVNRTTE---SGFTPLHIAAHYGNVNV-ATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTR------DGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAA------GKNGLTPLHVAAHYDNQKVALLLLDKGASPQV-----------TAKNGYTPLHIAS 616          

HSP 2 Score: 98.9821 bits (245), Expect = 6.642e-20
Identity = 130/524 (24.81%), Postives = 214/524 (40.84%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKD-NFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL------LNKMEECNELELI---------------------NEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNI 3167
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D          D   +Y    +      HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+   S     +  G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +         +G + +  +L       +       TPL  AA  G  D  ++LL+  A  +    NGL+ LH AA   HYD   V  L+++  + P  +   N  TPL  A     M I   L+   +  N    +G +  H AA +G+ D++ L+     ++ +   NG  PLH AA+  +  V E+L      L+   +     LI                     N   K G TPLH+AA   H  I  +L+  GA  N+
Sbjct:  278 GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVD----------DVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR---------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAA---HYDNQKVALLLLDKGASP-QVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNV 768          

HSP 3 Score: 90.1225 bits (222), Expect = 3.065e-17
Identity = 113/488 (23.16%), Postives = 196/488 (40.16%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            NP  +   G T +H++ + N +  +E +  Y  +   +      SG TP+  A  +G ++IV  LLQ   + +    N    TALH A      E+   LL+N A  D +  ++++ +   +   K   ++++  +      + P     N  GY+P+ I+ +     + S L+E         + L       TPLH          A KLL    +      KNG T LH+A   +N K+  LL+  G++ +    +G+T LH A             K    I   + N+GA                                  N +     TPL  AA  G  D   +LL   A+++    NGL+ LH AA      ++  I++     +D +     +PL  A    ++ +++FL+   +N N +   G +  H AA +G+  I++++ + G    +  +NG+  L  A   G   V + L
Sbjct:  369 NPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITE----SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH-----MAHPDAATTN--GYTPLHISAREGQVDVASVLLEA-----GAAHSLATKKGF-TPLHVAAKYGSLDVA-KLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIA-----------SKKNQMQIATTLLNYGAE--------------------------------TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV-IVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTL 792          

HSP 4 Score: 73.9442 bits (180), Expect = 2.778e-12
Identity = 66/266 (24.81%), Postives = 107/266 (40.23%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-------------------------------NKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            DS    L AA  G  D     L+   D+N  + NGL+ LH AA  GH  ++  ++   S  VD       T L  A       ++  L++Q +N N Q   G +  + AA + + D++  + + G + +    +G  PL  A + G   V  +LL                               +   +     ++N   + G TPLH AAH  +  +  LL++RGA V+            TA   +TPL +AS     +++K
Sbjct:    9 DSNASFLRAARSGNLDKVVEYLKGGIDINTSNQNGLNALHLAAKEGHIGLVQELMERGSA-VDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGANQSTATEDGFTPLAVALQQGHNQVVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-----------TARNGITPLHVASKRGNTNMVK 262          

HSP 5 Score: 56.9954 bits (136), Expect = 3.783e-7
Identity = 77/307 (25.08%), Postives = 135/307 (43.97%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
            L  NG  +DA+    +T  H +  L   +++ + L    +P    + G T +H+S R   +  + ++ L +     L +     G TPL  A + G++D+ K LLQ     +A   N    T LH A   DN+++  LLL   A   +      + +   +   K N ++I T   +   +   +N   N  G +P+ +A +     M++ L+  +++       +   N L TPLH           E L K   +L  +  K G++ L +A    NIK+V  L+ +G+N   +  +G+T LH A 
Sbjct:  462 LLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQV-DVASVLLEAGAAHSLAT---KKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGL--TPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIAS---KKNQMQIATTLLN---YGAETNILTNQ-GVTPLHLAAQEGHADMVTLLLNKQANIH-----VGTKNGL-TPLHLAAQEDRVIVGEILSKNGANLDAQT-KLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAA 748          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 146.747 bits (369), Expect = 1.823e-34
Identity = 154/607 (25.37%), Postives = 269/607 (44.32%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF--LRIITHYSSSEIFSTPSNNPNNPI------GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            L E G  +D+    G T  H + L    +++ + +  G N   Q   G T ++++ + N +  ++ +     N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++    K +++R  E     F  L I  HY +  + +T   N    +      G +P+ +A K  +  M+  L++     +AK        +  TPLH    +   +  E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  TSLH A  C    +  L      +      N G + +H A +         +  I + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   ++ VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG + +L    G  PLH AA+ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+  +           TA    TPL +AS
Sbjct:   62 LMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGAN----QSTATEDGFTPLAVALQQGHNQVVAILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQS---KMMVNRTTE---SGFTPLHIAAHYGNVNV-ATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTR------DGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAA------GKNGLTPLHVAAHYDNQKVALLLLDKGASPQV-----------TAKNGYTPLHIAS 616          

HSP 2 Score: 98.2117 bits (243), Expect = 1.107e-19
Identity = 130/524 (24.81%), Postives = 214/524 (40.84%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKD-NFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL------LNKMEECNELELI---------------------NEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNI 3167
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D          D   +Y    +      HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+   S     +  G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +         +G + +  +L       +       TPL  AA  G  D  ++LL+  A  +    NGL+ LH AA   HYD   V  L+++  + P  +   N  TPL  A     M I   L+   +  N    +G +  H AA +G+ D++ L+     ++ +   NG  PLH AA+  +  V E+L      L+   +     LI                     N   K G TPLH+AA   H  I  +L+  GA  N+
Sbjct:  278 GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVD----------DVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR---------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAA---HYDNQKVALLLLDKGASP-QVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNV 768          

HSP 3 Score: 89.7373 bits (221), Expect = 4.307e-17
Identity = 113/488 (23.16%), Postives = 196/488 (40.16%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            NP  +   G T +H++ + N +  +E +  Y  +   +      SG TP+  A  +G ++IV  LLQ   + +    N    TALH A      E+   LL+N A  D +  ++++ +   +   K   ++++  +      + P     N  GY+P+ I+ +     + S L+E         + L       TPLH          A KLL    +      KNG T LH+A   +N K+  LL+  G++ +    +G+T LH A             K    I   + N+GA                                  N +     TPL  AA  G  D   +LL   A+++    NGL+ LH AA      ++  I++     +D +     +PL  A    ++ +++FL+   +N N +   G +  H AA +G+  I++++ + G    +  +NG+  L  A   G   V + L
Sbjct:  369 NPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITE----SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH-----MAHPDAATTN--GYTPLHISAREGQVDVASVLLEA-----GAAHSLATKKGF-TPLHVAAKYGSLDVA-KLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIA-----------SKKNQMQIATTLLNYGAE--------------------------------TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV-IVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTL 792          

HSP 4 Score: 74.3294 bits (181), Expect = 2.307e-12
Identity = 66/266 (24.81%), Postives = 107/266 (40.23%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-------------------------------NKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            DS    L AA  G  D     L+   D+N  + NGL+ LH AA  GH  ++  ++   S  VD       T L  A       ++  L++Q +N N Q   G +  + AA + + D++  + + G + +    +G  PL  A + G   V  +LL                               +   +     ++N   + G TPLH AAH  +  +  LL++RGA V+            TA   +TPL +AS     +++K
Sbjct:    9 DSNASFLRAARSGNLDKVVEYLKGGIDINTSNQNGLNALHLAAKEGHIGLVQELMERGSA-VDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHIDVVKYLLETGANQSTATEDGFTPLAVALQQGHNQVVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-----------TARNGITPLHVASKRGNTNMVK 262          

HSP 5 Score: 56.225 bits (134), Expect = 5.493e-7
Identity = 77/307 (25.08%), Postives = 135/307 (43.97%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
            L  NG  +DA+    +T  H +  L   +++ + L    +P    + G T +H+S R   +  + ++ L +     L +     G TPL  A + G++D+ K LLQ     +A   N    T LH A   DN+++  LLL   A   +      + +   +   K N ++I T   +   +   +N   N  G +P+ +A +     M++ L+  +++       +   N L TPLH           E L K   +L  +  K G++ L +A    NIK+V  L+ +G+N   +  +G+T LH A 
Sbjct:  462 LLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQV-DVASVLLEAGAAHSLAT---KKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGL--TPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIAS---KKNQMQIATTLLN---YGAETNILTNQ-GVTPLHLAAQEGHADMVTLLLNKQANIH-----VGTKNGL-TPLHLAAQEDRVIVGEILSKNGANLDAQT-KLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAA 748          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 157.918 bits (398), Expect = 4.538e-38
Identity = 157/615 (25.53%), Postives = 274/615 (44.55%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +             N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H AA +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRSAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALN-GFTPLHIACK---------KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 131.724 bits (330), Expect = 4.680e-30
Identity = 143/555 (25.77%), Postives = 229/555 (41.26%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   +     N  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   S+  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    S    K  NGFT LH+A   N I++++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH AA  GH DV   +++  +  + I      TPL  A     + +   L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+SR ANVN+ +KS            LTPL LA+    +++
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 695          

HSP 3 Score: 92.0485 bits (227), Expect = 4.953e-18
Identity = 111/480 (23.12%), Postives = 200/480 (41.67%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ +A +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +   S + Y   +                         N V       +  AA  G  D   +LL  +A++N  + +GL+ LH AA     +V +++VN  +  VD +     TPL       ++ I++FL++  +  N +   G +  H AA +G+  I++++ +   S      NG+  L  A   G   V + L
Sbjct:  383 GFTPLHIACKKNRIRVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLAAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAA------------------KKNQMDIATSLLEYGADA-------------------------NAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH-VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 4 Score: 80.1073 bits (196), Expect = 2.352e-14
Identity = 103/459 (22.44%), Postives = 179/459 (39.00%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF---------------------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
             +  L ++G  + A    G T  H +  +  +++++  +  G +P   +  GET +H++ R       E +     + + +E+ ++    TPL  + ++G  DIV++LLQ   + NA   + Y  T LH A    +E++   LL + A   I   K  + +   A+Y K                        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L+E  +D+ A      V  +    +H             LL  + + +   +K+G T LHLA   + + + ++LV  G++   Q   G+T LH   V C                           HY             G I I   L  +   VN    +  T L  AA  G T    +LL+N+A  N    NG + L  A   G+  V+D +
Sbjct:  398 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQA---EVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGY--TPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN--GYTPLHIAAKKNQMDIATSLLEYGADANA------VTRQGIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH---VGC---------------------------HY-------------GNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 68.5514 bits (166), Expect = 7.302e-11
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 157.918 bits (398), Expect = 4.965e-38
Identity = 157/615 (25.53%), Postives = 274/615 (44.55%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +             N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H AA +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRSAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALN-GFTPLHIACK---------KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 131.724 bits (330), Expect = 4.739e-30
Identity = 143/555 (25.77%), Postives = 229/555 (41.26%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   +     N  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   S+  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    S    K  NGFT LH+A   N I++++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH AA  GH DV   +++  +  + I      TPL  A     + +   L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+SR ANVN+ +KS            LTPL LA+    +++
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 695          

HSP 3 Score: 92.4337 bits (228), Expect = 4.923e-18
Identity = 111/480 (23.12%), Postives = 200/480 (41.67%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ +A +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +   S + Y   +                         N V       +  AA  G  D   +LL  +A++N  + +GL+ LH AA     +V +++VN  +  VD +     TPL       ++ I++FL++  +  N +   G +  H AA +G+  I++++ +   S      NG+  L  A   G   V + L
Sbjct:  383 GFTPLHIACKKNRIRVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLAAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAA------------------KKNQMDIATSLLEYGADA-------------------------NAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH-VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 4 Score: 80.1073 bits (196), Expect = 2.458e-14
Identity = 103/459 (22.44%), Postives = 179/459 (39.00%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF---------------------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
             +  L ++G  + A    G T  H +  +  +++++  +  G +P   +  GET +H++ R       E +     + + +E+ ++    TPL  + ++G  DIV++LLQ   + NA   + Y  T LH A    +E++   LL + A   I   K  + +   A+Y K                        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L+E  +D+ A      V  +    +H             LL  + + +   +K+G T LHLA   + + + ++LV  G++   Q   G+T LH   V C                           HY             G I I   L  +   VN    +  T L  AA  G T    +LL+N+A  N    NG + L  A   G+  V+D +
Sbjct:  398 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQA---EVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGY--TPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN--GYTPLHIAAKKNQMDIATSLLEYGADANA------VTRQGIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH---VGC---------------------------HY-------------GNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 68.5514 bits (166), Expect = 7.313e-11
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 157.918 bits (398), Expect = 4.965e-38
Identity = 157/615 (25.53%), Postives = 274/615 (44.55%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +             N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H AA +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRSAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALN-GFTPLHIACK---------KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 131.724 bits (330), Expect = 4.739e-30
Identity = 143/555 (25.77%), Postives = 229/555 (41.26%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   +     N  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   S+  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    S    K  NGFT LH+A   N I++++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH AA  GH DV   +++  +  + I      TPL  A     + +   L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+SR ANVN+ +KS            LTPL LA+    +++
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 695          

HSP 3 Score: 92.4337 bits (228), Expect = 4.923e-18
Identity = 111/480 (23.12%), Postives = 200/480 (41.67%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ +A +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +   S + Y   +                         N V       +  AA  G  D   +LL  +A++N  + +GL+ LH AA     +V +++VN  +  VD +     TPL       ++ I++FL++  +  N +   G +  H AA +G+  I++++ +   S      NG+  L  A   G   V + L
Sbjct:  383 GFTPLHIACKKNRIRVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLAAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAA------------------KKNQMDIATSLLEYGADA-------------------------NAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH-VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 4 Score: 80.1073 bits (196), Expect = 2.458e-14
Identity = 103/459 (22.44%), Postives = 179/459 (39.00%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF---------------------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
             +  L ++G  + A    G T  H +  +  +++++  +  G +P   +  GET +H++ R       E +     + + +E+ ++    TPL  + ++G  DIV++LLQ   + NA   + Y  T LH A    +E++   LL + A   I   K  + +   A+Y K                        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L+E  +D+ A      V  +    +H             LL  + + +   +K+G T LHLA   + + + ++LV  G++   Q   G+T LH   V C                           HY             G I I   L  +   VN    +  T L  AA  G T    +LL+N+A  N    NG + L  A   G+  V+D +
Sbjct:  398 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQA---EVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGY--TPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN--GYTPLHIAAKKNQMDIATSLLEYGADANA------VTRQGIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH---VGC---------------------------HY-------------GNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 68.5514 bits (166), Expect = 7.313e-11
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 157.532 bits (397), Expect = 5.675e-38
Identity = 157/615 (25.53%), Postives = 274/615 (44.55%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +             N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H AA +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRSAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALN-GFTPLHIACK---------KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 121.709 bits (304), Expect = 5.990e-27
Identity = 137/554 (24.73%), Postives = 223/554 (40.25%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELEL---------------------------INEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSK 3176
            +H++ R +D  A   +     N  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   S+  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    S    K  NGFT LH+A   N I++++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH AA  GH DV   +++  +  + I      TPL  A     + +   L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +                             +N  NK G+TPLH AA  +   + ++L+++GA+V+  +K
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTK 711          

HSP 3 Score: 92.0485 bits (227), Expect = 5.845e-18
Identity = 111/480 (23.12%), Postives = 200/480 (41.67%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ +A +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +   S + Y   +                         N V       +  AA  G  D   +LL  +A++N  + +GL+ LH AA     +V +++VN  +  VD +     TPL       ++ I++FL++  +  N +   G +  H AA +G+  I++++ +   S      NG+  L  A   G   V + L
Sbjct:  383 GFTPLHIACKKNRIRVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLAAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAA------------------KKNQMDIATSLLEYGADA-------------------------NAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH-VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 4 Score: 79.7221 bits (195), Expect = 2.868e-14
Identity = 103/459 (22.44%), Postives = 179/459 (39.00%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF---------------------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
             +  L ++G  + A    G T  H +  +  +++++  +  G +P   +  GET +H++ R       E +     + + +E+ ++    TPL  + ++G  DIV++LLQ   + NA   + Y  T LH A    +E++   LL + A   I   K  + +   A+Y K                        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L+E  +D+ A      V  +    +H             LL  + + +   +K+G T LHLA   + + + ++LV  G++   Q   G+T LH   V C                           HY             G I I   L  +   VN    +  T L  AA  G T    +LL+N+A  N    NG + L  A   G+  V+D +
Sbjct:  398 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQA---EVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGY--TPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN--GYTPLHIAAKKNQMDIATSLLEYGADANA------VTRQGIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH---VGC---------------------------HY-------------GNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 68.5514 bits (166), Expect = 8.970e-11
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 157.532 bits (397), Expect = 5.760e-38
Identity = 157/615 (25.53%), Postives = 274/615 (44.55%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++  K KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +             N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H AA +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRSAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALN-GFTPLHIACK---------KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 120.939 bits (302), Expect = 7.931e-27
Identity = 137/554 (24.73%), Postives = 223/554 (40.25%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELEL---------------------------INEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSK 3176
            +H++ R +D  A   +     N  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   S+  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    S    K  NGFT LH+A   N I++++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH AA  GH DV   +++  +  + I      TPL  A     + +   L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +                             +N  NK G+TPLH AA  +   + ++L+++GA+V+  +K
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTK 711          

HSP 3 Score: 92.0485 bits (227), Expect = 5.259e-18
Identity = 111/480 (23.12%), Postives = 200/480 (41.67%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ +A +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +   S + Y   +                         N V       +  AA  G  D   +LL  +A++N  + +GL+ LH AA     +V +++VN  +  VD +     TPL       ++ I++FL++  +  N +   G +  H AA +G+  I++++ +   S      NG+  L  A   G   V + L
Sbjct:  383 GFTPLHIACKKNRIRVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLAAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAA------------------KKNQMDIATSLLEYGADA-------------------------NAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH-VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 4 Score: 80.8777 bits (198), Expect = 1.566e-14
Identity = 103/459 (22.44%), Postives = 179/459 (39.00%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF---------------------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
             +  L ++G  + A    G T  H +  +  +++++  +  G +P   +  GET +H++ R       E +     + + +E+ ++    TPL  + ++G  DIV++LLQ   + NA   + Y  T LH A    +E++   LL + A   I   K  + +   A+Y K                        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L+E  +D+ A      V  +    +H             LL  + + +   +K+G T LHLA   + + + ++LV  G++   Q   G+T LH   V C                           HY             G I I   L  +   VN    +  T L  AA  G T    +LL+N+A  N    NG + L  A   G+  V+D +
Sbjct:  398 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQA---EVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGY--TPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN--GYTPLHIAAKKNQMDIATSLLEYGADANA------VTRQGIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH---VGC---------------------------HY-------------GNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 68.5514 bits (166), Expect = 8.457e-11
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 3.473e-37
Identity = 157/615 (25.53%), Postives = 274/615 (44.55%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+  ++        +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +             N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H AA +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   67 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND-------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRSAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALN-GFTPLHIACK---------KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 629          

HSP 2 Score: 131.724 bits (330), Expect = 3.315e-29
Identity = 143/555 (25.77%), Postives = 229/555 (41.26%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   +     N  V       SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   S+  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    S    K  NGFT LH+A   N I++++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH AA  GH DV   +++  +  + I      TPL  A     + +   L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+SR ANVN+ +KS            LTPL LA+    +++
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADV----ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 695          

HSP 3 Score: 92.4337 bits (228), Expect = 3.443e-17
Identity = 111/480 (23.12%), Postives = 200/480 (41.67%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ +A +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +   S + Y   +                         N V       +  AA  G  D   +LL  +A++N  + +GL+ LH AA     +V +++VN  +  VD +     TPL       ++ I++FL++  +  N +   G +  H AA +G+  I++++ +   S      NG+  L  A   G   V + L
Sbjct:  383 GFTPLHIACKKNRIRVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLAAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAA------------------KKNQMDIATSLLEYGADA-------------------------NAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH-VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 4 Score: 80.1073 bits (196), Expect = 1.719e-13
Identity = 103/459 (22.44%), Postives = 179/459 (39.00%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF---------------------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
             +  L ++G  + A    G T  H +  +  +++++  +  G +P   +  GET +H++ R       E +     + + +E+ ++    TPL  + ++G  DIV++LLQ   + NA   + Y  T LH A    +E++   LL + A   I   K  + +   A+Y K                        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L+E  +D+ A      V  +    +H             LL  + + +   +K+G T LHLA   + + + ++LV  G++   Q   G+T LH   V C                           HY             G I I   L  +   VN    +  T L  AA  G T    +LL+N+A  N    NG + L  A   G+  V+D +
Sbjct:  398 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQA---EVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGY--TPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN--GYTPLHIAAKKNQMDIATSLLEYGADANA------VTRQGIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH---VGC---------------------------HY-------------GNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 68.5514 bits (166), Expect = 5.115e-10
Identity = 71/266 (26.69%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            D+    L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 276          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 156.377 bits (394), Expect = 1.170e-36
Identity = 164/628 (26.11%), Postives = 277/628 (44.11%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF--LRIITHYS-----------SSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +DI+    K V++R  E     F  L I  HY            ++ +  T  N+       +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +      +      N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H +A +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   84 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDTNADIES---KMVVNRATE---SGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND------ITPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRAAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACK---------KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 654          

HSP 2 Score: 92.0485 bits (227), Expect = 4.600e-17
Identity = 120/535 (22.43%), Postives = 220/535 (41.12%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            D+ +C+  L ++   +D   +   T  H +       +  V L    NP  +   G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ ++ +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +   S + Y   +                         N V       +  AA  G  D   +LL  +A++N  + +GL+ LH AA     +V +++VN  +  VD +     TPL       ++ I++FL++  +  N +   G +  H AA +G+  I++++ +   S      NG+  L  A   G   V + L
Sbjct:  353 DHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLSAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAA------------------KKNQMDIATSLLEYGADA-------------------------NAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH-VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 3 Score: 65.855 bits (159), Expect = 3.455e-9
Identity = 66/268 (24.63%), Postives = 109/268 (40.67%), Query Frame = 3
Query: 2580 LWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLN----------------KMEECNELEL---------------INEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF--RGKK 3284
            L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL                 + ++     L               +N   + G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K    RG K
Sbjct:   46 LRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVKLLLDRGAK 301          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 9.095e-36
Identity = 158/615 (25.69%), Postives = 275/615 (44.72%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   ++ L +   ++DA    G T  H + L    +++ V +  G N   Q   G T ++++ + N L   E +    +N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ + +++  F+       N I  +P+ +A K  +  M+  L+    D  AK++    D    TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+++     D  ND  T+LH A  C    +  +      +      N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  V+ +  +  TPL  +  L    I+  L++Q ++PN     G +  H +A +G+ D+   +   G SL++    G  PLH AA+ GK +V  LLL K    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   84 EGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHL---EVVKFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA-----RNDI--TPLHVASKRGNANMVKLLL----DRGAKIDAKTRDG--LTPLHCGARSGHEQVVEMLLDRAAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACK---------KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAA------GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----------GYTPLHIAAKKNQMDI 646          

HSP 2 Score: 130.183 bits (326), Expect = 1.276e-28
Identity = 142/555 (25.59%), Postives = 235/555 (42.34%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            +H++ R +D  A   + L ++N + +ES    SG TPL  A   G +++   LL     V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++   ++  I S   N      G SP+ +A +      +  L+++       + +  V N+  T LH        K A+ LL    +    K  NGFT LH+A   N IK+++LL+K+G++ +     G T +H A      +++                 G +A+H A +S         G   + + L  +   V     D +TPL  +A LG  D  Q LL+  A  N    +G + LH +A  GH DV   +++  +  + I      TPL  A     + + + L+++ ++P+     G +  H AA      +  L+   G S      NG  PLH AA+  + D+   LL    + N +       ++G+  +H AA   H  +  LL+ R ANVN+ +KS            LTPL LA+    +++
Sbjct:  206 LHIAARKDDTKAAALL-LQNDNNADVES---KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI--TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLQH------NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN-PNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNV-RGETALHMAARS---------GQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV------TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKS-----------GLTPLHLAAQEDRVNV 712          

HSP 3 Score: 94.3597 bits (233), Expect = 8.786e-18
Identity = 109/460 (23.70%), Postives = 204/460 (44.35%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV----VCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIR 2927
            NP  +   G T +H++ + N +  +E   L   + + +++ +E SG TP+  A  +G V+IV +L+    + N    N    TALH A      E+   L+++ A+ + K   D++ +   A   K + ++ +    +S   +T S       GY+P+ ++ +     + + L+    D  A L++     +  TPLH        + A  LL+   S      K+G T LH+A   +N K+  LL+  G++      +G+T LH A     +  AT L++     +          G +++H A Q         +G + +  LL     NVN  +    TPL  AA     +  ++L+   A ++ +   G + LH     G+  +++ ++   S  V+ +  N  TPL  A    H  II+ L++  ++PN+  + G +    A   GY  ++D ++
Sbjct:  392 NPNAKALNGFTPLHIACKKNRIKVME---LLLKHGASIQAVTE-SGLTPIHVAAFMGHVNIVSQLMHHGASPNT--TNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-------GYTPLHLSAREGHEDVAAFLL----DHGASLSI--TTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAA-GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVT-----RQGIASVHLAAQ---------EGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 4 Score: 69.3218 bits (168), Expect = 3.644e-10
Identity = 67/252 (26.59%), Postives = 108/252 (42.86%), Query Frame = 3
Query: 2580 LWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            L AA  G  +     ++N  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + +++  +   G S +L   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++R A V+            TA  ++TPL +AS     +++K
Sbjct:   46 LRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF-----------TARNDITPLHVASKRGNANMVK 285          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8UVC1|INVS_DANRE (Inversin OS=Danio rerio OX=7955 GN=invs PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 8.504e-30
Identity = 141/534 (26.40%), Postives = 233/534 (43.63%), Query Frame = 3
Query: 1665 SVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSD---TKCAEKLLKL--DTSLIGKKDKNGFTVLHLATIANNIKLVQLLVK-NGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLE--NSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSM--PVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            S L    +  G TPL+Y V    +D  + LL+    +N  ++++  RTALH A    N     LLL   A   +KD ++ + +   + +     L ++  + +     T   N    + +S        +  + +  LI+++S      N+   D+E + PLH    N     T+    +L+     SL+  +D  G T LH A    N  +V++L    G +    DN   T LHWA +     ++ L  + +   +   D+ GA+ +HY  QS  +   +V            +    +  D + RT  +WAA  G  D  +I+L+     D+N  D  G + LH AA  GH   + L++    M  P+D+  +   TPLF A  + H  +I  LI+  +  +  DI G S  H AAL G  ++ +++ + G S  L++  G  PL  AA  G  +   LL+    + N    I   +K+G T LH + +N +    KLL+  GA  N +  + +           TPLD A
Sbjct:   31 SALRDSEDQFGRTPLMYCVLADRLDCAEVLLKAGAGINKTDHSQ--RTALHLAAQKGNVRFMKLLLSRHADWRLKDLEEMTPLHLASRHSSSKPLSLLLKHMAPGEVDTQDRNKQTALHWSAFY-----NHPEHVKLLIKHDS------NIGIPDSEGKIPLHWAAHNKHPNATRTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNEAVVEVLTSYEGCSVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGMIPSDSQGATPLHYGAQSNFADTVAV---------FLKHHSVRDEPDLEGRTAFMWAAGKGSNDVIKIMLDLKKDIDINMTDKYGGTALHAAALSGHVSTVRLLLEQGGMVDPLDVMKH---TPLFRACEMGHRDVILTLIKGGARVDLVDIDGHSALHWAALGGNAEVCEVLMENGISPNLQDQAGRTPLQCAAYAGYINCMALLIQHDADPN----IQ--DKEGRTALHWSCNNGYLDAVKLLLGCGAFPNHMEHTEE---------RYTPLDYA 524          

HSP 2 Score: 85.5001 bits (210), Expect = 3.382e-15
Identity = 125/494 (25.30%), Postives = 203/494 (41.09%), Query Frame = 3
Query: 1461 DLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLES-PSET-------SGATPLIYAVQIGAVDIVKKLLQL-NVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSL-IGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNN-LCTPLFYAVTLKHMSIIHFLIEQR--SNPNQQDIKGRSVAHCAALKGY 2903
            ++D QD   +T  HWS   +  + + + +    N  + DSEG+  +H +       A  T+        +LE+ P+E+        G TPL +AV  G   +V+ L      +V A +N    RT LH+A  + + +I  LLL+          ++KS +      P D+      HY +   F+              V +  K+   +   DL                  E RT              + +L L   + I   DK G T LH A ++ ++  V+LL++ G      D   HT L  A      D+I    K    +  +  + G SA+H+A         ++ G   + ++L  N  + N  D   RTPL  AA  G  +C  +L+++ AD N +D  G + LH + + G+ D + L++   + P  +E      TPL YA+  +H  +  FL+E    S    QDI   S+   A  KGY
Sbjct:  134 EVDTQDRNKQTALHWSAFYNHPEHVKLLIKHDSNIGIPDSEGKIPLHWAAHNKHPNATRTVRC------ILEAAPTESLLNWQDYEGRTPLHFAVADGNEAVVEVLTSYEGCSVTAYDN--LFRTPLHWAALLGHAKIVHLLLE----------RNKSGM-----IPSDSQGATPLHYGAQSNFA------------DTVAVFLKHHSVRDEPDL------------------EGRTAFMWAAGKGSNDVIKIMLDLKKDIDINMTDKYGGTALHAAALSGHVSTVRLLLEQGGMVDPLDVMKHTPLFRACEMGHRDVILTLIKGGARVDLVDID-GHSALHWA---------ALGGNAEVCEVLMENGISPNLQDQAGRTPLQCAAYAGYINCMALLIQHDADPNIQDKEGRTALHWSCNNGYLDAVKLLLGCGAFPNHMEHTEERYTPLDYALLGEHQELTQFLLEHGALSIAAIQDIAASSIQ--ALYKGY 562          

HSP 3 Score: 70.4774 bits (171), Expect = 1.171e-10
Identity = 70/303 (23.10%), Postives = 132/303 (43.56%), Query Frame = 3
Query: 1455 GCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPML-QDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA 2360
            GC + A D++ RT  HW+ LL    ++ + L    + M+  DS+G T +H   + N     +T+ ++  + SV + P +  G T  ++A   G+ D++K +L L  +++    +KY  TALH A    +     LLL+     D                                        P + + ++P+  AC+     ++  LI+      A+++++ +D    + LH      + +  E L++   S    +D+ G T L  A  A  I  + LL+++ ++   QD +G T+LHW+
Sbjct:  238 GCSVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGMIPSDSQGATPLHYGAQSN---FADTVAVFLKHHSVRDEP-DLEGRTAFMWAAGKGSNDVIKIMLDLKKDIDINMTDKYGGTALHAAALSGHVSTVRLLLEQGGMVD----------------------------------------PLDVMKHTPLFRACEMGHRDVILTLIKG----GARVDLVDIDGH--SALHWAALGGNAEVCEVLMENGIS-PNLQDQAGRTPLQCAAYAGYINCMALLIQHDADPNIQDKEGRTALHWS 489          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 132.109 bits (331), Expect = 3.181e-29
Identity = 147/586 (25.09%), Postives = 262/586 (44.71%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF--LRIITHYSSSEIFSTPSN-----NPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKS 3179
            L   G  +D+    G T  H + L    +++ V +  G N   Q   G T ++++ + N +  ++   L  N  +  +S +   G TPL  A+Q G    V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++    K +++R  E     F  L I  HY +  + +   N     +     G +P+ +A K  +  M+  L++     +AK        +  TPLH    +   +  E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  T+LH A  C    +  L      +      N G + +H A +         +  I + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   ++ VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG + +L    G  PLH AA+ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+
Sbjct:   83 LLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKY--LLENGAN--QSTATEDGFTPLAVALQQGHNQAVAILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQS---KMMVNRTTE---SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAK------TRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSA------GKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKN 628          

HSP 2 Score: 112.849 bits (281), Expect = 2.358e-23
Identity = 133/535 (24.86%), Postives = 229/535 (42.80%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSV----LESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLH---HCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKS 3179
            +H++ R +D  +   +    +N  V    + + +  SG TPL  A   G V++   LL     V+    N    T LH A    N  +  LLL    + D K     + +   A    D  + ++    +  +  T +       G SP+ +A +    + +  L+++++  +       V  +  T LH   HC     TK    LL    +    +  NGFT LH+A   N IK+++LLVK G++ +     G T +H A        I L    +     + +  G +A+H A ++         G + + + L  N   V+    + +TPL  A+ LG T+  Q+LL++ A  +    NG + LH +A  G  DV  +++   +    +      TPL  A     + +   L+++R+  +     G +  H AA      +  L+ + G S      NG  PLH AA+  +  +   LLN   E N +       K+G+TPLH A+   H  +  LL+ +GAN+++ +KS
Sbjct:  196 LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI--TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKN-------GLSPLHMAAQGDHVECVKHLLQHKAPVD------DVTLDYLTALHVAAHCGHYRVTK----LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM-GHLNIVLLLLQNGASPDVTNIRGETALHMAARA---------GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAH-SLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIV------TKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKS 694          

HSP 3 Score: 95.1301 bits (235), Expect = 4.742e-18
Identity = 123/497 (24.75%), Postives = 209/497 (42.05%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKS 3179
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D       + +   A            HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+   S     +  G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +     EG V    V+ +    +            TPL  AA  G  D  ++LL+  A  +    NGL+ LH AA   +  V  L++   + P     N   TPL  A     M I   L+   +  N    +G +  H A+ +G+ D++ L+   G ++ +   +G   LH AA+  K +V ++L     +       +   K G TPL  A H  + K+   L+ +GANVN  +K+
Sbjct:  299 GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAH---------CGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR-----EGQVDVASVLLEAGAAHSLATK----KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGY-TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD------QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKN 760          

HSP 4 Score: 92.8189 bits (229), Expect = 2.919e-17
Identity = 115/488 (23.57%), Postives = 202/488 (41.39%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            NP  +   G T +H++ + N +  +E +  Y    + +++ +E SG TP+  A  +G ++IV  LLQ   + +    N    TALH A      E+   LL+N A  D +  ++++ +   +   K   ++++  + +    +T +       GY+P+ I+ +     + S L+E  +             +  TPLH          A+ LL+   +      KNG T LH+A   +N K+  LL++ G++      +G+T LH A             K    I   + N+GA                                  N V     TPL  A+  G TD   +LL+  A+++    +GL+ LH AA     +V D I+       D       TPL  A    ++ +++FL++Q +N N +   G +  H AA +G+  I++++ + G        NG+  L  A   G   V + L
Sbjct:  390 NPNARALNGFTPLHIACKKNRIKVMELLVKYG---ASIQAITE-SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-------GYTPLHISAREGQVDVASVLLEAGAAHSL------ATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAA-----------KKNQMQIASTLLNYGAET--------------------------------NIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVAD-ILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 5 Score: 65.0846 bits (157), Expect = 6.521e-9
Identity = 64/266 (24.06%), Postives = 106/266 (39.85%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-------------------------------NKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            DS    L AA  G  D     L+   D+N  + NGL+ LH AA  GH  ++  ++   S  VD       T L  A       ++  L+++ +N N Q   G +  + AA + + D++  + + G + +    +G  PL  A + G      +LL                               +   +     ++N   + G TPLH AAH  +  +  LL++RGA V+            TA   +TPL +AS     +++K
Sbjct:   30 DSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGS-SVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-----------TARNGITPLHVASKRGNTNMVK 283          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267F3S6 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002256g1 PE=4 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 1.492e-132
Identity = 255/697 (36.59%), Postives = 396/697 (56.81%), Query Frame = 3
Query: 1236 AREILESGNVQAFEEFLLLNSEKINIQFTFDEGSTFPIILIQTFRKAESLTVDRSQGPIIEDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXX-XXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYS-NNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIV-NTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATELKVESLSE 3317
            AR +LE+GN+  F+  +  N         + +G + PIIL+Q+++K E+ T+ ++Q   I+DY  C+ +L   G  L  QDS GRT  HW IL    + LL  AL  G NP LQD EG++ +HL+IR     +L+ I     +    L+  S  SGATPLIYAVQI + + V +LL+  V VN QE+NKY+RTALHYAL+++  +IF LLL+  A+ DI DYKDKSV  R A++P   F +++  Y+ ++    PS+        +P+++AC+  +F+    LI+  SD        +VD+  +  LH+C ++ +T CAE LL     ++ KKD +G++ LHLATIA N+KL+ LL+++G+     DN+ H+S+HWAVV C+              +   D  GA  +HYA Q   + + +   P+ I ++L      V+C+D + R+PL+WA S+G    C++LL+  A     D  GL+VLHCAASRGH ++++L+  +T  + +++ D N C+PLFYAVTL     +  L+   ++ + QD KGR+ AHCAA K    +L L+ + G +L + N+ GDLP+HEA   G  +  + L       +   L++  N      +H AA+ N  ++C  ++  GA+VN+ S S Q          +T LDL S S   + ++ + G+ A EL +    E
Sbjct:   34 ARSLLETGNLHRFKYLVDDNRADFRFGHVYSDGFSLPIILVQSYKKLEA-TLGKTQEMPIDDYCQCVRWLARKGASLGHQDSAGRTLLHWCILTQTPVSLLQAALDAGANPALQDEEGQSAVHLAIRMGCAESLDVIARSEPHGRQALDVASRLSGATPLIYAVQIASYEFVHQLLEFGVQVNTQEDNKYRRTALHYALYVNRTDIFELLLRKGARPDIVDYKDKSVEARAADHPNGTFKKMVRVYARAQ--PPPSDTSKEFHPTTPLMVACQAGEFETAQSLIDAGSDPA------EVDDGGKNALHYCAESEETACAELLLAKRPEVVTKKDADGYSPLHLATIAGNVKLIHLLLQSGAEVDAVDNERHSSVHWAVV-CSQADSLKALLDHKAKVMQPDIFGAYPLHYAAQVCGTAQPTDDRPVRILEMLLGRSSRVDCLDAEKRSPLMWAGSVGAKRACELLLKKGAKPALGDKAGLTVLHCAASRGHANIVELMAKDTVDIDINVGDKNDCSPLFYAVTLNQEECVRALVRCGADIDHQDKKGRTAAHCAAAKDLIIMLKLLNELGANLWVGNSIGDLPIHEAVHMGHLETVKHL-----AADSKALLDTKNVSEQACVHIAAYKNETQMCNAVLRYGADVNLASVSEQ-------GNPVTALDLTSSSECKEFIRRYGGQYAHELGLADRPE 708          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267GYS0 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016146g2 PE=4 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.233e-127
Identity = 251/690 (36.38%), Postives = 395/690 (57.25%), Query Frame = 3
Query: 1236 AREILESGNVQAFEEFLLLNSEKINIQFTFDEGSTFPIILIQTFRKAESLTVDRSQGPIIEDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXX-XXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYS-NNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIV-NTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATEL 3296
            AR +LE+GN+  F+  +  N         + +G + PIIL+Q+++K E+ T+ ++Q   I+DY  C+ +L   G  L  QDS GRT  HW IL      L  A    G NP LQD EG++ +HL+IR     +L+ I     +    L+  S  SGATPLIYAVQI + + V +LL+  V VN QE+NKY+RTALHYAL+++  +IF LLL+  A+ DI DYKDKSV  R A++P   F +++  Y+ ++   + ++   +P   +P+++AC+  +F+    LI+  SD        +VD+  +  LH+C ++ +T CAE LL     ++ KKD +G++ LHLATIA N+KL+ LL+++G+     DN+ H+S+HWAVVC   D +         +++     GA  +HYA Q   + + +   P+ I ++L      V+C+D + R+PL+WA S+G    C++LL+  A     D  GL+VLHCAASRGH ++++L+  +T  + +++ D N C+PLFYAVTL     +  L+   ++ + QD KGR+ AHCAA K    +L L+ + G +L + N+ GDLP+HEA   G  +  + L       +   L++  N      +H AA+ N  ++C  ++  GA+VN+ S S Q          +T LDL S S   + ++ + G+ A EL
Sbjct:   34 ARSLLETGNLHRFKYLVDDNRADFRFGHVYSDGFSLPIILVQSYKKLEA-TLGKTQEMPIDDYCQCVRWLARKGASLGHQDSAGRTLLHWCILTQTPVSLLQAALDAGANPALQDEEGQSAVHLAIRMGCAESLDVIARSEPHGRQALDVASRLSGATPLIYAVQIASYEFVHQLLEFGVQVNTQEDNKYRRTALHYALYVNRTDIFELLLRKGARPDIVDYKDKSVEARAADHPNGTFKKMVRVYARAQPPPSDTSKEFHPT--TPLMVACQAGEFETAQSLIDAGSDP------AEVDDGGKNALHYCAESEETACAELLLAKRPEVVTKKDADGYSPLHLATIAGNVKLIHLLLQSGAEVDAVDNERHSSVHWAVVCSQADSLKALLDHKAKVMQPDI-FGAYPLHYAAQVCGTAQPTDDRPVRILEMLLGRSSRVDCLDAEKRSPLMWAGSVGAKRACELLLKKGAKPALGDKAGLTVLHCAASRGHANIVELMAKDTVDIDINVGDKNDCSPLFYAVTLNQEECVRALVRCGADIDHQDKKGRTAAHCAAAKDLIIMLKLLNELGANLWVGNSIGDLPIHEAVHMGHLETVKHLA-----ADSKALLDTKNVSEQACVHIAAYKNETQMCNAVLRYGADVNLASVSEQ-------GNPVTALDLTSSSECKEFIRRYGGQYAHEL 701          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210QD20 (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10301 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 2.779e-85
Identity = 210/589 (35.65%), Postives = 317/589 (53.82%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSV-LESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVA--EYPKDNFLRIITHYSS--SEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPI--VIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            DY  C+  L E G   D QD  GRT  HW++    ++ +   +  G +P ++D +G    HLSI    + A E  N    +  V      +  G  P++ A+Q   +D  ++LL L V++NA  + + KRTALHYA+ +   +++ LLLK K + D+ DY+ K+V  RV   + P+  F ++I  Y+    ++    +++     G +PVIIAC+N + + L +L++  + +         D   ++ LH+C DN +T+CAE +L  D  L+  KD+ GFT LH+A I  N  L++LL+K  ++    DN+ HT  HWA V C    +      +   +   D+H A  IHYA Q      G     I   + K L +N    + +D D R PLLWAAS G ++ C++L++  AD+N  D +GLS LHCAASRGH   I+ + N  +  VD+ D N CT LFYA+TL +      L++  SNPN QD +GR+  HCAA+KG  D + ++ K    L   +   D P+HEAA+ G  DV + LL      N+   +N  NK G T LH +A  N+  +CKLLI  GA+ N
Sbjct:   92 DYIKCIRLLIEKGTSTDDQDKAGRTPLHWAVFSKNVNFVNELIESGADPTIRDQDGMDPFHLSII---IGAKEIFNSIVRDREVEFLDHKDGKGVPPVVAAIQHRQLDFARRLLDLGVDINAT-DRRLKRTALHYAISLKRLDLYELLLKYKPEVDVADYQGKTVFHRVCGNKDPR-YFQKLIETYNGIPEDVMDQAADD-----GMTPVIIACQNGNPEQLKELLDKGASAS------DADKTGKSALHYCADNLETQCAEMILHKDGDLLNSKDEQGFTPLHMAVIGGNAPLLRLLLKKDADINCLDNEHHTVAHWATV-CGHLEVLEILLENGADVSRADSHEAFPIHYAAQMNGKENGHTDPKIGEKVLKKLVDNGVPTDVLDKDGRQPLLWAASAGNSESCKLLVKAGADVNAIDKDGLSALHCAASRGHVKCIETLKNLGAN-VDLADKNNCTALFYAITLGNKECTKALLKFGSNPNHQDNRGRTPTHCAAIKGCVDTVKMLDKHTAQLWTPSIREDCPIHEAAQGGFCDVVKYLLKWK---NDPSAVNIPNKGGRTCLHISAIVNNLPLCKLLIDNGADKN 659          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: W4YGJ7 (ANK_REP_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 3.043e-76
Identity = 213/693 (30.74%), Postives = 333/693 (48.05%), Query Frame = 3
Query: 1245 ILESGNVQAFEEFLLLNSEKINIQFTFDEGSTFPIILIQTFRKAESLTVDRSQGPIIEDYKH--CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPS---VLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLV-KNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTI---DILKDFRGKKATEL 3296
            +  +G  Q   E+L   + K+NI     +G+T  I+ +Q  R      VD    P  +   H  C   L  +G + +  D +GRT  HW++     + + V L    +   +D +G+ +M  +IR N    L+ I     + S   +L  PS + G TPLI A ++G  +  + LLQ   N++ Q+   + +TAL  A  ++N +I  +L+K  A    +D +  + +           L +I         +T      N  G +P++IAC+    + +  L++ ES       + + D + +T LH+  +      AE LL  D+ L   +D  G T LHLA I     LV+ L+ K+G N   QDN GHT +HWAVVC     +            +ID+HGAS IHYA Q    P  S  G I+  K L      VN +D   +TPLLWA+S G ++ C++L E  AD+   D +GL+ LHCA +  H   ++ ++      VD  D N CTPLFYA ++ H+  +  L+E  ++PN  D KG+S  HCAA     D + L+++  GS+    + G+ P HEA + G  D+ + ++ K   C      +  +K G TPLH AA N +  +C+ L+   AN++   +S+         L +T LD A DS  +   D L     K+  EL
Sbjct:   13 LAHAGYAQKLNEYLSKTANKVNINEFSKDGATPLILSVQGSR------VD----PAAQGTSHIECCELLVSHGANPNLSDKLGRTALHWAVFYKKSEFVKVLLKGEGDVTKEDKKGQNVMQFAIRMNAAKCLQLICETLKDASAAKILSKPSASVG-TPLIQATKLGHQECCQILLQAGANIDIQDQAYFDKTALLIATELNNADIVEMLIKYDANIQAEDSQGNTCLHLSCSLTNPRCLELILEGCKK---ATDLVGKRNKAGLTPLMIACQQGLEKHVEFLLKYESP------VGEQDEQGKTALHYATEKGLRSSAELLLAADSGLPWTQDSEGRTPLHLAVIEGKKDLVEFLIGKSGVNA--QDNQGHTPIHWAVVC-GVHDLIDTLVDHGADPSLIDDHGASPIHYAAQMCGDPAVSEIG-ILCLKALIKRGAKVNAIDTGHKTPLLWASSAGSSEACKLLKEAGADVTLADLDGLTALHCAVTCDHPTCVETLLKECDAVVDTPDKNGCTPLFYAASMDHVGNVQTLLESGASPNYTDNKGKSPMHCAAGSASLDAIRLLQEHNGSMNQAGDEGETPFHEAIQKGDLDMIKFMIEKG--CKP----DTPDKNGRTPLHIAAGNANVDLCRYLVELKANIDAGYRSDN-------GLRMTALDCAWDSGAVSCMDYLASIGAKRGREL 668          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2T7P037 (ANK_REP_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14472 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 3.313e-75
Identity = 183/511 (35.81%), Postives = 266/511 (52.05%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFL-RIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSP-------------EGS--VQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKS 3179
            G +PLI AVQ G   I ++LL+    V AQE    +RT LHYAL++   ++F LLL         D++  SV+ R        +L ++++      +      N  +  G +PV IAC+N     LS L+ + +    +      D   RT LHHCV+N DT CAE LLK D SL+   D  G T LHLA IA N+ L++LL+K G++   +D+  HT  HWA VC     +          +   D H A  +HYA Q    P             EGS  V G + + + L ++  +    D D RTP++WAAS G  + C +L+   A+ +  D +GL  LHCAASRGH   +  +V T    VD  D N CTPLFYA+TL H   +  L++  +     D +GR+ AHCAA+KG  DI++ +R  G  L   +  GD P+HEAA+ G  ++ + LL         + ++  NK+G T LH AA  N+ ++ K+L+ RGA+VN + K+
Sbjct:  238 GLSPLILAVQQGHDTICRQLLEAGAEVTAQEA-MTRRTPLHYALYLKRLDLFNLLLNYSPDLTAADHRGTSVVHRCCAVSDVQYLSQLLSACDRQRVLQV--INMADSEGATPVTIACQNGHLTHLSALLAHGASVSDR------DAHGRTALHHCVENPDTACAELLLKADPSLLAAPDDEGLTPLHLAVIAANVPLIRLLLKRGASLTCRDHQQHTVAHWATVC-GHAGVLDVLLEYDVELSSPDAHQAYPVHYAAQ-VARPAHADDDELRHSVSEGSQEVHGNLRLLRKLLDHGVSPEVRDKDMRTPIIWAASAGNAEACGLLVAAGANPDAADKDGLCALHCAASRGHVVCVRQLVTTCGARVDPTDQNQCTPLFYAITLGHCDCVTTLLQLGARSAHTDNRGRNSAHCAAVKGSRDIIESLRVQGVDLWCPSLKGDYPVHEAAQAGHVEIVQYLLEASPAGT--DTVDAANKEGRTCLHIAALTNNLRLAKVLLDRGADVNAVMKT 735          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 149.828 bits (377), Expect = 1.157e-35
Identity = 165/647 (25.50%), Postives = 281/647 (43.43%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ-----DITKETANLN------LTPLDLASDSLTIDILKDFRGKKAT 3290
            E +   +  L + G  +DA    G T  H + L    D++   +  G N   Q   G T ++++ + N L  +    L  N  S  +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F   ++        +P+ +A K  +  M+  L+E  +  +AK        +  TPLH    +   +  E LL     ++ K  KNG + LH+AT  +++  VQLL+ +     D  ND  T+LH A  C    +  +      +      N G + +H A +         +  I + +LL  +  ++  V     TP+  AA +G  +    L+ + A  N  +  G + LH AA  G  +V+  +V   +  VD +  +  TPL  +  L    II  L++  + P+     G +  H AA +G+ D+  ++   G SL +    G  PLH AA+ GK +V  LLL K          +   K G+TPLH AAH ++ K+  LL+ +GA+           ++I +K NQ      + +  A+ N      ++PL LAS    +D++     + AT
Sbjct:   31 EGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRY--LLDNGSS--QSIATEDGFTPLAVALQQGHDQVVSLLLENDTK------GKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARND-------ITPLHVASKRGNSNMVKLLLERGARIDAK------TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALN-GFTPLHIACK---------KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAY-VDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPP------DASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDAT 636          

HSP 2 Score: 116.701 bits (291), Expect = 1.234e-25
Identity = 144/581 (24.78%), Postives = 235/581 (40.45%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGAS----------AIHYATQS-------FLSPEGSV--------QGPIVIXXXXXXXXXXVNCVDYDS---------RTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            +H++ R +D  A   +    +N  V       SG TPL  A   G +++   LL     V+ +  N    T LH A    N  +  LLL+  A+ D K     + +   A    +  + ++    +  I S   N      G SP+ +A +      +  L+ +E   +       V N+  T LH        K A+ ++    +    K  NGFT LH+A   N IK+++LL+K+G++ +     G T +H A                 +I+  + NHGAS          A+H A ++       +L   G+         Q P+ I   L   +     + + +          TPL  AA  G  D   ILL+  A L      G + LH AA  G  +V +L++   + P D    +  TPL  A    +  +   L++Q ++P+     G +  H AA K   +I   + + G         G  PLH A++ G  D+  LL+ +         IN  NK G+TPLH AA  +   + ++L++ GA V+  +K           +  TPL +A
Sbjct:  153 LHIAARKDDTKAAALLLQNDHNADV----ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDI--TPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAP-ILSKTKN------GLSPLHMATQGDHLNCVQLLLHHEVPVD------DVTNDYLTALHVAAHCGHYKVAKVIVDKKAN-PNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAF-----------MGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRA-PPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDAT------INLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETK-----------MGYTPLHVA 684          

HSP 3 Score: 77.0258 bits (188), Expect = 1.459e-13
Identity = 74/297 (24.92%), Postives = 126/297 (42.42%), Query Frame = 3
Query: 2439 GASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVID-LIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRS-----------------------------NPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            G +A+H A++         +G + +   L      V+       T L  A+  G +D  + L+ N A++N +  NG + L+ AA   H DV+  L+ N  S  +  ED    TPL  A+   H  ++  L+E  +                             N + +   G +  H AA  G  ++  L+   G ++  +  N   PLH A++ G  ++ +LLL +         I+   K G+TPLH  A + H ++ ++L+ RGA   ILSK+            L+PL +A+
Sbjct:   21 GLNALHLASK---------EGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDG--FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGAR------IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA--PILSKTKN---------GLSPLHMAT 289          

HSP 4 Score: 70.8626 bits (172), Expect = 1.307e-11
Identity = 74/337 (21.96%), Postives = 146/337 (43.32%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEY--------------PKD-------NFLRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA 2360
            +  L ++G  + A    G T  H +  +   +++   +  G +P   +  GET +H++ R       E +     N + +++ S+    TPL  + ++G  +I+++LLQ     ++   + Y  T LH A    ++++ ++LL   A   I   K  + +   A+Y              P D         L +  HY + ++        ++P     N  GY+P+ IA K +  ++ + L+E  +D+ A      +  +  +PLH      +      L+  D + I   +K+G T LHLA   + + + ++LV +G+    +   G+T LH A
Sbjct:  363 MELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQT---EVVKYLVQNGAYVDAKSKDD-QTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGY--TPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN--GYTPLHIAAKKNQMEIATTLLEYGADTNA------ITRQGISPLHLASQEGNVDMVTLLMARDAT-INLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVA 684          

HSP 5 Score: 66.6254 bits (161), Expect = 2.396e-10
Identity = 60/213 (28.17%), Postives = 95/213 (44.60%), Query Frame = 3
Query: 2625 LENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDIT 3194
            L++  D+N  + NGL+ LH A+  GH +V+  ++   +  VD       T L  A       ++  L+   +N N Q   G +  + AA + + D++  +   G S ++   +G  PL  A + G   V  LLL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+   K+  DIT
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGAT-VDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDF--KARNDIT 217          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 1.523e-34
Identity = 152/616 (24.68%), Postives = 272/616 (44.16%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCC-ATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   +  L E G  +D+    G T  H + L    +++ + +  G +   Q   G T ++++ + N L  +  +     N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F+   N      G +P+ +A K  +  M+  L++  S  +AK        +  TPLH C   S    A +LL    + I  + KNG + LH+A   ++++ V+ L+++ +   D   D  T+LH A  C        L  K      + +  +G + +H A +         +  + + +LL     ++  +     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   +M VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  D+  ++ +AG S +L    G  PLH A++ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+ +            TA    TPL +A+    ++I
Sbjct:   75 EGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGN----QSTATEDGFTPLAIALQQGHNQVVSILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQN------GITPLHVASKRGNTNMVRLLLDRGSQIDAKTR------DGLTPLH-CAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACK---------KNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAM-VDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSA------GKNGLTPLHVAAHYDNQKVALLLLDKGASPHA-----------TAKNGYTPLHIAAKKNQMEI 640          

HSP 2 Score: 129.028 bits (323), Expect = 3.175e-29
Identity = 135/556 (24.28%), Postives = 241/556 (43.35%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKV--------------------DNELR---TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDC--NGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKA 3287
            G   L  A + G +D+V++LL+   +V++    K   TALH A      E+  +L+K  A  + +     + +   ++    + +R +     ++  +T         G++P+ IA +    Q++S L+EN++  + +L  L +                    D + +   TPLH      +   A  LL    ++     +NG T LH+A+   N  +V+LL+  GS    +  DG T LH A        ++L  +    I+    N G S +H A Q            +   K L  +K  V+ V  D  T L  AA  G     ++LL+  A+ N R    NG + LH A  +    V++L+V   +    I ++ L TP+  A  + H++I+  L++  ++P+  +I+G +  H AA  G  +++  + + G  +  R      PLH A+  GK ++ +LLL  M   +           G TPLH +A      +  +L+  GA+ ++ +K              TPL +AS   ++D+ K    ++A
Sbjct:   65 GLNALHLAAKEGHMDLVQELLERGSSVDSA--TKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATED-------GFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKN-GLSPLHMAAQGDH---------VECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAA------TTNGYTPLHISAREGQLDVASVLLEAGASHSLATKK-----------GFTPLHVASKYGSLDVAKLLLQRRA 583          

HSP 3 Score: 97.4413 bits (241), Expect = 1.286e-19
Identity = 136/600 (22.67%), Postives = 242/600 (40.33%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAE--------------YPKDNF-LRIIT---------HYSSSEIFSTPSNNPNNPI----GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLK----LDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLN---KMEECNELEL------------------------INEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILS 3173
            N  +Q   G T +H++  Y ++       L  N  + ++  +  +G TPL  A + G  ++V+ LL     ++A+  +    T LH A    ++    LLL+  A    +     S +   A+               P D+  L  +T         HY  +++      NPN       G++P+ IACK +  +++  L++  +  +A      +     TP+H             LL+     D S I      G T LH+A  A  +++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +         +G + +  +L     + +       TPL  A+  G  D  ++LL+  A  +    NGL+ LH AA   HYD   V  L+++  + P     N   TPL  A     M I   L++  +  N    +G +  H A+ +G+ D+  L+ + G  + +   +G   LH AA+  +  V E+L+     M++  +L                          +N   K G TPLH+AA   +  I  +L+  GA  N ++
Sbjct:  218 NADVQSKSGFTPLHIAAHYGNV---NVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGL--TPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNI-----RGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR---------EGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAA---HYDNQKVALLLLDKGASPHATAKNGY-TPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAIT 787          

HSP 4 Score: 95.5153 bits (236), Expect = 3.841e-19
Identity = 90/336 (26.79%), Postives = 155/336 (46.13%), Query Frame = 3
Query: 2217 IGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS-------FLSPEGSVQG--------PIVIXXXXXXXXXXVNCVDYDS----RTPLLW-AASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            IG  ++NG   LHLA    ++ LVQ L++ GS+       G+T+LH A +    +++ +  K   DI     N G + ++ A+Q        +L   G  Q         P+ I     +N+     ++ D+    R P L  AA    T    +LL+N  + + +  +G + LH AA  G+ +V  L++N  +        N  TPL  A    + +++  L+++ S  + +   G +  HCAA  G+   ++L+ + G  +  R  NG  PLH AA+    +  + LL      +++ L        +T LH AAH  H+++ KLL+ + AN N
Sbjct:   58 IGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQN-GFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDY------LTALHVAAHCGHYRVTKLLLDKRANPN 386          

HSP 5 Score: 91.2781 bits (225), Expect = 9.169e-18
Identity = 112/481 (23.28%), Postives = 193/481 (40.12%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIV-NTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E +  Y  +   +      SG TP+  A  +G ++IV  LLQ   + +   +N    TALH A      E+   LL+N A  D +  +D++ +   +   K   ++++  +      + P     N  GY+P+ I+ +     + S L+E      A  +      +  TPLH          A KLL    +      KNG T LH+A   +N K+  LL+  G++      +G+T LH A                    K       + + Y  ++                         N +     TPL  A+  G +D   +LL+  A +N    +GL+ LH AA      V +++V N  SM  D +     TPL  A    +  +++FL++  ++ N +   G +  H AA +G   I++++ + G        NG+  L  A   G   V + L
Sbjct:  394 GFTPLHIACKKNRVKVMELLVKYGASIQAITE----SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--SNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQH-----MAHPDAATTN--GYTPLHISAREGQLDVASVLLE------AGASHSLATKKGFTPLHVASKYGSLDVA-KLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAA------------------KKNQMEIATTLLQYEAET-------------------------NILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASM--DQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTL 809          

HSP 6 Score: 79.7221 bits (195), Expect = 3.027e-14
Identity = 69/249 (27.71%), Postives = 109/249 (43.78%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLL-----NKME-------------ECNELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            DS T  L AA  G  D     L+   D+   + NGL+ LH AA  GH D++  ++   S  VD       T L  A       ++  L++Q ++ N Q   G +  + A+ + + D++  + + GG+ +    +G  PL  A + G   V  +LL      K+              +   L L N+ N     K G TPLH AAH  +  +  LL++RGA V+  ++ N           +TPL +AS
Sbjct:   31 DSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSS-VDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQN----------GITPLHVAS 268          

HSP 7 Score: 76.6406 bits (187), Expect = 2.260e-13
Identity = 95/416 (22.84%), Postives = 169/416 (40.62%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEY--------------PKDNF-------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
            +P + +  GET +H++ R   +   E +     N +++++ +     TPL  A ++G  +IV+ LLQ   + +A   N Y  T LH +      ++ ++LL+  A   +   K  + +   ++Y              P D+        L +  HY + ++        ++P     N  GY+P+ IA K +  ++ + L++ E    A+ N+L    +  TPLH       +  A  LL+   + +    K+G T LHLA   + + + ++LVKNG++   Q   G+T L   +V C                           HY     ++              L  +  +VN    +  TPL  AA  G T    +LL+  A  N    NG + L  A   G+  V+D +
Sbjct:  452 SPDVSNIRGETALHMAARAGQV---EVVRCLLRNGAMVDARARED-QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKN--GYTPLHIAAKKNQMEIATTLLQYE----AETNILT--KQGVTPLHLASQEGHSDMAALLLQ-KGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPL---IVAC---------------------------HYGNAKMVN-------------FLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTL 809          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: invs (inversin [Source:NCBI gene;Acc:103026533])

HSP 1 Score: 135.576 bits (340), Expect = 1.492e-31
Identity = 144/526 (27.38%), Postives = 230/526 (43.73%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSD------TKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVK-NGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSV--QGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLE---NSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            G TPL+Y V    +D  + LL+   +VN  +++K  RTALH A    N     LLL   A   +KD ++ + +     +     L ++  + +     T   N    + +S        +  + +  LI+++S      N+   D+E + PLH    N         +C  +    + SL+  +D  G T LH A    N  +V++L   +G N    DN   T LHWA +     ++ L  + +   +   D+ GA+ +HY  QS  +   +V  + P V            +  D + RT  +WAA  G  D  + +LE   +  D+N  D  G + LH AA  GH   + L++   SM VD  D    TPLF A  + H  +I  LI+  +  +  DI G S  H AAL G  ++ +++ + G S  L++  G  PL  AA  G  +   LL+    + N        +K+G T LH + +N +    KLL+  GA  N +  + +           TPLD A
Sbjct:   53 GRTPLMYCVLADRLDCAETLLKAGASVNKADHSK--RTALHLAAQKGNVRFMKLLLSRHADWLLKDLEEMTPLHLATRHSSSKPLSLLLKHMAPGEVDTQDRNKQTALHWSAFY-----NHPEHVKLLIKHDS------NIGIPDSEGKIPLHWAAHNKHPNATHTVRCILEAAPTE-SLLNWQDYEGRTPLHFAVADGNEAVVEVLTSYDGCNVTAYDNLFRTPLHWAALLGHARIVHLLLERNKSGMIPSDSQGATPLHYGAQSNYADTVAVFLKHPSV-----------RDEPDLEGRTAFMWAAGKGSDDVIKTMLELKGHVLDINMADKYGGTALHAAALSGHVSTVRLLLEKGSM-VDPLDVMKHTPLFRACEMGHRDVILTLIKGGARVDLVDIDGHSALHWAALGGNAEVCEVLMENGISPNLQDQAGRTPLQCAAYAGYINCMALLIQHHADPNMQ------DKEGRTALHWSCNNGYLDAVKLLLGCGAFPNHMEHTEE---------RYTPLDYA 537          

HSP 2 Score: 88.1965 bits (217), Expect = 4.749e-17
Identity = 125/495 (25.25%), Postives = 205/495 (41.41%), Query Frame = 3
Query: 1461 DLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLES-PSET-------SGATPLIYAVQIGAVDIVKKLLQLN-VNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSL--IGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNN-LCTPLFYAVTLKHMSIIHFLIEQ--RSNPNQQDIKGRSVAHCAALKGY 2903
            ++D QD   +T  HWS   +  + + + +    N  + DSEG+  +H +       A  T+        +LE+ P+E+        G TPL +AV  G   +V+ L   +  NV A +N    RT LH+A  + +  I  LLL+          ++KS +      P D+      HY +   ++              V +  K+   +   DL                  E RT              + +L+L   +  I   DK G T LH A ++ ++  V+LL++ GS     D   HT L  A      D+I    K    +  +  + G SA+H+A         ++ G   + ++L  N  + N  D   RTPL  AA  G  +C  +L+++ AD N +D  G + LH + + G+ D + L++   + P  +E      TPL YA+  +H  +  FL+E    S    QDI   ++   A  KGY
Sbjct:  146 EVDTQDRNKQTALHWSAFYNHPEHVKLLIKHDSNIGIPDSEGKIPLHWAAHNKHPNATHTVRC------ILEAAPTESLLNWQDYEGRTPLHFAVADGNEAVVEVLTSYDGCNVTAYDN--LFRTPLHWAALLGHARIVHLLLE----------RNKSGM-----IPSDSQGATPLHYGAQSNYA------------DTVAVFLKHPSVRDEPDL------------------EGRTAFMWAAGKGSDDVIKTMLELKGHVLDINMADKYGGTALHAAALSGHVSTVRLLLEKGSMVDPLDVMKHTPLFRACEMGHRDVILTLIKGGARVDLVDID-GHSALHWA---------ALGGNAEVCEVLMENGISPNLQDQAGRTPLQCAAYAGYINCMALLIQHHADPNMQDKEGRTALHWSCNNGYLDAVKLLLGCGAFPNHMEHTEERYTPLDYALLGEHQEVTQFLLEHGAMSIAAIQDIAASTIQ--ALYKGY 575          

HSP 3 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 73/305 (23.93%), Postives = 139/305 (45.57%), Query Frame = 3
Query: 1452 NGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPML-QDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNV-NAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA 2360
            +GC++ A D++ RT  HW+ LL    ++ + L    + M+  DS+G T +H   + N     +T+ ++  +PSV + P +  G T  ++A   G+ D++K +L+L  +V +    +KY  TALH A    +     LLL+             S++D                             P + + ++P+  AC+     ++  LI+      A+++++ +D    + LH      + +  E L++   S    +D+ G T L  A  A  I  + LL+++ ++   QD +G T+LHW+
Sbjct:  249 DGCNVTAYDNLFRTPLHWAALLGHARIVHLLLERNKSGMIPSDSQGATPLHYGAQSN---YADTVAVFLKHPSVRDEP-DLEGRTAFMWAAGKGSDDVIKTMLELKGHVLDINMADKYGGTALHAAALSGHVSTVRLLLEK-----------GSMVD-----------------------------PLDVMKHTPLFRACEMGHRDVILTLIKG----GARVDLVDIDGH--SALHWAALGGNAEVCEVLMENGIS-PNLQDQAGRTPLQCAAYAGYINCMALLIQHHADPNMQDKEGRTALHWS 502          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 133.65 bits (335), Expect = 6.974e-31
Identity = 163/657 (24.81%), Postives = 269/657 (40.94%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYA----------------------TQSFLSP--EGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNK-----------------MEECNELEL----------INEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            L  +G DL+     G T  H + L     ++A  +  G N   Q  +G + ++++ + N L   E +     N +    P+E  G TPL  A+Q G  ++V  L      +N     K +  ALH A   D+     +LL+N    D+      + +   A Y   +  +++ +  ++  F TP N      G +P+ IA +  +  M+  L++  +  +A+       +EL TPLH    N   +  E LL    + I  K KNG + +H+A   +++  V+ L++  +   D   D  T LH A  C    +  +             N G + +H A                      T+S L+P    +  G + I K L     + N  +    TPL  AA  G  +  Q LL+N A ++ +  +  + LHCAA  GH +++ L++   + P D       TPL  A    H      L++  +   +   KG +  H A   G  D+ +L+ + G +      NG  PLH A      DV +LL++K                   + N+LE+           N  + +G+TPLH AA      +  LLIS+  NVN+ +K    +T       LTPL L +    + I
Sbjct:   39 LLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHL---EVVKFLLENGANQSLPTE-DGFTPLAVALQQGHENVVALL------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNF-TPKN------GITPLHIAARRGNVIMVRLLLDRGAQIDAR-----TKDEL-TPLHCAARNGHVRVIEILLD-QGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALN-GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANP-DSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTA------LTPLHLVAQEGHVGI 663          

HSP 2 Score: 96.2857 bits (238), Expect = 2.206e-19
Identity = 136/591 (23.01%), Postives = 224/591 (37.90%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEI------FSTP---------------------SNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNN-----NGDLPLHEAAETGKFDVCELLLNKMEEC---------------------------NELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGA 3155
            NP +    G T +H++  Y +L   +   L +   +V  +P   +G TPL  A + G V +V+ LL     ++A+  ++   T LH A    +  +  +LL   A    K     S I   A+    + +R +  Y++ EI        TP                       N     G++P+ IACK +  + +  L+++ +  EA      V     TPLH           + LL+   S      K   T LH+A  A + ++ Q L++N +    +  D  T LH     CA  +            K   +   +A H       + EG      ++        +          TPL  A   G  D  ++LLE  A+ N    NGL+ LH A    + DV+ L+V+    P     N   TPL  A     + +   L++  +N N + ++G +  H AA +G  D++ L+    G++ L N          PLH  A+ G   + ++L+ +                                +   +N   + G TPLH+AA   H  I  LL+  GA
Sbjct:  173 NPDVLSKTGFTPLHIAAHYENLSVAQL--LLNRGANVNFTPK--NGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDEL--TPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNA-EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA------VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVE-TPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLH-----CAARMGHKELVKLLLEHKANPDSATTAGHTPLH-IAAREGHAHTTRILLDGNAQQTKMTK----KGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGY-TPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGA 738          

HSP 3 Score: 90.5077 bits (223), Expect = 1.155e-17
Identity = 98/410 (23.90%), Postives = 177/410 (43.17%), Query Frame = 3
Query: 2217 IGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQ-------SFLSPEGSVQG--------PIVIXXXXXXXXXXVNCVDYDS----RTPLLW-AASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILS----------------KSNQDITKETANL------NLTPLDLASDSLTIDILKDF--RGKK--ATELKVES 3308
            I   ++NG   LHLA+   ++K+V  L+ +G + +     G+T+LH A +    + +          +      G S ++ A Q        FL   G+ Q         P+ +     +       ++Y +    R P L  AA    T    +LL+N  + +     G + LH AA   +  V  L++N  +  V+    N  TPL  A    ++ ++  L+++ +  + +     +  HCAA  G+  +++++   G  +  +  NG  P+H AA+    D    LL    E +++ L +      +TPLH AAH  HH++ K+L+ +GA  N  +                +S   + K +A+L       LTPL +A+    ++I+K    RG    A+ +KVE+
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALA-GQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGAN-VNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDH------LTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET 414          

HSP 4 Score: 87.0409 bits (214), Expect = 1.162e-16
Identity = 110/513 (21.44%), Postives = 193/513 (37.62%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHY----ATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDN-----NLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPL 3095
            G T +H++ + N +    +++L   + + LE+ +E SG TPL  A  +G ++IVK LLQ   + NA  +N    T LH A    + E+   LL+N A+ D K   D++ +   A       ++++  + ++   +T +       G++P+ IA +         L++  +                                           K  K GFT LH+A     + + +LL++ G+N      +G T LH                               A+H+      +  +S  GS                  +    +  TPL  AA     +    LL+  A+ N     G++ LH AA  G  D++ L+++     V++ +         TPL       H+ I   L++Q ++       G +  H A   G   ++  + +    +  +   G  PLH+AA+ G  D+  LLL          L NE    G +PL
Sbjct:  346 GFTPLHIACKKNHM---RSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNA--SNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTA-------GHTPLHIAAREGHAHTTRILLDGNAQQT----------------------------------------KMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHV------------------------------AVHHNNLDVVKLLVSKGGSP-----------------HSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGN-VNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHG------ALPNEITTNGTSPL 751          

HSP 5 Score: 70.4774 bits (171), Expect = 1.557e-11
Identity = 81/314 (25.80%), Postives = 138/314 (43.95%), Query Frame = 3
Query: 1428 HC--LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
            HC    FL +N   +DA+    +T  H +  +   +L+ + L    NP    + G T +H++ R     A  T  L   N    ++     G TPL  A + G VD+ + LL+   N NA   N    T LH A+  +N ++  LL+ +K  S     ++      +A   K N L +    +SS +    + N  +  G +P+ +A +     M++ LI  + +     N ++      TPLH          A+ L+K   S+     + G+T LH+A    NIK+V+ L++  ++   +   G+T LH A 
Sbjct:  424 HCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGH--AHTTRILLDGNAQ--QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGL--TPLHVAVHHNNLDVVKLLV-SKGGSPHSTARNGYTPLHIAA--KQNQLEV----ASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLG-NKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVY-SASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAA 722          

HSP 6 Score: 64.6994 bits (156), Expect = 8.178e-10
Identity = 61/229 (26.64%), Postives = 103/229 (44.98%), Query Frame = 3
Query: 2625 LENSADLNHRDCNGLSVLHCAASRGHYD-VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECN------------------ELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            ++N   +N  + NGL+ LH A+  GH   V++L+ +   +    +  N  T L  A       ++  L+   +N N Q  KG S  + AA + + +++  + + G + +L   +G  PL  A + G  +V  LL+N   +                     + L N+ N     K G TPLH AAH  +  + +LL++RGANVN   K+            +TPL +A+
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGN--TALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKN-----------GITPLHIAA 222          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 124.02 bits (310), Expect = 7.040e-28
Identity = 130/555 (23.42%), Postives = 235/555 (42.34%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKV--------------------DNELR---TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKAT 3290
            G   L  A + G V++V +LL+L  +V+A    K   TALH A      ++   L+ N A  + +     + +   A+      +R +  + +S+  +T         G++P+ +A +    Q++S L+EN++  + +L  L +                    D E +   TPLH      +   A  LL    + +    +N  T LH+A    N  +V+LL+  G+    +  DG T LH         ++++       I+    N G S +H ATQ            +   +LL  +   V+ V  D  T L  AA  G     +++++  A+ N +  NG + LH A  +    V++L++   +    + ++ L TP+  A  + H +I+  L    ++PN  +++G +  H AA  G  D++  + + G  + ++  +    LH A+  GK ++ +LLL K    +           G TPLH A    H +   LL+  GA+++  +K              TPL +A+    I+  K    K+A 
Sbjct:   76 GLNALHLASKEGHVEVVAELLKLGASVDAA--TKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATED-------GFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAA-VDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKN-GLSPLHMATQG---------DHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGL-TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAA------TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKK-----------GFTPLHVAAKYGQIEAAKLLLQKRAA 592          

HSP 2 Score: 110.153 bits (274), Expect = 1.408e-23
Identity = 129/544 (23.71%), Postives = 225/544 (41.36%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLI---RKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEE 3041
            D+ +C+  L ++   +D   +   T  H +       +  V +    NP  +   G T +H++ + N +  +E   L   + + L++ +E SG TP+  A  +G  +IVK+L     + N    N    TALH A      ++   LL+N AK DIK   D++ +   +   K   ++++    +    +T S       GY+P+ +A +    +  S L+E+ +   A         +  TPLH        + A KLL    +      K G T LH+A   +N ++  LL+ +G++      +G+T LH A                    K     G + + +  ++                         N V     +PL  AA  G  D   +LL  +A++N  + NGL+ LH AA      V ++++N  +  VD       TPL  A    +M ++ FL+E ++  N +   G +  H AA +G+  I++++   R +   LTL   NG+  L  A   G   V + L    +E
Sbjct:  347 DHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVME---LLLKHGASLQAVTE-SGLTPIHVAAFMGHENIVKQLTHHGASPNT--TNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTS-------GYTPLHLAVREGHQETASLLLEHGASLSA------ATKKGFTPLHVAAKYGQIEAA-KLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAA------------------KKNQLEIGTTLLEFGAET-------------------------NAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGA-EVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTL---NGNTALSIARRLGYISVVDTLRGLTDE 823          

HSP 3 Score: 106.301 bits (264), Expect = 2.230e-22
Identity = 127/503 (25.25%), Postives = 211/503 (41.95%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSD--IKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSN 3182
            G TPL    + G   +V+ LL     + ++  N    + LH A   D+     LLL++    D    DY        VA +          HY  +++      NPN     G++P+ IACK +  +++  L+++ +  +A      V     TP+H           ++L     S     +  G T LH+A  A    +V+ L++NG+    +  D  T+LH A      +++ L  +          + G + +H A +     EG  +   ++ +   +    ++       TPL  AA  G  +  ++LL+  A  +     GL+ LH AA   HYD   V  L+++  + P     N   TPL  A     + I   L+E  +  N    +G S  H AA +G  D++ L+     ++ + N NG  PLH AA+  +  V E+LLN   E      ++   K G TPLH A H  + K+   L+   A +N  +KS 
Sbjct:  303 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGL--SPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYL---TALHVAAH--------CGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQA------VTESGLTPIHVAAFMGHENIVKQLTHHGAS-PNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTS-GYTPLHLAVR-----EGHQETASLLLEHGAS----LSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAA---HYDNQRVALLLLDHGASPHAAAKNGY-TPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAE------VDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSG 765          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 3.475e-36
Identity = 159/650 (24.46%), Postives = 286/650 (44.00%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELR---TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ--------DITKETANL---NLTPLDLASDSLTIDILKDFRGKKAT 3290
            E +   +  L +   ++D    +G T  H + L    D++ V +  G N   Q   G T ++++ + N L   E +    +N +  +S +   G TPL  A+Q G   +V  LL+      +    K +  ALH A   D+     LLL+++  +D+      + +   A Y   N   ++ +  ++  F+  +       G +P+ +A K  +  M+  L++  +         K+D + R   TPLH    +   K  E LL+ D  ++ K  KNG + LH+AT   ++  VQLL+   +   D   D  T LH A  C    +  L      +      N G + +H A +         +  I + +LL  +  +++       TP+  A+ +G  +  Q+LL+N A  N  +  G + LH A+  G  +V+  ++ + +  V ++     TPL  A  L    I+  L+++ S+PN     G +  + A+ +G+ D+  L+ + G  ++     G  PLH A++ G+ +V  LLL K    +         + G+TPLH A H +H K+  LL+ +GA+           ++I +K NQ        ++  ET  L    + PL LA+     D++    G+ A+
Sbjct:   54 EGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHL---EIVKFLLDNGAN-QSVATEDGFTPLAVALQQGHEQVVGLLLE------SDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARN-------GITPLHVAAKRGNNNMVKLLLDRGA---------KIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALN-GFTPLHIACK---------KNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGAR-VGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADP----KVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS 661          

HSP 2 Score: 113.235 bits (282), Expect = 1.731e-25
Identity = 140/587 (23.85%), Postives = 237/587 (40.37%), Query Frame = 3
Query: 1575 DSEGET---IMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSE---------------------AKLNMLKVDNELR-------TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTW-SMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            D++G+     +H++ R +D  A   +  + +N  V    +  SG TPL  A   G +++   LL L   V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++    +  +  T +       G SP+ +A +      +  L+  ++  +                     AKL +L    E         TPLH     +  K  E LLK   S I    ++G T +H+A+   ++ +VQLL++NG+++   +  G T LH A        +          + +      + +H A++          G   I +LL     + N       TPL +A+  G  D   +LLEN AD++     G + LH A+  G  +V  L++  + S    +   N  TPL  A    H  +   L+++ ++P+     G +  H AA K   ++  ++ + G    +    G  PLH AA+ G  D+  LLL +         I+   K G+T +H AA  +   + ++L    A+VN  +K           L  TPL +AS
Sbjct:  166 DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADV----TSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGI--TPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKN-------GLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKL-LLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGAS-IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMAS-RAGQLEVVKTLLQSGARVGVKAREDQTPLHIASR---------LGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS------ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTK-----------LCYTPLHVAS 710          

HSP 3 Score: 108.612 bits (270), Expect = 4.418e-24
Identity = 122/520 (23.46%), Postives = 225/520 (43.27%), Query Frame = 3
Query: 1686 ETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSP--EGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            ++  AT  + A + G ++ +   L+  +++N    N     ALH A    + ++ T LLK +A+ D       + +   A   + + +R++  + ++   +  S N     G++P+ +A + +  +++  L++N ++            +  TPL   +     +    LL+ DT     K K     LH+A   ++     LL+++  N       G T LH A               + ++  ++ N GA A+ +  ++ ++P    + +G   + KLL +    ++    D  TPL  AA  G     ++LLE  A +  +  NGLS LH A    H   + L++   + PVD    +  TPL  A    H  +   L+++   PN + + G +  H A  K    +++L+ K G S+     +G  P+H A+  G  +V +LLL            N  N +G TPLH A+     ++ K L+  GA V + ++ +Q           TPL +AS
Sbjct:    8 QSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLN--ALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGAN--INAQSQN-----GFTPLYMAAQENHLEIVKFLLDNGANQSV------ATEDGFTPLAVALQQGHEQVVGLLLESDT-----KGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAA-----------HYGNMNVATLLLNLGA-AVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQA-PVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS------NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQ-----------TPLHIAS 477          

HSP 4 Score: 80.4925 bits (197), Expect = 2.396e-15
Identity = 114/493 (23.12%), Postives = 197/493 (39.96%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCA----EKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI------VNTWSMPVDIEDNNLC-TPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + + + +E SG TP+  A  +G +++V+ LLQ   + NA   N    T LH A      E+   LL++ A+  +K  +D++ +   +   K   ++++    S         +PN P   G +P+  A +     + S L+EN +D      +  V  +  TPLH        + A    EK    D  + G+   NG T LH+AT  ++ K+  LL+  G++      +G+T L                                  H A +      G V         L       N +      PL  AA  G  D   +LL   A ++     GL+ +H AA     +V +++      VNT +         LC TPL  A    ++ +++FL+  R+  N +   G +  H AA +G+  +++ + +   S      NG+  L  A   G   V + L
Sbjct:  370 GFTPLHIACKKNRIKVME---LLLKHGASIHTTTE-SGLTPIHVASFMGHLNVVQLLLQNGASSNA--TNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGS---------DPNAPTASGSTPLYFASREGHGDVASLLLENGAD------ISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ---NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPL----------------------------------HIAAKKNQLEVGKV---------LLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTT--------KLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 5 Score: 61.6178 bits (148), Expect = 1.413e-9
Identity = 85/351 (24.22%), Postives = 139/351 (39.60%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLAT------------------------------IA---NNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
             +  L +NG   +A +  G T  H +     L+++   L  G    ++  E +T +H++ R   L   E + L     S   +P+  SG+TPL +A + G  D+   LL+   +++      +  T LH A      E+ TLLL+  A +D K          VA       L + THY   ++        ++P +   N  GY+P+ IA K +  ++   L+E  +++    NML    +   PLH             LL    S I    K G T +HLA                               +A    NIK+V  L++N +    +  +G+T LH A 
Sbjct:  418 VVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASR---LGKAEIVQLLLQRGSDPNAPT-ASGSTPLYFASREGHGDVASLLLENGADISPVTKKGF--TPLHIASKYGRLEVATLLLEKYASADPK----------VAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKN--GYTPLHIAAKKNQLEVGKVLLELGAET----NMLT--QQGVAPLHLAAQEGHADMVALLLGRHAS-ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAA 743          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 5.855e-35
Identity = 165/658 (25.08%), Postives = 290/658 (44.07%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF--LRIITHYSSSEIFSTPSNNPNNPI------GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELR---TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ--------DITKETANL---NLTPLDLASDSLTIDILKDFRGKKAT 3290
            E +   +  L +   ++D    +G T  H + L    D++ V +  G N   Q   G T ++++ + N L   E +    +N +  +S +   G TPL  A+Q G   +V  LL+      +    K +  ALH A   D+     LLL+++  +D+     K ++++  E     F  L I  HY +  + +T   N    +      G +P+ +A K  +  M+  L++  +         K+D + R   TPLH    +   K  E LL+ D  ++ K  KNG + LH+AT   ++  VQLL+   +   D   D  T LH A  C    +  L      +      N G + +H A +         +  I + +LL  +  +++       TP+  A+ +G  +  Q+LL+N A  N  +  G + LH A+  G  +V+  ++ + +  V ++     TPL  A  L    I+  L+++ S+PN     G +  + A+ +G+ D+  L+ + G  ++     G  PLH A++ G+ +V  LLL K          +   K G+TPLH A H +H K+  LL+ +GA+           ++I +K NQ        ++  ET  L    + PL LA+     D++    G+ A+
Sbjct:   53 EGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHL---EIVKFLLDNGAN-QSVATEDGFTPLAVALQQGHEQVVGLLLE------SDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTS---KMMLNQTTE---SGFTPLHIAAHYGNMNV-ATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGA---------KIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALN-GFTPLHIACK---------KNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGAR-VGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASA------DPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS 666          

HSP 2 Score: 113.235 bits (282), Expect = 1.818e-25
Identity = 140/590 (23.73%), Postives = 240/590 (40.68%), Query Frame = 3
Query: 1575 DSEGET---IMHLSIRYNDLMALETINLYSNNPSV----LESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSE---------------------AKLNMLKVDNELR-------TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            D++G+     +H++ R +D  A   +  + +N  V    + + +  SG TPL  A   G +++   LL L   V+    N    T LH A    N  +  LLL   AK D K     + +   A    +  + ++    +  +  T +       G SP+ +A +      +  L+  ++  +                     AKL +L    E         TPLH     +  K  E LLK   S I    ++G T +H+A+   ++ +VQLL++NG+++   +  G T LH A        +          + +      + +H A++          G   I +LL     + N       TPL +A+  G  D   +LLEN AD++     G + LH A+  G  +V  L++  ++   D +  N  TPL  A    H  +   L+++ ++P+     G +  H AA K   ++  ++ + G    +    G  PLH AA+ G  D+  LLL +         I+   K G+T +H AA  +   + ++L    A+VN  +K           L  TPL +AS
Sbjct:  165 DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGI--TPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKN-------GLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKL-LLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGAS-IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMAS-RAGQLEVVKTLLQSGARVGVKAREDQTPLHIASR---------LGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYA-SADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS------ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTK-----------LCYTPLHVAS 715          

HSP 3 Score: 82.8037 bits (203), Expect = 3.854e-16
Identity = 114/489 (23.31%), Postives = 200/489 (40.90%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI------VNTWSMPVDIEDNNLC-TPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            G T +H++ + N +  +E   L   + + + + +E SG TP+  A  +G +++V+ LLQ   + NA   N    T LH A      E+   LL++ A+  +K  +D++ +   +   K   ++++    S         +PN P   G +P+  A +     + S L+EN +D      +  V  +  TPLH        + A  LL+   S    K KNG T LH+AT  ++ K+  LL+  G++      +G+T L                                  H A +         +  + + K+L       N +      PL  AA  G  D   +LL   A ++     GL+ +H AA     +V +++      VNT +         LC TPL  A    ++ +++FL+  R+  N +   G +  H AA +G+  +++ + +   S      NG+  L  A   G   V + L
Sbjct:  377 GFTPLHIACKKNRIKVME---LLLKHGASIHTTTE-SGLTPIHVASFMGHLNVVQLLLQNGASSNA--TNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGS---------DPNAPTASGSTPLYFASREGHGDVASLLLENGAD------ISPVTKKGFTPLHIASKYGRLEVATLLLEKYAS-ADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPL----------------------------------HIAAK---------KNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTT--------KLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 4 Score: 67.3958 bits (163), Expect = 2.431e-11
Identity = 60/235 (25.53%), Postives = 107/235 (45.53%), Query Frame = 3
Query: 2544 VNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLP-LHEAAETGKFDVCELLLNKMEECNELE--LINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            +N  + +    L  A+  G  D    LL+  A+++     G + LH AA  G  D++ ++V  +   ++ +  N  TPL+ A    H+ I+ FL++  +N +     G +    A  +G+  ++ L+ ++     +R     LP LH AA     +   LLL      +     ++N+  + G TPLH AAH  +  +  LL++ GA V+            TA   +TPL +A+
Sbjct:   36 INTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVE-FGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR-----LPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDF-----------TARNGITPLHVAA 253          

HSP 5 Score: 59.6918 bits (143), Expect = 5.639e-9
Identity = 83/351 (23.65%), Postives = 138/351 (39.32%), Query Frame = 3
Query: 1431 CLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLAT------------------------------IA---NNIKLVQLLVKNGSNTKDQDNDGHTSLHWAV 2363
             +  L +NG   +A +  G T  H +     L+++   L  G    ++  E +T +H++ R   L   E + L     S   +P+  SG+TPL +A + G  D+   LL+   +++      +  T LH A      E+ TLLL+  A +D K     +             L + THY   ++        ++P +   N  GY+P+ IA K +  ++   L+E  +++    NML    +   PLH             LL    S I    K G T +HLA                               +A    NIK+V  L++N +    +  +G+T LH A 
Sbjct:  425 VVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASR---LGKAEIVQLLLQRGSDPNAPT-ASGSTPLYFASREGHGDVASLLLENGADISPVTKKGF--TPLHIASKYGRLEVATLLLEKYASADPKGKNGLTP------------LHVATHYDHQKVALLLLDKGASPHSTAKN--GYTPLHIAAKKNQLEVGKVLLELGAET----NMLT--QQGVAPLHLAAQEGHADMVALLLGRHAS-ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAA 748          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 123.25 bits (308), Expect = 4.463e-29
Identity = 153/564 (27.13%), Postives = 235/564 (41.67%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSD------TKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVK-NGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS--------FLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLE--NSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            +H +    D  AL+ I+  S+NP   ++P +  G TPL+Y V     +  + L++   NVN  + +K KRTALH A    N  I  LLL  +A    KD +  + +     +     L ++  +          N     + +S        +  + +  LI+++S      N+   D+E + PLH   +N D       +C  +    D S++  +D  G T LH A    N  +V +L      N    DN   TSLHWA +     ++ L  + +       D+ GA+ +HYA QS        FLS       P                 D + RT  +WAA  G       +L    + D+N  D  G + LH AA  GH   + L++   +  VD  +    TPLF A  + H  +I  LIE  +  +  D  G S  H AAL G  DI  ++ + G    +R++    PL  AA  G  +   +L++   + N  +      K+GMT LH   +N +    KLL+  GA  N +         ET     TPLD A
Sbjct:   15 VHAAAINGDRSALQKID--SSNPEFRDAPDQF-GRTPLMYCVLADRPECAEALVKAGANVN--KTDKSKRTALHLAAQKGNYRILKLLLSRRASLLQKDLEGMTGLHLATRHETPRCLALLLKHIEPGEVDVQDNQKRTALHWSAYY-----NHPEHVRMLIKHDS------NIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTD-SILNWQDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSSGTIPSDSQGATPLHYAAQSNHAETVEVFLSHPSVHDEP-----------------DLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQ-VDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDSQADPNIQD------KEGMTALHWCCNNGYLNAVKLLLEYGAFPNHM---------ETNEERYTPLDYA 528          

HSP 2 Score: 92.8189 bits (229), Expect = 2.281e-19
Identity = 114/476 (23.95%), Postives = 204/476 (42.86%), Query Frame = 3
Query: 1431 CLNFLFEN--GCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETIN-LYSNNP--SVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNV-NVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSL-IGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDN-NLCTPLFYAVTLKHMSIIHFLIEQ 2834
            CL  L ++    ++D QD+  RT  HWS   +  + + + +    N  + DSEG+  +H +    D  A+ T+  L    P  S+L    +  G TPL +AV  G   +V  L    V NV A +N    RT+LH+A  + + +I  LLL+  +   I                                       P++  G +P+  A +++  + +   + + S  +      + D E RT                +L+L  +L +   DK G T LH A ++ ++  V+LL+ +G+     +   HT L  A      ++I+   +    +  +  + G S +H+A         ++ G   I  +L  N  + +  D+  RTPL  AA  G  +C  +L+++ AD N +D  G++ LH   + G+ + + L++   + P  +E N    TPL YA+   H  +I +++E 
Sbjct:  126 CLALLLKHIEPGEVDVQDNQKRTALHWSAYYNHPEHVRMLIKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTDSILNW-QDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDN--LFRTSLHWAALLGHAKIVHLLLERNSSGTI---------------------------------------PSDSQGATPLHYAAQSNHAETVEVFLSHPSVHD------EPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQD-GHSPLHWA---------ALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDSQADPNIQDKEGMTALHWCCNNGYLNAVKLLLEYGAFPNHMETNEERYTPLDYALLGGHQEVIQYMLEH 543          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 119.783 bits (299), Expect = 8.271e-28
Identity = 152/564 (26.95%), Postives = 233/564 (41.31%), Query Frame = 3
Query: 1596 MHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSD------TKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVK-NGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS--------FLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLE--NSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            +H +    D  AL+ I +   NP   ++P +  G TPL+Y V     +  + L++   NVN  + +K KRTALH A    N  I  LLL  +A    KD +  + +     +     L ++  +          N     + +S        +  + +  LI+++S      N+   D+E + PLH   +N D       +C  +    D S++  +D  G T LH A    N  +V +L      N    DN   TSLHWA +     ++ L  + +       D+ GA+ +HYA QS        FLS       P                 D + RT  +WAA  G       +L    + D+N  D  G + LH AA  GH   + L++   +  VD  +    TPLF A  + H  +I  LIE  +  +  D  G S  H AAL G  DI  ++ + G    +R++    PL  AA  G  +   +L++   + N        +K+GMT LH   +N +    KLL+  GA  N +         ET     TPLD A
Sbjct:   19 VHAAAINGDRSALQKILV--ANPEFRDAPDQF-GRTPLMYCVLADRPECAEALVKAGANVN--KTDKSKRTALHLAAQKGNYRILKLLLSRRASLLQKDLEGMTGLHLATRHETPRCLALLLKHIEPGEVDVQDNQKRTALHWSAYY-----NHPEHVRMLIKHDS------NIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTD-SILNWQDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSSGTIPSDSQGATPLHYAAQSNHAETVEVFLSHPSVHDEP-----------------DLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQ-VDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDSQADPNIQ------DKEGMTALHWCCNNGYLNAVKLLLEYGAFPNHM---------ETNEERYTPLDYA 532          

HSP 2 Score: 93.5893 bits (231), Expect = 1.654e-19
Identity = 114/476 (23.95%), Postives = 204/476 (42.86%), Query Frame = 3
Query: 1431 CLNFLFEN--GCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETIN-LYSNNP--SVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNV-NVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSL-IGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDN-NLCTPLFYAVTLKHMSIIHFLIEQ 2834
            CL  L ++    ++D QD+  RT  HWS   +  + + + +    N  + DSEG+  +H +    D  A+ T+  L    P  S+L    +  G TPL +AV  G   +V  L    V NV A +N    RT+LH+A  + + +I  LLL+  +   I                                       P++  G +P+  A +++  + +   + + S  +      + D E RT                +L+L  +L +   DK G T LH A ++ ++  V+LL+ +G+     +   HT L  A      ++I+   +    +  +  + G S +H+A         ++ G   I  +L  N  + +  D+  RTPL  AA  G  +C  +L+++ AD N +D  G++ LH   + G+ + + L++   + P  +E N    TPL YA+   H  +I +++E 
Sbjct:  130 CLALLLKHIEPGEVDVQDNQKRTALHWSAYYNHPEHVRMLIKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTDSILNW-QDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDN--LFRTSLHWAALLGHAKIVHLLLERNSSGTI---------------------------------------PSDSQGATPLHYAAQSNHAETVEVFLSHPSVHD------EPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQD-GHSPLHWA---------ALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDSQADPNIQDKEGMTALHWCCNNGYLNAVKLLLEYGAFPNHMETNEERYTPLDYALLGGHQEVIQYMLEH 547          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 3.848e-27
Identity = 99/373 (26.54%), Postives = 171/373 (45.84%), Query Frame = 3
Query: 2142 TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            TPLH    +   +  E LL+    ++ K  KNG + LH+AT  ++++ VQ+L++  +   D   D  T+LH A  C       +      +      N G + +H A +         +  I + +LL     ++  V     TP+  +A +G  +   ILL+  A  N  +  G + LH AA  G  +V+  ++   +  VD +     TPL  A  L  + I+  L++  ++P+     G +  H AA +G+ D+  ++ + G SL +    G  PLH A++ GK +V  LLL +    +         K G+TPLH A+H ++ K+  LL+ +GA+ +            TA    TPL +A+    ++I
Sbjct:    8 TPLHCAARSGHEQVVEILLEQGAPILAKT-KNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALN-GFTPLHIACK---------KNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQ-VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAA------GKNGLTPLHVASHYDNQKVALLLLDQGASPH-----------ATAKNGYTPLHIAAKKDQLEI 351          

HSP 2 Score: 115.546 bits (288), Expect = 4.932e-26
Identity = 125/516 (24.22%), Postives = 203/516 (39.34%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            G TPL  A + G   +V+ LL+    + A+  N    + LH A   D+ E   +L++ +A  D       + +   A            HY ++++      NPN     G++P+ IACK +  +++  L++  +  EA      V     TP+H      +      LL+   S     +  G T LH+A  A   ++V+ L++NG+    +  +  T LH A                              +    Q   SP+ +                       +  TPL  AA  G  D   ILLE+ A L      G + LH A+  G  +V  L++  ++ P D    N  TPL  A    +  +   L++Q ++P+     G +  H AA K   +I   + + G         G  PLH  A+ G  DV  LLL +  +      +N   K G++PLH AA  +   + ++L+  GA+VN  +K           L  TPL +A
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGL--SPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAH---------CGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEA------VTESGLTPMHVSAFMGNLNIVLILLQGGAS-PNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKL----------------------EIVQLLLQHMASPDAATS---------------------NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP-DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYAD------VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTK-----------LGYTPLIVA 442          

HSP 3 Score: 107.842 bits (268), Expect = 1.043e-23
Identity = 120/494 (24.29%), Postives = 209/494 (42.31%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEE 3041
            NP ++   G T +H++ + N +  +E +  Y  +   +E+ +E SG TP+  +  +G ++IV  LLQ   + NA   N    TALH A      E+   LL+N A+ D K  ++++ +   A   K   ++++  + +S     P    +N  GY+P+ +A +     + + L+E+ +      ++     +  TPLH        + A  LL+   S      KNG T LH+A+  +N K+  LL+  G++      +G+T LH A                    K       + + Y  ++                         N +      PL   A  G  D   +LL   AD+NH   +GLS LH AA     +V +++V   +  V+       TPL  A    ++ +++FL++  ++ N +   G +  H AA +G+  I++L+ K G        NG+  L  A   G   V + L    EE
Sbjct:   97 NPNVRALNGFTPLHIACKKNRIRVMELLLKYGAS---IEAVTE-SGLTPMHVSAFMGNLNIVLILLQGGASPNA--TNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMAS-----PDAATSN--GYTPLHVAAREGHEDVTAILLEHGA------SLAVTTKKGFTPLHVASKYGKMEVASLLLQRFAS-PDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAA------------------KKDQLEIATTLLEYGAET-------------------------NAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAH-VNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEE 526          

HSP 4 Score: 83.9593 bits (206), Expect = 2.179e-16
Identity = 64/235 (27.23%), Postives = 106/235 (45.11%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILK 3266
            D  TPL  AA  G     +ILLE  A +  +  NGLS LH A    H + + +++  +  PVD    +  T L  A    H      L+++ +NPN + + G +  H A  K    +++L+ K G S+     +G  P+H +A  G  ++  +LL      N        N +G T LH AA     ++ + L+  GA V+  ++  Q           TPL +A+    ++I++
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQ-YRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNAT------NVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQ-----------TPLHIAARLGKLEIVQ 221          

HSP 5 Score: 67.3958 bits (163), Expect = 2.896e-11
Identity = 82/364 (22.53%), Postives = 148/364 (40.66%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNF---------------------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELR---------------------------TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA 2360
            +  L + G  ++A    G T  H S  +  L+++ + L  G +P   +  GET +H++ R      + +  L  N   V     E    TPL  A ++G ++IV+ LLQ   + +A  +N Y  T LH A    +E++  +LL++ A   +   K  + +   ++Y K                        L + +HY + ++        ++P     N  GY+P+ IA K    ++ + L+E  +++ A          L                            +PLH          AE L+K   + +    K G+T L +A    NIK+V  L+++G++   +  +G+T LH A
Sbjct:  121 MELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRS--LLRNGAQVDAKAREEQ--TPLHIAARLGKLEIVQLLLQHMASPDAATSNGY--TPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKN--GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVK-HGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQA 475          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 54.299 bits (129), Expect = 3.227e-8
Identity = 50/223 (22.42%), Postives = 89/223 (39.91%), Query Frame = 3
Query: 2556 DYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDI--KGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISR-GANVNILSKSNQDITKETANLN 3215
            D D R PL W+ S    +    LL    ++N                     +D          D  D++  TP   A ++ ++ ++  L ++   P+   I  +G +  H A  K + ++   + + G S+ +++    +PLH AA  G   + ELL    +       +N  +K+G TPL  A    H     LL+ + GA  +++   N+    E   LN
Sbjct:   33 DQDGRIPLHWSVSFQAHEITSFLLSKMENVN---------------------LD----------DYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSA-----VNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLV--DNKGAKAEDVALN 217          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 53.5286 bits (127), Expect = 2.847e-7
Identity = 31/108 (28.70%), Postives = 53/108 (49.07%), Query Frame = 3
Query: 2649 HRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIK--GRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNG 2966
            +RD  G + L  A  +G YDV+  ++      ++ +DN   T L  A    H+ I+  LIE  ++ N + I+  G +    A+  G+ D++  + K G   T+RN  G
Sbjct:  325 YRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKG 432          

HSP 2 Score: 52.373 bits (124), Expect = 5.323e-7
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 3
Query: 2817 HFLIEQRSNPNQ-----QDIKGRSVAHCAALKGYCDILD-LIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNI 3167
            H  + +R  P Q     +D  GR+    A  KG  D++  +I + G  +  ++N G+  LHEAA  G  ++ ELL+    + N ++ I  F   G TPL  A+ N H  + K L+  GA+  I
Sbjct:  311 HIAVSKR--PKQKKGIYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVN-IKSIEMF---GDTPLIDASANGHLDVVKYLLKNGADPTI 427          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 50.0618 bits (118), Expect = 2.102e-6
Identity = 43/145 (29.66%), Postives = 62/145 (42.76%), Query Frame = 3
Query: 2622 LLENSADL--NHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMP---VDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSN-PNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKME 3038
            LL  + DL  N    NG S LH A+  G Y +   ++         +     N C  L  A+   H   +H L++Q     N +   GR+  H A +  Y   L L+   G  L + + NGD PLH   E G     ++LLN+ E
Sbjct:   24 LLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHL--ALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGE 166          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 72.7886 bits (177), Expect = 5.072e-14
Identity = 60/208 (28.85%), Postives = 99/208 (47.60%), Query Frame = 3
Query: 2544 VNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLK-HMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGD---LPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGA 3155
            VN  D + RTPL  AA  G  +C ++L+  + D N  D  G + LH AA   ++  +  +V   S  V+  D   CTPL YA         +  L+  R N +++D +G S  H A+  G+   ++++     +  L  ++G     PLH AA  G     E+L+      N+LE+ ++   +G TPL  A+   H +  + L++  A
Sbjct:   26 VNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGS-NVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSF---NDLEVRDD---RGRTPLDLASFQGHVECVECLLNHNA 226          

HSP 2 Score: 54.299 bits (129), Expect = 7.354e-8
Identity = 69/242 (28.51%), Postives = 99/242 (40.91%), Query Frame = 3
Query: 2028 PVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKL--DTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS--FLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSM 2741
            P+ +AC     +    L+    D  AK      DN  RTPLH    + +  C E L+    D + I   DK G   LH A    N + V  LV  GSN    D    T LH+A               +       D  G SA+HYA+ +   L+ E  +    V    L N      CV     TPL  AA  G     ++L+++  DL  RD  G + L  A+ +GH + ++ ++N  +M
Sbjct:    3 PLHLACLGGFTECCKKLLFYGVDVNAK------DNNDRTPLHCAACSGNVNCLELLMSQAGDFNCI---DKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLD---VSANDLLNRSSGSPCV-----TPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNAM 227          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 73.1738 bits (178), Expect = 3.338e-13
Identity = 102/454 (22.47%), Postives = 180/454 (39.65%), Query Frame = 3
Query: 2025 SPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGK----------KDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQ-------GPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVN----TWSMPVDI-----------------------EDNNLC---------TPLFYAVTLKHMSIIHFLIEQRSNP---NQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQ---DITKETAN 3209
            +P+ +AC +    +   L+E  +D      +  +D E  TPLH      +   A KLL +   L G           +D+   T LHLA    +  L +L ++ G+N        + + H  +V     +  +                 S + Y   SF   E   +         ++I   +   +  + C D D  TPL+ AA     D  + LL++ AD+  +D N  + +  AA+ G  + ++  +      W++  D+                        DN  C         TP+ YA     +  +  L+++  +P   N +D    +  H AAL G+  ++  +   GG++  RN     PL  AA  G  +V  +LL      +E   ++  +K   TPLH A+   H ++ KLL+SR AN+ +   + +   DI  E+++
Sbjct:    6 TPLHVACSHGCIPVAKCLVEAGAD------LRSLDEEQMTPLHFACMEGNLGVA-KLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIK--------------VSKLKYL--SFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKR--DPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILL------DEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSH 428          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK80])

HSP 1 Score: 66.2402 bits (160), Expect = 1.893e-11
Identity = 51/185 (27.57%), Postives = 96/185 (51.89%), Query Frame = 3
Query: 2676 LHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAA-HNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPL 3227
            LH A +R   D +  I++  +  V++ D    TPL  A    ++ ++  L+E  ++PN  +  G++    +   G  +   L+R+ G     R+ NG   +H AA+ G  D   LLL  +++  +++L + +N  G TPL + A  + + ++ ++LI++GA+VN   KS +D  +    L+  PL
Sbjct:  111 LHKAVARQDLDQVRKILSENNSVVEVMDKFGLTPLMVAAQKGYIDVMETLLEFGADPNYFNSSGKTCMMISCYSGQEEPAKLLRERGVEWGSRDKNGLTSVHWAADGGHDD---LLLWMLKDGAQVDLEDTYN--GWTPLMRVACLSGNDEVAEVLIAKGADVNRTDKSRKD--RAYGGLHERPL 288          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO44583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI8])

HSP 1 Score: 67.3958 bits (163), Expect = 2.337e-11
Identity = 67/206 (32.52%), Postives = 98/206 (47.57%), Query Frame = 3
Query: 2547 NCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGY---CDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGA 3155
            N  D++ RTPL WA+     D  ++LL++ A++N  DC GL+    A    HYD               + +NL        TLK  ++  F   + +   QQD+KGR+V H A  +     C + +L+ K  G L L   N  + LH AAE G    CEL+L+ +  C+ L LI   + +G TPLH AA     +I   L+  G 
Sbjct:  250 NIEDHEGRTPLHWASGNSSLDNLKLLLQHGANINALDCEGLTAAMWAC---HYD---------------QKHNL-------STLK-TALSRFDPREEALFEQQDVKGRTVVHWAVNRSTSLEC-LKELLTKETGKL-LDGENRSI-LHTAAEQGCLAACELVLD-VSGCDCLNLI---DNQGRTPLHLAALCGQAQIINYLLDVGG 422          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 62.3882 bits (150), Expect = 8.803e-11
Identity = 36/121 (29.75%), Postives = 62/121 (51.24%), Query Frame = 3
Query: 2574 PLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAG 2936
            P++ AA     + C++LL   AD+N  +C G + LH A  RGH  +++L++    M V++ D +  T L  A  +    II  L+   +N   +D  G +  H AA +G  ++L  + + G
Sbjct:   68 PIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 2 Score: 58.9214 bits (141), Expect = 1.382e-9
Identity = 53/189 (28.04%), Postives = 91/189 (48.15%), Query Frame = 3
Query: 2181 CAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLH-WAVVCCATXXXXXXXXXXXXXXXXXXN----HGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNT 2732
            C  KLL+ + + +   D +GF+ LH AT  N++ +VQ+L+  G+   D D  G  S+     + CA     +             N    +G +A+H+AT+   S         ++E LL++ + +VN VD D+ T L  AA +G     + LL   A++  +D +G +  H AA  G  +V+  ++ T
Sbjct:   10 CVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGA---DVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSK--------MVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRT 187          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 144.821 bits (364), Expect = 3.229e-34
Identity = 153/606 (25.25%), Postives = 263/606 (43.40%), Query Frame = 3
Query: 1443 LFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            L  +G +L+A    G T  H + L     ++A  +  G N   Q  +G + ++++ + N L   E +     N +    P+E  G TPL  A+Q G  ++V  L      +N     K +  ALH A   D+     +LL+N    D+      + +   A Y   +  +++ +  ++  F TP N      G +P+ IA +  +  M+  L++  +  +A+       +EL TPLH    N   +  E LL+   + I  K KNG + +H+A   +++  V+ L++  +   D   D  T LH A  C    +  +             N G + +H A +         +  +    LL  +  ++  V     TPL  AA +G  +  + LL+  A  N  +    + LH A+  GH +V   ++   +  VD    +  TPL  A  + H  ++  L++ ++NP+     G +  H AA +G+   + ++  AG         G  PLH A++ GK DV ELLL +    N         K G+TPLH A H+N+  + KLL+S+G + +            TA    TPL +A+    I++
Sbjct:   62 LLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHL---EVVKFLLENGANQSLPTE-DGFTPLAVALQQGHENVVALL------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNF-TPKN------GITPLHIASRRGNVMMVRLLLDRGAQIDAQ-----TKDEL-TPLHCAARNGHVRIIEILLE-HGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALN-GFTPLHIACK---------KNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQ-VDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAA------GKNGLTPLHVAVHHNNLDVVKLLVSKGGSAH-----------STARNGYTPLHIAAKQNQIEV 615          

HSP 2 Score: 126.331 bits (316), Expect = 1.706e-28
Identity = 125/486 (25.72%), Postives = 210/486 (43.21%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEE 3041
            G T +H++ + N +    +++L   + + LE+ +E SG TPL  A  +G ++IVK LLQ   + NA  +N    T LH A    + E+   LL+N A+ D +   D++ +   A       ++++  + ++   +T +       G++P+ IA +      +  L++      A    +K+  +  TPLH          AE LL+   +      KNG T LH+A   NN+ +V+LLV  G +      +G+T LH A                                           + Q  I +  +L  N  + NC      TPL  A+  G  D   +L+   A++N  + NGL+ LH  A  GH  + D +V   +  V        TPL  A    ++ ++ FL++Q+++ N +   G +  H AA +G+ DI+ L+ K G       +NG  PL  A   G   V ++L    EE
Sbjct:  369 GFTPLHIACKKNHM---RSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKNLLQRGASPNA--SNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTA-------GHTPLHIAAREGHIHTIRILLD------AGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGAN-PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIA-------------------------------------------AKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEE 790          

HSP 3 Score: 112.849 bits (281), Expect = 1.857e-24
Identity = 142/595 (23.87%), Postives = 244/595 (41.01%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEI------FSTP---------------------SNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDIL 3263
            NP +    G T +H++  Y ++   +   L +   +V  +P   +G TPL  A + G V +V+ LL     ++AQ  ++   T LH A    +  I  +LL++ A    K     S I   A+    + +R +  Y++ EI        TP                       N     G++P+ IACK +  + +  L+++ +  EA      V     TPLH           + LL+   S      K   T LH+A+ A + ++ Q L++N +    +  D  T LH     CA  +            K   +   +A H       + EG +   I I       +  +    +   TPL  A+  G  D  ++LLE  A+ N    NGL+ LH A    + DV+ L+V+          N   TPL  A     + +   L++  ++PN + ++G +  H A+ +G  D++ ++     ++ L N NG  PLH  A+ G   + + L+ +         +   ++ G TPLH A H  + K+ K L+ + A+VN  ++           +  TPL  A+     DI+
Sbjct:  196 NPDVLSKTGFTPLHIAAHYENMSVAQL--LLNRGANVNFTPK--NGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDEL--TPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNA-EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA------VTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVE-TPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLH-----CAARMGHKELVKLLLDHKANPDSATTAGHTPLH-IAAREGHIHT-IRILLDAGAQQVKMTKKGF---TPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGY-TPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGAS------VYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTR-----------MGYTPLHQAAQQGHTDIV 748          

HSP 4 Score: 92.0485 bits (227), Expect = 4.418e-18
Identity = 99/406 (24.38%), Postives = 178/406 (43.84%), Query Frame = 3
Query: 2229 DKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQ-------SFLSPEGSVQG--------PIVIXXXXXXXXXXVNCVDYDS----RTPLLW-AASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILS----------------KSNQDITKETANL------NLTPLDLASDSLTIDILKDF--RGKK--ATELKVES 3308
            ++NG   LHLA+   ++K+V  L+ +G   +     G+T+LH A +    + +          +    + G S ++ A Q        FL   G+ Q         P+ +     +       ++Y +    R P L  AA    T    +LL+N  + +     G + LH AA   +  V  L++N  +  V+    N  TPL  A    ++ ++  L+++ +  + Q     +  HCAA  G+  I++++ + G  +  +  NG  P+H AA+    D    LL    E +++ L +      +TPLH AAH  HH++ K+L+ +GA  N  +                +S   + K +A+L       LTPL +A+    ++I+K+   RG    A+ +KVE+
Sbjct:   40 NQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALA-GQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGAN-VNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDH------LTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVET 437          

HSP 5 Score: 70.4774 bits (171), Expect = 1.663e-11
Identity = 69/250 (27.60%), Postives = 112/250 (44.80%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD-VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECN------------------ELELINEFN-----KKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLAS 3239
            D+ T  L AA  G  D     ++N  ++N  + NGL+ LH A+  GH   V++L+ +   +    +  N  T L  A       ++  L+   +N N Q  KG S  + AA + + +++  + + G + +L   +G  PL  A + G  +V  LL+N   +                     + L N+ N     K G TPLH AAH  +  + +LL++RGANVN   K+            +TPL +AS
Sbjct:    9 DAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGN--TALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKN-----------GITPLHIAS 245          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 143.28 bits (360), Expect = 9.657e-34
Identity = 149/615 (24.23%), Postives = 267/615 (43.41%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   +  L + G  +D+    G T  H S L    +++   +  G +   Q   G T ++++ + N L  +  +     N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F+  +       G +P+ +A K  +  M+  L++  S  +AK        +  TPLH    +      E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  T+LH A  C    +  L      +      N G + +H A +         +  + + +LL     ++  V     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   +M VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  +   ++ +AG S +L    G  PLH  ++ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+ +            TA    TPL +A+    +DI
Sbjct:   75 EGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGN----QSTATEDGFTPLAIALQQGHNQVVSILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-------GITPLHVASKRGNTNMVRLLLDRGSQIDAK------TRDGLTPLHCAARSGHEASVEVLLEKGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAM-VDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSA------GKNGLTPLHVAAHYDNQKVALLLLDKGASPHT-----------TAKNGYTPLHIAAKKNQMDI 637          

HSP 2 Score: 127.872 bits (320), Expect = 5.967e-29
Identity = 131/554 (23.65%), Postives = 238/554 (42.96%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKV--------------------DNELR---TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKA 3287
            G   L  A + G +D+V++LL     V++  + K   TALH +      E+   L+K  A  + +     + +   A+    + +R +     ++  +T         G++P+ IA +    Q++S L+EN++  + +L  L +                    D + +   TPLH      +   A  LL    + +    +NG T LH+A+   N  +V+LL+  GS    +  DG T LH A        +++  +    ++    N G S +H A Q            +   K L  +K  V+ V  D  T L  AA  G     ++LL+  A+ N R  NG + LH A  +    V++L+V   +    + ++ L TP+  A  + H++I+  L++  ++P+  +I+G +  H AA  G  +++  + + G  +  R      PLH A+  GK ++ +LLL  M   +           G TPLH +A     +   +L+  GA+ ++ +K              TPL + S   ++D+ K    ++A
Sbjct:   65 GLNALHLAAKEGHMDLVQELLDRGAPVDS--STKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATED-------GFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKN-GLSPLHMAAQG---------DHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAA------TTNGYTPLHISAREGQLETASVLLEAGASHSLATKK-----------GFTPLHVVSKYGSLDVAKLLLQRQA 580          

HSP 3 Score: 92.4337 bits (228), Expect = 3.648e-18
Identity = 126/525 (24.00%), Postives = 211/525 (40.19%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL------LNKMEECNELELI---------------------NEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILS 3173
            G TPL  A + G    V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D       + +   A            HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      V     TP+H             LL+   S     +  G T LH+A  A   ++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +     EG ++   V+ +   ++            TPL   +  G  D  ++LL+  A  +    NGL+ LH AA   HYD   V  L+++  + P     N   TPL  A     M I   L++  +  N    +G +  H A+ +G+ D+  L+   G  + +   +G   LH AA+  +  V E+L      L+   +     LI                     N   K G TPLH+AA   +  I  +L+  GA  N ++
Sbjct:  292 GLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAH---------CGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQA------VTESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR-----EGQLETASVLLEAGASHSLATK----KGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAA---HYDNQKVALLLLDKGASPHTTAKNGY-TPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVT 784          

HSP 4 Score: 90.1225 bits (222), Expect = 1.906e-17
Identity = 112/489 (22.90%), Postives = 197/489 (40.29%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIE-NESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            NP  +   G T +H++ + N +  +E +  Y    + +++ +E SG TP+  A  +G ++IV  LLQ   + +   +N    T+LH A      E+   LL+N A  D +  +D++ +   +   K   ++++  +      + P     N  GY+P+ I+ +    +  S L+E   S S A            TPLH  V    +    KLL    +      KNG T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +     + Y  ++                         N +     TPL  A+  G  D   +L+   A +N    +GL+ LH AA      V +++V   +  +D +     TPL  A    +  ++ FL++  ++ N +   G +  H AA +G   I++++ + G        NG+  L  A   G   V + L
Sbjct:  383 NPNARALNGFTPLHIACKKNRVKVMELLVKYG---ASIQAVTE-SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--SNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQH-----MAHPDAATTN--GYTPLHISAREGQLETASVLLEAGASHSLATKKGF-------TPLH-VVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAA------------------KKNQMDIATVLLQYGAET-------------------------NALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGAN-LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 5 Score: 79.337 bits (194), Expect = 3.052e-14
Identity = 107/461 (23.21%), Postives = 184/461 (39.91%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEY--------------PKDNF-------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQ---SFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
            +  L + G  + A    G T  H +  +  L+++ + L  G +P + +  GET +H++ R       E +     N +++++ +     TPL  A ++G  +IV+ LLQ   + +A   N Y  T LH +      E  ++LL+  A   +   K  + +  V++Y              P D+        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L++  +++ A      +  +  TPLH          A  LL    + I    K+G T LHLA   + + + ++LV+NG+N   Q   G+T L   +V C                           HY      SFL   G+                +VN    +  TPL  AA  G T    +LL++ A  N    NG + L  A   G+  V+D +
Sbjct:  407 MELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQA---EVVRCLLRNGAMVDARARED-QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN--GYTPLHIAAKKNQMDIATVLLQYGAETNA------LTKQGVTPLHLASQEGHADMA-ALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPL---IVAC---------------------------HYGNAKMVSFLLQNGA----------------SVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 142.895 bits (359), Expect = 1.467e-33
Identity = 148/615 (24.07%), Postives = 268/615 (43.58%), Query Frame = 3
Query: 1416 EDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            E +   +  L + G  +D+    G T  H S L    +++   +  G +   Q   G T ++++ + N L  +  +     N    +S +   G TPL  A+Q G   +V  LL+ +         K +  ALH A   D+ +   LLL+N   +D++     + +   A Y   N   ++ +  ++  F+  +       G +P+ +A K  +  M+  L++  S  +AK        +  TPLH    +      E LL+    L+ +  KNG + LH+A   ++++ V+ L+++ +   D   D  T+LH A  C    +  L      +      N G + +H A +         +  + + +LL     ++  V     TP+  AA +G  +   +LL+N A  +  +  G + LH AA  G  +V+  ++   +M VD       TPL  A  L    I+  L++  ++P+     G +  H +A +G  +   ++ +AG S +L    G  PLH  ++ G  DV +LLL +    +         K G+TPLH AAH ++ K+  LL+ +GA+ +  +K+             TPL +A+    +DI
Sbjct:   90 EGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGN----QSTATEDGFTPLAIALQQGHNQVVSILLENDTK------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-------GITPLHVASKRGNTNMVRLLLDRGSQIDAK------TRDGLTPLHCAARSGHEASVEVLLEKGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACK---------KNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAM-VDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSA------GKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN-----------GYTPLHIAAKKNQMDI 652          

HSP 2 Score: 127.487 bits (319), Expect = 7.585e-29
Identity = 131/554 (23.65%), Postives = 238/554 (42.96%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKV--------------------DNELR---TPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKA 3287
            G   L  A + G +D+V++LL     V++  + K   TALH +      E+   L+K  A  + +     + +   A+    + +R +     ++  +T         G++P+ IA +    Q++S L+EN++  + +L  L +                    D + +   TPLH      +   A  LL    + +    +NG T LH+A+   N  +V+LL+  GS    +  DG T LH A        +++  +    ++    N G S +H A Q            +   K L  +K  V+ V  D  T L  AA  G     ++LL+  A+ N R  NG + LH A  +    V++L+V   +    + ++ L TP+  A  + H++I+  L++  ++P+  +I+G +  H AA  G  +++  + + G  +  R      PLH A+  GK ++ +LLL  M   +           G TPLH +A     +   +L+  GA+ ++ +K              TPL + S   ++D+ K    ++A
Sbjct:   80 GLNALHLAAKEGHMDLVQELLDRGAPVDS--STKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATED-------GFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKN-GLSPLHMAAQG---------DHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGL-TPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAA------TTNGYTPLHISAREGQLETASVLLEAGASHSLATKK-----------GFTPLHVVSKYGSLDVAKLLLQRQA 595          

HSP 3 Score: 92.0485 bits (227), Expect = 4.364e-18
Identity = 126/525 (24.00%), Postives = 211/525 (40.19%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD---VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL------LNKMEECNELELI---------------------NEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILS 3173
            G TPL  A + G    V+ LL+    + A+  N    + LH A   D+ E    LL++KA  D       + +   A            HY  +++      NPN     G++P+ IACK +  +++  L++  +  +A      V     TP+H             LL+   S     +  G T LH+A  A   ++V+ L++NG+    +  +  T LH A     T+++ L  +          N G + +H + +     EG ++   V+ +   ++            TPL   +  G  D  ++LL+  A  +    NGL+ LH AA   HYD   V  L+++  + P     N   TPL  A     M I   L++  +  N    +G +  H A+ +G+ D+  L+   G  + +   +G   LH AA+  +  V E+L      L+   +     LI                     N   K G TPLH+AA   +  I  +L+  GA  N ++
Sbjct:  307 GLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAH---------CGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQA------VTESGLTPIHVAAFMGHLNIVLLLLQNGAS-PDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAR-----EGQLETASVLLEAGASHSLATK----KGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAA---HYDNQKVALLLLDKGASPHTTAKNGY-TPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVT 799          

HSP 4 Score: 89.7373 bits (221), Expect = 2.095e-17
Identity = 112/489 (22.90%), Postives = 197/489 (40.29%), Query Frame = 3
Query: 1560 NPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIE-NESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL 3023
            NP  +   G T +H++ + N +  +E +  Y    + +++ +E SG TP+  A  +G ++IV  LLQ   + +   +N    T+LH A      E+   LL+N A  D +  +D++ +   +   K   ++++  +      + P     N  GY+P+ I+ +    +  S L+E   S S A            TPLH  V    +    KLL    +      KNG T LH+A   +N K+  LL+  G++      +G+T LH A                    K   +     + Y  ++                         N +     TPL  A+  G  D   +L+   A +N    +GL+ LH AA      V +++V   +  +D +     TPL  A    +  ++ FL++  ++ N +   G +  H AA +G   I++++ + G        NG+  L  A   G   V + L
Sbjct:  398 NPNARALNGFTPLHIACKKNRVKVMELLVKYG---ASIQAVTE-SGLTPIHVAAFMGHLNIVLLLLQNGASPDV--SNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQH-----MAHPDAATTN--GYTPLHISAREGQLETASVLLEAGASHSLATKKGF-------TPLH-VVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAA------------------KKNQMDIATVLLQYGAET-------------------------NALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGAN-LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 5 Score: 79.337 bits (194), Expect = 3.588e-14
Identity = 107/461 (23.21%), Postives = 184/461 (39.91%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEY--------------PKDNF-------LRIITHYSSSEIF-------STPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQ---SFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI 2723
            +  L + G  + A    G T  H +  +  L+++ + L  G +P + +  GET +H++ R       E +     N +++++ +     TPL  A ++G  +IV+ LLQ   + +A   N Y  T LH +      E  ++LL+  A   +   K  + +  V++Y              P D+        L +  HY + ++        ++P     N  GY+P+ IA K +   + + L++  +++ A      +  +  TPLH          A  LL    + I    K+G T LHLA   + + + ++LV+NG+N   Q   G+T L   +V C                           HY      SFL   G+                +VN    +  TPL  AA  G T    +LL++ A  N    NG + L  A   G+  V+D +
Sbjct:  422 MELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQA---EVVRCLLRNGAMVDARARED-QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN--GYTPLHIAAKKNQMDIATVLLQYGAETNA------LTKQGVTPLHLASQEGHADMA-ALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPL---IVAC---------------------------HYGNAKMVSFLLQNGA----------------SVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 142.51 bits (358), Expect = 1.606e-33
Identity = 151/595 (25.38%), Postives = 258/595 (43.36%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDL-MALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPN----NPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGAN-----------VNILSKSNQ-----DITKETANLN------LTPLDLASDSLTIDILKDFRGKKA 3287
            G   +HL+ +   + M LE ++    N  VLE+ ++  G T L  A   G   +V +L+    NVNAQ    +  T L+ A   ++ E+   LL+N A   I      + +    +   +N + ++  Y +      P+        +  G++P+ IA    +  +            A+L + +  N+  TPLH    N   +  E LL  + + I  K KNG + +H+A   +++  V+ L++  +   D   D  T LH A  C    +  +             N G + +H A +         +  + +  LL  +  ++  V     TPL  A+ +G  +  +ILL+  A  +  +    + LH A+  GH++V + ++   + PVD +  +  TPL  A  + H  ++  L+E ++NPN     G S  H AA +G+   + L+       T     G  PLH A++ GK DV ELLL +    N         K G+TPLH A H+N+  +  LL+S+G +           ++I +K NQ      + +  A+ N      +TPL LAS     DI+     K+A
Sbjct:   40 GLNALHLASKEGHVKMVLELLH----NGIVLETTTK-KGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGF--TPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNV------------AQLLLNRGANDELTPLHCAARNGHFRIIEILLD-NGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALN-GFTPLHIACK---------KNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQN-AAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAA------GKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQA 597          

HSP 2 Score: 122.479 bits (306), Expect = 2.337e-27
Identity = 141/556 (25.36%), Postives = 229/556 (41.19%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLK--NKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLL--------------------------KLDTSLIGKKDK------NGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDI 3260
            G TPL  A Q   +++VK LL+   N +    + +  T L  AL   +E +  LL+    K K  +    D      V  +     L I  HY +  +     N   N    +P+  A +N  F+++  L++N +  +AK       N L +P+H         C ++LL                          ++   L+ K  K      NGFT LH+A   N+++++ LL+K+ ++ +     G T LH A      +++ +  +              + +H A++S         G   + + L  N   V+    D +TPL  AA +G  +  ++LLE+ A+ N     G S LH AA  GH   + L+++  +    +      TPL  A     + +   L+E+ +NPN     G +  H A      D+++L+   GGS      NG   LH AA+  + +V   LL      N   L      +G+TPLH A+      I  LLIS+ ANVN+ +KS            LTPL L +    + I
Sbjct:  106 GFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGF--TPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTP---LHIAAHYENLNVAQLLLNRGAND-ELTPLHCAARNGHFRIIEILLDNGAPIQAK-----TKNGL-SPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKV-ETPLHMASRS---------GHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGF-TPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESL------QGVTPLHLASQEGRPDIVSLLISKQANVNLGNKS-----------GLTPLHLVAQEGHVGI 621          

HSP 3 Score: 105.145 bits (261), Expect = 4.449e-22
Identity = 114/465 (24.52%), Postives = 195/465 (41.94%), Query Frame = 3
Query: 1584 GETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPI--GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQ---------------DIKGRSVAHCAALKGYCDILDLIR 2927
            G T +H++ + N L  ++ +  +S +   +E+ +E SG TPL  A  +G ++IVK LLQ   + +A  +N    T LH A    + E+   LL+N A  D K   D++ +   A       ++++  + +         NPN+    G+SP+ IA +    Q +  L++ E+         K+  +  TPLH          AE LL+   +      KNG T LH+A   NN+ +V LLV  G +      +G+T+LH A             +   ++   +  HGASA                                N       TPL  A+  G  D   +L+   A++N  + +GL+ LH  A  GH  + D++V   +  V        TPL  A    ++ ++ FL++Q++N N +               + K  +  H     GY  ++D+++
Sbjct:  309 GFTPLHIACKKNHLRVMDLLLKHSAS---IEAVTE-SGLTPLHVASFMGHLNIVKILLQKGASPSA--SNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKA---------NPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQT------KMTKKGFTPLHVASKYGKVDVAELLLERGAN-PNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAA-----------KQNQVEVANSLLQHGASA--------------------------------NAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGAS-VYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHTTPLHTHLWLGYISVIDVLK 707          

HSP 4 Score: 71.633 bits (174), Expect = 7.085e-12
Identity = 67/260 (25.77%), Postives = 118/260 (45.38%), Query Frame = 3
Query: 2562 DSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYD-VIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECN-ELELINEF----NKKGMTPLHKAAHNNHHKICKLLISRGAN-----------------VNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDF 3272
            D+    L AA  G  D     ++N  D+N  + NGL+ LH A+  GH   V++L+ N   +    +  N  T L  A       ++  L+   +N N Q  KG +  + AA + + +++  + + G + ++   +G  PL  A + G  +V  LL++   +    L  + +F    +  G TPLH AAH  +  + +LL++RGAN                 + IL  +   I  +T N  L+P+ +A+    +D +K  
Sbjct:    6 DAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGN--TALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKN-GLSPIHMAAQGDHMDCVKQL 262          

HSP 5 Score: 58.5362 bits (140), Expect = 7.294e-8
Identity = 73/306 (23.86%), Postives = 136/306 (44.44%), Query Frame = 3
Query: 1440 FLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHW 2357
            FL +N   +DA+    +T  H +  +   +L+ + L    NP    + G + +H++ R   +   +T+ L  +     ++     G TPL  A + G VD+ + LL+   N NA   N    T LH A+  +N ++  LL+ +K  S     ++      +A   K N + +    ++S +    S N  +  G +P+ +A +     ++S LI  +    A +N+   +    TPLH          A+ L+K   S+     + G+T LH+A    NIK+V+ L++  +N   +    +   H+
Sbjct:  393 FLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHV---QTVRLLLDM-EAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGL--TPLHVAVHHNNLDVVNLLV-SKGGSPHSAARNGYTALHIAA--KQNQVEV----ANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQ----ANVNL--GNKSGLTPLHLVAQEGHVGIADILVKQGASVYAAT-RMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHY 678          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: invs (inversin [Source:NCBI gene;Acc:101168237])

HSP 1 Score: 132.109 bits (331), Expect = 1.741e-30
Identity = 141/530 (26.60%), Postives = 227/530 (42.83%), Query Frame = 3
Query: 1695 GATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLH---HCVDNSDTKCAEKLLKL--DTSLIGKKDKNGFTVLHLATIANNIKLVQLLVK-NGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQS--------FLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSA--DLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLA 3236
            G TPL+Y V    +D  + LL+   +VN  ++++  R+ALH A    N     LLL  +A    KD +  + +     +P    L ++  +       T   N    + +S        +  + +  LI+++S      N+   D+E + PLH   H  + S T+    +L+     SL+  +D  G T LH A    N  +V++L    G N    DN   T LHWA +     ++ L  + +       D+ GA+ +HY  QS        FLS       P                 D + RT  +WA+  G  D    +LE++   D+N  D  G + LH AA  GH   + L++   +M VD  D    TPLF A  + H  +I  LI+  +  +  D+ G +  H AAL G  ++  ++ + G S  ++++ G  PL  AA  G      +L+    + N    I   +K+G T LH + +N +    KLL+S  A  N +  + +           TPLD A
Sbjct:   47 GRTPLMYCVLADRLDCAEILLKAGASVNKTDHSQ--RSALHLAAQKGNVRFLKLLLSRRANWLQKDLEGMTPLHLATRHPSPKALALLLKHIGPGEVDTQDKNKQTALHWSAFY-----NRPEHVRLLIKHDS------NIGIPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGTIPSDSQGATPLHYGAQSNNAETVGVFLSHPSVKDEP-----------------DLEGRTAFMWASGKGSDDVICTMLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAM-VDALDVMKHTPLFRACEMGHRDVILTLIKGSARVDLVDVDGHTALHWAALGGNAEVCQMLMENGISPNVQDHAGRTPLQCAAYGGYITCMAVLIENHADPN----IQ--DKEGRTALHWSCNNGYLDAVKLLLSYNAFPNHMEHTEE---------RYTPLDYA 530          

HSP 2 Score: 92.8189 bits (229), Expect = 1.914e-18
Identity = 146/596 (24.50%), Postives = 245/596 (41.11%), Query Frame = 3
Query: 1461 DLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLES-PSET-------SGATPLIYAVQIGAVDIVKKLLQL-NVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSL-IGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDN-NLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYC---------DIL--------DLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCEL-LLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANV 3161
            ++D QD   +T  HWS   +  + + + +    N  + DSEG+  +H +    +  A +T+        +LE+ P+E+        G TPL +AV  G   +V+ L      NV A +N    RT LH+A  + + +I  LLL+      I               P D+      HY +       SNN    +G   V ++  +         +++E D E +   +    +          + D  C   +L+ +  + I   DK G T LH A ++ ++  VQLL++ G+     D   HT L  A      D+I    K    +  +  + G +A+H+A         ++ G   + ++L  N  + N  D+  RTPL  AA  G   C  +L+EN AD N +D  G + LH + + G+ D + L+++  + P  +E      TPL YA+   H  +  F++E  +          + +  A  KGY           +L        D  +K      +R     +PL  +A TGK    +L L+N +++   L  ++E  KK     H       HK  K   SR + V
Sbjct:  140 EVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDSEGKIPLHWAAHSQEASATQTVRC------ILEAAPTESLLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDN--LFRTPLHWAALLGHAKIVHLLLERNKSGTI---------------PSDSQGATPLHYGAQ------SNNAET-VG---VFLSHPS---------VKDEPDLEGRTAFMWASGK---------GSDDVICT--MLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAMVDALDVMKHTPLFRACEMGHRDVILTLIKGSARVDLVDVD-GHTALHWA---------ALGGNAEVCQMLMENGISPNVQDHAGRTPLQCAAYGGYITCMAVLIENHADPNIQDKEGRTALHWSCNNGYLDAVKLLLSYNAFPNHMEHTEERYTPLDYALLGGHSEVTQFMLENGALSIAAIQDIAAASIQAVYKGYMVRKAFRERKQLLMRHEQLRKDAAKKREEGQRIRGAVKQVPLSSSASTGKAQQEKLSLVNVLQDLT-LNGLSEETKKRSKAQHSKNKEETHKAHKSKFSRRSKV 671          

HSP 3 Score: 73.559 bits (179), Expect = 1.455e-12
Identity = 70/303 (23.10%), Postives = 131/303 (43.23%), Query Frame = 3
Query: 1455 GCDLDAQDSMGRTFAHW-SIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWA 2360
            GC++ A D++ RT  HW ++L H   +  +        +  DS+G T +H   + N+    ET+ ++ ++PSV + P +  G T  ++A   G+ D++  +L+ N +++    +KY  TALH A    +     LLL+  A  D  D                                         + ++P+  AC+     ++  LI+      A+++++ VD    T LH      + +  + L++   S    +D  G T L  A     I  + +L++N ++   QD +G T+LHW+
Sbjct:  244 GCNVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGTIPSDSQGATPLHYGAQSNN---AETVGVFLSHPSVKDEP-DLEGRTAFMWASGKGSDDVICTMLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAMVDALDV----------------------------------------MKHTPLFRACEMGHRDVILTLIKG----SARVDLVDVDGH--TALHWAALGGNAEVCQMLMENGIS-PNVQDHAGRTPLQCAAYGGYITCMAVLIENHADPNIQDKEGRTALHWS 495          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000048145.1 (SMESG000048145.1)

HSP 1 Score: 1957.18 bits (5069), Expect = 0.000e+0
Identity = 1101/1110 (99.19%), Postives = 1106/1110 (99.64%), Query Frame = 3
Query: 1224 MEIAAREILESGNVQAFEEFLLLNSEKINIQFTFDEGSTFPIILIQTFRKAESLTVDRSQGPIIEDYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATELKVESLSENYPINNSNDKDQSSANNLSVEVLXXXXXXXXXXXXXNHLFIXXXXXXXXXXXXXXEIRRPLSSKTLKVNLSFSKTIRSIKSTNNMDRMHGPIKSTKLITNRIRSTNENKTPLKTTSXXXXXXXXXXXXXXKMPSKYQSNPMENEGIVTYERQPNEERCESNLSDNHIYIAKANGNNVTGNENKETETIPEKAIIEDLGKFSLNATKPISKEEIIENPANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPEMIENGISIKATSYNSLCQDXXXXXXXXXXXXXXXCRKTQKSKSTELSSRVVESVRQYENIREKVKSITEQRRMELFQGYSKTLKINKVQARKSIKSAKVSKTFEPNANHINLPDVALFENSPTLHSTHSSKKNRSFPSAINKNDQIRSAYDCGSVNLLPLF 4553
            MEIAAREILESGNVQAFEEFLLLNSEKINIQFTFDEGSTFPIILIQTFRKAESLTVDRSQGPIIEDYKHCLNFLFENGCDLDAQDSMGRTFAHWSILLHCLDLLAVALGLGCNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDN DTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATDLIDLFFKIDPDIIKIIDNHGASAIHYATQSFLSPEGSVQGPIVIEKLLKNNKENVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSK NQDITKETAN NLTPLDLASDSLTIDILKDFRGKKATELKVESLSENYPINNSNDK+Q+SANNLSVEVLTKTEESKSDEKEKNHLFIKKNSKLLKSPSKNSEI+RP+SSKTLKVNLSFSKTIRSIKSTNNMDRMHGPIKSTKLITNRIRSTNENKTPLKTTSINVNNLENNVTINNKMPSKYQSNPMENEGIVTYERQPNEER ESNLSDNHIYIAKANGNNVTGNENKETETIPEKAIIEDLGKFSLNATKPISKEEIIENPANTSVSLTSLKSKTSKDSKTKSRTKSAKPKSEPEMIENGISIKATSYNSLCQDSNNTTSSSISSHISNCRKTQKSKSTELSSRVVESVRQYENIREKVKSITEQRRMELFQGYSKTLKI+KVQARKSIKSAKVSKTFEPNANHINLPDVALFENSPTLHSTHSSKKNRSFPSAINKNDQIRSAYDCGSVNLLPLF
Sbjct:    1 MEIAAREILESGNVQAFEEFLLLNSEKINIQFTFDEGSTFPIILIQTFRKAESLTVDRSQGPIIEDYKHCLNFLFENGCDLDAQDSMGRTFAHWSILLHCLDLLAVALGLGCNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNPDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATDLIDLFFKIDPDIIKIIDNHGASAIHYATQSFLSPEGSVQGPIVIEKLLKNNKENVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKPNQDITKETANFNLTPLDLASDSLTIDILKDFRGKKATELKVESLSENYPINNSNDKNQTSANNLSVEVLTKTEESKSDEKEKNHLFIKKNSKLLKSPSKNSEIKRPISSKTLKVNLSFSKTIRSIKSTNNMDRMHGPIKSTKLITNRIRSTNENKTPLKTTSINVNNLENNVTINNKMPSKYQSNPMENEGIVTYERQPNEERSESNLSDNHIYIAKANGNNVTGNENKETETIPEKAIIEDLGKFSLNATKPISKEEIIENPANTSVSLTSLKSKTSKDSKTKSRTKSAKPKSEPEMIENGISIKATSYNSLCQDSNNTTSSSISSHISNCRKTQKSKSTELSSRVVESVRQYENIREKVKSITEQRRMELFQGYSKTLKIDKVQARKSIKSAKVSKTFEPNANHINLPDVALFENSPTLHSTHSSKKNRSFPSAINKNDQIRSAYDCGSVNLLPLF 1110          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000013802.1 (SMESG000013802.1)

HSP 1 Score: 160.999 bits (406), Expect = 2.021e-39
Identity = 124/428 (28.97%), Postives = 220/428 (51.40%), Query Frame = 3
Query: 2019 GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNE-LELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNI-LSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATEL 3296
             Y  ++ ACK  + + +  L+EN +D     ++       +T LH+C       CAE +L +   L+   +KNG+TVLHLA++      ++ L+    +   ++ND  +SL  AV+    + + L  + + ++     N G S +HYA +     E   +  + I  +L  +  +++ +D   R+PL+WA         + L+E  A +  +D +GLS+LH A S G+ ++I +++  +   ++  D+N CT L YA +  ++ ++  L+E+ SN N +D K R+  H A+ KG    L ++ +   +L   NN+ + PLHEA+  G  ++ E L+  ME   + L  IN  N  G T LH +   ++ +ICK+L+  GA+ NI L  SN          ++T LDLA+ + T  ++  F GK + +L
Sbjct:    3 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTD-----KTLLHYCFKYES--CAELILSVAPELLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVN-GVSPMHYAAKVKACLE--CENELEIINILLKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLEDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKLLNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGK--------SMTALDLANKNETKLLIVKFNGKSSDDL 412          

HSP 2 Score: 151.754 bits (382), Expect = 1.430e-36
Identity = 137/457 (29.98%), Postives = 226/457 (49.45%), Query Frame = 3
Query: 2031 VIIACKNSDFQMLSDLIENESD-SEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVV---CCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATELKVESLSENYPINNSNDK-DQSSANNLSVEVL 3386
            +  +C+  +F+++   I +  + SE +      D   +T LH+ + N +    E +LK    L+ K D+   T+LH+  ++  I+ + LL+KN +N    D +G T+LH AV+     A + ++ +       I+I DN G   +HYA +     + SV       +LL     ++ C D  SRTPLL A ++   +  + LL+N A+   RD   L  +H   S G+ ++ + +    +   ++ D N  TP+FYAV+  +  I+  LIE  +  +  D  GR++ H AA KG    L+L+   G     + ++G +PLHEAA  G  ++ E+LLN     + +E +NE N  G T LH AA  N   +C LLIS+ + +N L  +  D      N  LT  DLA+     + LK F G+ A ++          IN SN + D S+  N  +E++
Sbjct:  633 LFASCRIGNFEIVCSFIHDGGEVSEIR------DQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALHLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIE-ICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTP---SAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSD------NEELTAYDLATTPDCKNTLKTFGGRSAKKV----------INCSNSELDYSTQYNAEIELV 1061          

HSP 3 Score: 77.0258 bits (188), Expect = 1.095e-13
Identity = 76/275 (27.64%), Postives = 125/275 (45.45%), Query Frame = 3
Query: 1575 DSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVD--------IVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGS---NTKDQDNDGHTSLHWAVV 2366
            D  G T +HL++ YN+L ALE +N Y  + +      + SG  PL YA++I             ++ LL++N ++  ++  +  RT L  A+ +++ E    LLKN A    +D ++   +  V     +  L I    +  E F     +PN   G +P+  A  N + +++  LIE      AKL++  VD   RT  H   +    KC E LL        K   +G   LH A      ++ ++L+   S   N  +++N G T+LH A V
Sbjct:  725 DGNGRTALHLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRD--RVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVC---SEGNLEIFNQLAVFENFDPNVTDPN---GLTPIFYAVSNCNEKIVKRLIE----LNAKLDI--VDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKC-HDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 984          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 124.79 bits (312), Expect = 3.246e-28
Identity = 130/582 (22.34%), Postives = 267/582 (45.88%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKS 3179
            L  L  N CD+DA+D  G+   H++I     +++ + +   C+   +D  G+  +H + + +     E + +  NN   +++  + +G  P+ YA+  G  ++V+ L+    +++A +    +   +HYA+   N E+  +L+ NK     +D K    I    +  K   ++I+ + +  +I +   +      G  P+  +    + +M+  LI N+ D  A      +D + + P+H+  +    +  + L+  +   I  +D+ G   +H A      ++VQ+L+ N  +   +D DG   +H+A+       +      +   +   D  G   IHYA +          G   I ++L NNK ++N  D D + P+ +A   G  +  QIL+ N  DL   D  G   +H A   G  +++ +++N     ++  D +   P+ YA+   +  ++  LI  + +    D  G+   H A   G  +I+ ++      +  R+ +G  P+H A + GK ++ +LL+N   +C+    IN  ++ G  P+H A +  + ++ ++LI+   ++N L K+
Sbjct:  984 LKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGD---KPEIVQILINNKCDIDA-RDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQ--PIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILIN-NKCDIDACDRD------GKQPIHYSMDRGNPEMVQILINNKCDINA------LDKDGKQPIHYACERGKPEIVQILIN-NKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAID-RGNPEMVQILINNKCDLVACDRLGKQPIHYACKG---------GKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINN-KCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINN--KCD----INARDEDGKQPIHYAINRGNPEMVQILINNKCDINALDKT 1528          

HSP 2 Score: 119.398 bits (298), Expect = 1.365e-26
Identity = 131/579 (22.63%), Postives = 257/579 (44.39%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCC--ATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            L  L  N CD+DA+D  G+   H++I     +++ + +   C+   +D   +  +H + +       E + L  NN   + +        P+ YA + G  ++++ L+    ++NA++    +   +HYA      E+  +L+ NK   D +D   K  I    +      + I+       I +    +  + +G  P+  ACK    +++  LI N+ D +A+      D   + P+H+ +D  + +  + L+  +   I   D+     +H A    N ++VQ+L+ N  +   +D      +H+A   C      I      +   I   D  G   IHY+     +PE  VQ  I+I     NNK ++N +D D + P+ +A   G  +  QIL+ N  D+N RD  G   +H A   G  +++ +++N     ++  D +   P+ YA+   +  ++  LI  + +    D  G+   H A   G  +I+ ++      +  R+ +G  P+H A + G  ++ ++L+N     N+ +L+   ++ G  P+H A      +I ++LI+   ++N
Sbjct:  852 LQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGG---KPELLQLLINNKCDINARDRLD-KQPIHYACKGGKPELLQLLINNKCDINARDREWMQ--PIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEIL-------INNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDAR------DRAGKQPIHYAIDRGNPEMVQILIN-NKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYA---CKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRG-NPE-MVQ--ILI-----NNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINN-KCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN-----NKCDLV-ACDRLGKQPIHYACKGGKPEIVQILINNKCDIN 1391          

HSP 3 Score: 119.398 bits (298), Expect = 1.550e-26
Identity = 133/591 (22.50%), Postives = 253/591 (42.81%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKA--------AHNNHHKICKLLISRGANVNI 3167
            D    +  L  N CD+DA+D  G+   H++I     +++ + +   C+    D E    +H +I   D    E + +  NN   + +  E     P+ YA + G  +IV+ L+    +++A + +   +  +HY++   N E+  +L+ NK   +  D   K  I    E  K   ++I+       I +    N  + +G  P+  ACK    +++  LI N+ D  A+      D + + P+H+ +D  + +  + L+     L+   D+ G   +H A      ++VQ+L+ N  +   +D DG   +H+A+                       + G                    P +++ L+ N  + V C D   + P+ +A   G  +  QIL+ N  D+N RD +G   +H A  RG+ +++ +++N     V   D     P+ YA       I+  LI  + + + +D  G+   H A   G  +++ L+      +  R+ +G  P+H A   G  ++ ++L+N   +C+    IN  +K G + L+ A        +H+N  +  K +IS G   N+
Sbjct: 1045 DKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAI---DRGNPEMVQILINNKCDIHARDE-KWMQPIHYACKDGKPEIVQILINNKCDIDACDRDG--KQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQIL-------INNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINAR------DEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAI-----------------------DRG-------------------NPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARDEDGKQPIHYAINRGNPEMVQILINN--KCD----INALDKTGFSHLNYAKGLLADLKSHSNIERE-KCIISHGQGRNL 1564          

HSP 4 Score: 112.464 bits (280), Expect = 1.636e-24
Identity = 112/493 (22.72%), Postives = 216/493 (43.81%), Query Frame = 3
Query: 1686 ETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            +  G  P+ YA+  G  + V+ L+    ++NA +  K+ +  +HYA    N E+  +L+ NK   D +D   K  I           ++I+       I +    N  + +   P+  ACK    ++L  LI N+ D  A+      D   + P+H+       +  + L+  +   I  +D+     +H A      +L+++L+ N  +   +D DG   +H+A+       I      +   I   D  G   IHYA +    PE        I ++L NNK +++  D   + P+ +A   G  +  QIL+ N  D++  D   +  +H A  RG+ +++ +++N     +   D     P+ YA       I+  LI  + + +  D  G+   H +  +G  +++ ++      +   + +G  P+H A E GK ++ ++L+N   +C+    IN  ++ G  P+H A      +I ++LI+   ++N
Sbjct:  800 DEDGKHPIHYAIDRGNPETVQILINNKCDINALD--KWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQIL-------INNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINAR------DRLDKQPIHYACKGGKPELLQLLIN-NKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAID-RGNPEIVEILINNKCDIDARDWLGKQPIHYACKGD-KPE--------IVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINN-KCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINN--KCD----INARDELGKQPIHYACKGGKPEIVQILINNKCDIN 1259          

HSP 5 Score: 90.5077 bits (223), Expect = 9.392e-18
Identity = 87/380 (22.89%), Postives = 182/380 (47.89%), Query Frame = 3
Query: 2046 KNSDFQMLSDLIENESDSE----AKLNML-KVDNELRTPLHHCVDNSDTKCAEKLL--KLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            K+S  ++L D+ ++ES  +    A+ +++ + D + + P+H+ +D  + +  + L+  K D + +   DK G   +H A  A N +L+Q+L+ N  +   +D DG   +H+A+       +      +   I   D      IHYA +          G   + +LL NNK ++N  D   + P+ +A   G  +  Q+L+ N  D+N RD   +  +H A   G  +++ +++N     +D  D +   P+ YA+   +  I+  LI  + + + +D  G+   H A      +I+ ++      +  R+  G  P+H A + G  ++ ++L+N   +C+    I+  +++ M P+H A    + ++ ++LI+   +++
Sbjct:  768 KSSQLKLLVDISQSESTEDFINYAQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINAL---DKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINR-GNPEMVQILINNKCDINARDWLDKQPIHYACKG---------GKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINN-KCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINN--KCD----IDACDREWMQPIHYAIDRGNPEMVQILINNKCDIH 1127          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 119.783 bits (299), Expect = 9.934e-27
Identity = 133/605 (21.98%), Postives = 265/605 (43.80%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIIT-----------------HYS----SSEIFSTPSNN-----PNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCC--ATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            +  L  N CD++A D  G+   H++      +LL + +   C+   +D +G+  +H +I   +    E + +  NN   + +  +     P+ YA + G  ++++ L+    ++NA++  +  +  +HYA      E+  LL+ NK   + +D +    I    +  K   L+I+                  HY+    + EI     NN       + +G  P+  ACK    +++  LI N+ D +A+      D   + P+H+ +D  + +  + L+  +   I   D+     +H A    N ++VQ+L+ N  +   +D      +H+A   C      I      +   I   D  G   IHY+           +G   + ++L NNK ++N +D D + P+ +A   G  +  QIL+ N  D+N RD  G   +H A   G  +++ +++N     ++  D +   P+ YA+   +  ++  LI  + +    D  G+   H A   G  +I+ ++      +  R+ +G  P+H A + G  ++ ++L+N     N+ +L+   ++ G  P+H A      +I ++LI+   ++N
Sbjct:  819 VQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNP---EMVQILINNKCDINA-RDWLDKQPIHYACKGGKPELLQLLINNKCDINARD--RLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDAR------DRAGKQPIHYAIDRGNPEMVQILIN-NKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYA---CKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMD---------RGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINN-KCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN-----NKCDLV-ACDRLGKQPIHYACKGGKPEIVQILINNKCDIN 1391          

HSP 2 Score: 112.464 bits (280), Expect = 1.938e-24
Identity = 112/493 (22.72%), Postives = 218/493 (44.22%), Query Frame = 3
Query: 1686 ETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            +  G  P+ YA+  G  + V+ L+    ++NA +  K+ +  +HYA    N E+  +L+ NK   D +D   K  I           ++I+ + +  +I      N  + +   P+  ACK    ++L  LI N+ D  A+      D   + P+H+       +  + L+  +   I  +D+     +H A      +L+++L+ N  +   +D DG   +H+A+       I      +   I   D  G   IHYA +    PE        I ++L NNK +++  D   + P+ +A   G  +  QIL+ N  D++  D   +  +H A  RG+ +++ +++N     +   D     P+ YA       I+  LI  + + +  D  G+   H +  +G  +++ ++      +   + +G  P+H A E GK ++ ++L+N   +C+    IN  ++ G  P+H A      +I ++LI+   ++N
Sbjct:  800 DEDGKHPIHYAIDRGNPETVQILINNKCDINALD--KWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILIN-NKCDI------NARDWLDKQPIHYACKGGKPELLQLLINNKCDINAR------DRLDKQPIHYACKGGKPELLQLLIN-NKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAID-RGNPEIVEILINNKCDIDARDWLGKQPIHYACKGD-KPE--------IVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINN-KCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINN--KCD----INARDELGKQPIHYACKGGKPEIVQILINNKCDIN 1259          

HSP 3 Score: 104.76 bits (260), Expect = 4.002e-22
Identity = 120/534 (22.47%), Postives = 230/534 (43.07%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNH--GASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLN 3029
            L  L  N CD++A+D + +   H++      +LL + +   C+   +D E    +H + +       E + +  NN   +++  E  G  P+ YA+  G  +IV+ L+    +++A++     +  +HYA   D  EI  +L+ NK   D +D   K  I    +      ++I+ +                PI Y     A    + +M+  LI N+ D  A+      D +   P+H+   +   +  + L+  +   I   D++G   +H +    N ++VQ+L+ N  +    D DG   +H+A   C     ++   +  +   I      G   IHYA +          G   I ++L NNK ++N  D D + P+ +A   G  +  QIL+ N  DL   D  G   +H A   G  +++ +++N     ++  D +   P+ YA+   +  ++  LI  + +    D  G+   H A   G  +I+ ++      +  R+ +G  P+H A + G  ++ ++L+N
Sbjct:  918 LQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGG---KPELLKILINNKCDIDARDE-DGKQPIHYAIDRGNPEIVEILINNKCDIDARD--WLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCD--IDACDREWMQPIHY-----AIDRGNPEMVQILINNKCDIHAR------DEKWMQPIHYACKDGKPEIVQILIN-NKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYA---CERGKPEIVQILINNKCDINARDELGKQPIHYACKG---------GKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINN-KCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN 1418          

HSP 4 Score: 92.8189 bits (229), Expect = 1.834e-18
Identity = 97/437 (22.20%), Postives = 189/437 (43.25%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVN 2729
            D    +  L  N CD+DA+D  G+   H++I     +++ + +   C+    D E    +H +I   D    E + +  NN   + +  E     P+ YA + G  +IV+ L+    +++A + +   +  +HY++   N E+  +L+ NK   +  D   K  I    E  K   ++I+ + +  +I      N  + +G  P+  ACK    +++  LI N+ D  A+      D + + P+H+ +D  + +  + L+     L+   D+ G   +H A      ++VQ+L+ N  +   +D DG   +H+A+                       + G                    P +++ L+ N  + V C D   + P+ +A   G  +  QIL+ N  D+N RD +G   +H A  RG+ +++ +++N
Sbjct: 1045 DKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAI---DRGNPEMVQILINNKCDIHARDE-KWMQPIHYACKDGKPEIVQILINNKCDIDACDRDG--KQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILIN-NKCDI------NARDELGKQPIHYACKGGKPEIVQILINNKCDINAR------DEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAI-----------------------DRG-------------------NPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN 1418          

HSP 5 Score: 82.4185 bits (202), Expect = 2.415e-15
Identity = 83/389 (21.34%), Postives = 174/389 (44.73%), Query Frame = 3
Query: 2019 GYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKSNQ 3185
            G  P+  ACK  + ++L  LI N+ D +A+      D + + P+H+ ++  + +  + L+  +   I  +D      +H A      +L+QLL+ N  +   +D      +H+A        +      +   I   D      IHYA +          G   + K+L NNK +++  D D + P+ +A   G  +  +IL+ N  D++ RD  G   +H A      +++ +++N     +D  D     P+ YA+   +  ++  LI  + + +  D +     H A  +G  +++ ++      +  R+     P+H A + GK ++ ++L+N   +C+    I+  ++ G  P+H +    + ++ ++LI+   ++N L K  +
Sbjct:  836 GKQPIHYACKAGNPELLQILINNKCDIDAR------DRDGKQPIHYAINRGNPEMVQILIN-NKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKG-GKPELLQLLINNKCDINARDREWMQPIHYACKG---------GKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINN-KCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINN--KCD----IDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGK 1200          

HSP 6 Score: 73.559 bits (179), Expect = 1.272e-12
Identity = 51/207 (24.64%), Postives = 101/207 (48.79%), Query Frame = 3
Query: 2544 VNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            +N  D D + P+ +A   G  +  QIL+ N  D+N  D  G   +H A   G+ +++ +++N     +D  D +   P+ YA+   +  ++  LI  + + N +D   +   H A   G  ++L L+      +  R+     P+H A + GK ++ +LL+N   +C+    IN  +++ M P+H A      ++ K+LI+   +++
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINN-KCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINN--KCD----INARDREWMQPIHYACKGGKPELLKILINNKCDID 995          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 119.398 bits (298), Expect = 1.514e-26
Identity = 128/579 (22.11%), Postives = 258/579 (44.56%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCC--ATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            L  L  N CD+DA+D  G+   H++I     +++ + +   C+   +D   +  +H + +       E + L  NN   + +        P+ YA + G  ++++ L+    ++NA++    +   +HYA      E+  +L+ NK   D +D   K  I    +      + I+ + +  +I      +  + +G  P+  ACK    +++  LI N+ D +A+      D   + P+H+ +D  + +  + L+  +   I   D+     +H A    N ++VQ+L+ N  +   +D      +H+A   C      I      +   I   D  G   IHY+     +PE        + ++L NNK ++N +D D + P+ +A   G  +  QIL+ N  D+N RD  G   +H A   G  +++ +++N     ++  D +   P+ YA+   +  ++  LI  + +    D  G+   H A   G  +I+ ++      +  R+ +G  P+H A + G  ++ ++L+N     N+ +L+   ++ G  P+H A      +I ++LI+   ++N
Sbjct:  852 LQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGG---KPELLQLLINNKCDINARDRLD-KQPIHYACKGGKPELLQLLINNKCDINARDREWMQ--PIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILIN-NKCDI------DARDWLGKQPIHYACKGDKPEIVQILINNKCDIDAR------DRAGKQPIHYAIDRGNPEMVQILIN-NKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYA---CKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRG-NPE--------MVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINN-KCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN-----NKCDLV-ACDRLGKQPIHYACKGGKPEIVQILINNKCDIN 1391          

HSP 2 Score: 117.472 bits (293), Expect = 5.164e-26
Identity = 139/605 (22.98%), Postives = 262/605 (43.31%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIIT-----------------HYS----SSEIFSTPSNN-----PNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLL--KLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            L  L  N CD++A+D + +   H++      +LL + +   C+   +D E    +H + +       E + +  NN   +++  E  G  P+ YA+  G  +IV+ L+    +++A++     +  +HYA   D  EI  +L+ NK   D +D   K  I    +      ++I+                  HY+    + E+     NN       +     P+  ACK+   +++  LI N+ D +A       D + + P+H+ +D  + +  + L+  K D + +   DK+G   +H A      ++VQ+L+ N  +   +D  G   +H+A        I      +   I   D  G   IHYA             P +++ L+ N  + V C D   + P+ +A   G  +  QIL+ N  D+N RD +G   +H A  RG+ +++ +++N     V   D     P+ YA       I+  LI  + + N +D  G+   H A  +G  +++ ++      L   +  G  P+H A + GK ++ ++L+N   +C+    I+  +  G  P+H A      ++ +LLI+   ++N
Sbjct:  918 LQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGG---KPELLKILINNKCDIDARDE-DGKQPIHYAIDRGNPEIVEILINNKCDIDARD--WLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDA------CDRDGKQPIHYSMDRGNPEMVQILINNKCDINAL---DKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKG-GKPEIVQILINNKCDINARDEDGKQPIHYAIDR--------GNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINN--KCD----IHARDWDGKQPIHYACKGGKPELIQLLINNKCDIN 1490          

HSP 3 Score: 112.464 bits (280), Expect = 1.629e-24
Identity = 112/493 (22.72%), Postives = 218/493 (44.22%), Query Frame = 3
Query: 1686 ETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            +  G  P+ YA+  G  + V+ L+    ++NA +  K+ +  +HYA    N E+  +L+ NK   D +D   K  I           ++I+ + +  +I      N  + +   P+  ACK    ++L  LI N+ D  A+      D   + P+H+       +  + L+  +   I  +D+     +H A      +L+++L+ N  +   +D DG   +H+A+       I      +   I   D  G   IHYA +    PE        I ++L NNK +++  D   + P+ +A   G  +  QIL+ N  D++  D   +  +H A  RG+ +++ +++N     +   D     P+ YA       I+  LI  + + +  D  G+   H +  +G  +++ ++      +   + +G  P+H A E GK ++ ++L+N   +C+    IN  ++ G  P+H A      +I ++LI+   ++N
Sbjct:  800 DEDGKHPIHYAIDRGNPETVQILINNKCDINALD--KWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILIN-NKCDI------NARDWLDKQPIHYACKGGKPELLQLLINNKCDINAR------DRLDKQPIHYACKGGKPELLQLLIN-NKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAID-RGNPEIVEILINNKCDIDARDWLGKQPIHYACKGD-KPE--------IVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINN-KCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINN--KCD----INARDELGKQPIHYACKGGKPEIVQILINNKCDIN 1259          

HSP 4 Score: 101.679 bits (252), Expect = 3.826e-21
Identity = 111/502 (22.11%), Postives = 214/502 (42.63%), Query Frame = 3
Query: 1419 DYKHCLNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLI 2924
            D    +  L  N CD+DA+D  G+   H++I     +++ + +   C+    D E    +H +I   D    E + +  NN   + +  E     P+ YA + G  +IV+ L+    +++A + +   +  +HY++   N E+  +L+ NK   +  D   K  I    E  K   ++I+ + +  +I      N  + +G  P+  ACK    +++  LI N+ D  A+      D + + P+H+ +D  + +  + L+     L+   D+ G   +H A      ++VQ+L+ N  +   +D DG   +H+A+                       + G                    P +++ L+ N  + V C D   + P+ +A   G  +  QIL+ N  D+N RD +G   +H A  RG+ +++ +++N     V   D     P+ YA       I+  LI  + + + +D  G+   H A   G  +++ L+
Sbjct: 1045 DKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAI---DRGNPEMVQILINNKCDIHARDE-KWMQPIHYACKDGKPEIVQILINNKCDIDACDRDG--KQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILIN-NKCDI------NARDELGKQPIHYACKGGKPEIVQILINNKCDINAR------DEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAI-----------------------DRG-------------------NPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLL 1482          

HSP 5 Score: 85.8853 bits (211), Expect = 2.452e-16
Identity = 91/408 (22.30%), Postives = 179/408 (43.87%), Query Frame = 3
Query: 1434 LNFLFENGCDLDAQDSMGRTFAHWSIXXXXXXXXXXXXXXXXNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATXXXXXXXXXXXXXXXXXXNHGASAIHYATQSFLSPEGSVQGPIVIXXXXXXXXXXVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRD 2657
            +  L  N CD+ A+D       H++      +++ + +   C+    D +G+  +H S+   D    E + +  NN   + +  +  G  P+ YA + G  +IV+ L+    ++NA++  +  +  +HYA      EI  +L+ NK   + +D   K  I    +      ++I+ +     +         + +G  P+  ACK    +++  LI N+ D  A+      D + + P+H+ +D  + +  + L+     L+   D+ G   +H A      ++VQ+L+ N  +   +D DG   +H+A+       +      +   +   D  G   IHYA +          G   I ++L NNK +++  D+D + P+ +A   G  +  Q+L+ N  D+N RD
Sbjct: 1116 VQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSM---DRGNPEMVQILINNKCDINA-LDKDGKQPIHYACERGKPEIVQILINNKCDINARD--ELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-------DRLGKQPIHYACKGGKPEIVQILINNKCDINAR------DEDGKQPIHYAIDRGNPEMVQILINNKCDLVAC-DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDR-GNPEMVQILINNKCDLVACDRLGKQPIHYACKG---------GKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARD 1493          

HSP 6 Score: 73.9442 bits (180), Expect = 1.129e-12
Identity = 51/207 (24.64%), Postives = 101/207 (48.79%), Query Frame = 3
Query: 2544 VNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVN 3164
            +N  D D + P+ +A   G  +  QIL+ N  D+N  D  G   +H A   G+ +++ +++N     +D  D +   P+ YA+   +  ++  LI  + + N +D   +   H A   G  ++L L+      +  R+     P+H A + GK ++ +LL+N   +C+    IN  +++ M P+H A      ++ K+LI+   +++
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINN-KCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINN--KCD----INARDREWMQPIHYACKGGKPELLKILINNKCDID 995          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK37.567e-3725.37ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK31.229e-3625.37ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK31.894e-3625.69ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK23.383e-3424.55ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK23.613e-3424.55ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphp-21.948e-4131.03NePHronoPhthisis (Human kidney disease) homolog [... [more]
nphp-22.152e-4131.03NePHronoPhthisis (Human kidney disease) homolog [... [more]
unc-441.518e-2822.86AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.518e-2822.86AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.672e-2822.86AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG425345.452e-6133.26gene:FBgn0260487 transcript:FBtr0300898[more]
CG425349.770e-6033.80gene:FBgn0260487 transcript:FBtr0309307[more]
Ank3.471e-3127.01gene:FBgn0011747 transcript:FBtr0089172[more]
Ank3.471e-3127.01gene:FBgn0011747 transcript:FBtr0300497[more]
Ank3.471e-3127.01gene:FBgn0011747 transcript:FBtr0089171[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX469921.17.712e-3625.23ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a9.510e-3625.23ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a9.510e-3625.23ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank1b3.119e-3525.90ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b5.048e-3525.90ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm41.006e-3424.60tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
ANK21.069e-3425.37ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.344e-3425.37ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.363e-3425.37ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.823e-3425.37ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank34.538e-3825.53ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank34.965e-3825.53ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank34.965e-3825.53ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank35.675e-3825.53ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank35.760e-3825.53ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE3.473e-3725.53Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|O70511|ANK3_RAT1.170e-3626.11Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q12955|ANK3_HUMAN9.095e-3625.69Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|Q8UVC1|INVS_DANRE8.504e-3026.40Inversin OS=Danio rerio OX=7955 GN=invs PE=2 SV=1[more]
sp|Q01484|ANK2_HUMAN3.181e-2925.09Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F3S61.492e-13236.59ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GYS01.233e-12736.38ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A210QD202.779e-8535.65Serine/threonine-protein phosphatase 6 regulatory ... [more]
W4YGJ73.043e-7630.74ANK_REP_REGION domain-containing protein OS=Strong... [more]
A0A2T7P0373.313e-7535.81ANK_REP_REGION domain-containing protein OS=Pomace... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b1.157e-3525.50ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ENSAMXT00000017800.21.523e-3424.68pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
invs1.492e-3127.38inversin [Source:NCBI gene;Acc:103026533][more]
ank1b6.974e-3124.81ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a7.040e-2823.42ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.13.475e-3624.46pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.15.855e-3525.08pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
invs4.463e-2927.13inversin [Source:NCBI gene;Acc:245946][more]
invs8.271e-2826.95inversin [Source:NCBI gene;Acc:245946][more]
ENSPMAT00000007446.13.848e-2726.54pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
NAS63.227e-822.42Evolutionarily conserved 19S regulatory particle a... [more]
HOS42.847e-728.70Subunit of the Set3 complex; complex is a meiotic-... [more]
AVO22.102e-629.66Component of a complex containing the Tor2p kinase... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494855.072e-1428.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387023.338e-1322.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359101.893e-1127.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445832.337e-1132.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391138.803e-1129.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b3.229e-3425.25ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000039458.19.657e-3424.23ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.11.467e-3324.07ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1a1.606e-3325.38ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
invs1.741e-3026.60inversin [Source:NCBI gene;Acc:101168237][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048145.10.000e+099.19SMESG000048145.1[more]
SMESG000013802.12.021e-3928.97SMESG000013802.1[more]
SMESG000032664.13.246e-2822.34SMESG000032664.1[more]
SMESG000032664.19.934e-2721.98SMESG000032664.1[more]
SMESG000032664.11.514e-2622.11SMESG000032664.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033117 ID=SMED30033117|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4592bp
AAAAATTATTAAATCACAAAATACTCTTGTACCCGATAGGAATGTATGTT
GGTTTATCACAAATATTTTTAAAAAAGTGAATTCGAATAATGGTTCTTTT
ACTTTTCATCAGCTAAAAATATTAAACATTTAAATCAAAACTTCATGAAT
GTGAACATTTTTAATTCCACACTTGACAGATACAAATTGAATTATTCTTT
ATAAATAATCCTGATCCACATCGTTCGAAGTAATTCATGACTTTTTATGT
CAAAAATATCCTGGTTTTCCATATAACATGAAATTAATCTTTGGATGTCA
AAGTATCAATCTTGTTAACAACAATTCAAACCACAATTCCACCGCTAATG
TATCATCCAATAAAAAATTGATTCGGCACTTTCTATACAAAGGATTTCAT
TGGTCCATTACCAGTTGAAAATCGGTTCGCATATCCTCTCAGCTTAATCA
TCAGAAAATCCTGATAGTTCTATGAAGTTTTTTAAAAATGGATTTCATTC
TCCTCGGTTAGCACATTTCACAAACGTCATCCTTCCCCCTTGTCACACAA
TCAAATAAATACCTGATCTAGATTTCATTTTAGTGTTATTCAATATAATG
CGGATCCTGATACGAATGGGCCTAGCAAAATAAATATACATTTTACAGTT
ATTTTTTTATTATTATCACTTTTTATTATTATAGTTTAATACTATTATTA
TTATTATTGACAAAATGTCAAATTCCTAAAAATAATCATCATGCTCCTCA
AATAATTCACCTGTGATATTTGACCGCATTTCCAATCAAATATAATAAAA
TTCAGTAAGTATCAATTCAAGAAGTTACAAAAAATTAAATTTAATTATAC
AAATAACATGGAAAATTCATCAATATTTAAAAAAACATTGGAAAAAGAAG
AAAATTCACGAAATTGTTACAAATCTTTCTCAAATTTGTTACAAAACTTC
CATTTCACCGCCAGCGACAGCTGCATTCCAGAGTTGTTACAGTGCTGTGT
TAATGTAGCAAATCTATTTCCAATCTGAAATCTGATTCGTTGATTTACTT
ATCCAAACCTTAACAACCGTTTCTAAGAAGTGATTTCTGAATCGGGATTG
GCGAATTCTCAATGTATCATAATTTAAAATTCCAATTCTAGTCTATTTTT
ACATTTAACAGTAGTAAAGAATTTCAAAAAATTTTTACTCAGTGTGACTT
AAATTGATTTTCGCTTTTCGTCAATGGAAATTGCTGCTAGAGAAATTCTG
GAATCGGGAAATGTTCAGGCGTTTGAGGAGTTTCTATTACTCAATTCCGA
AAAAATCAATATACAATTTACCTTTGACGAAGGTTCGACATTCCCGATAA
TTCTAATTCAGACCTTTCGGAAAGCAGAATCATTAACCGTCGATCGTTCA
CAAGGGCCAATAATCGAGGATTACAAGCATTGCTTGAATTTTTTATTCGA
AAACGGATGCGATTTGGATGCACAAGATAGCATGGGAAGAACGTTCGCAC
ATTGGTCGATTTTGTTGCATTGTTTGGATCTGTTAGCGGTGGCCTTAGGA
TTAGGATGTAATCCAATGTTGCAGGATTCAGAAGGAGAAACGATAATGCA
TTTGTCAATTAGATACAATGATTTAATGGCTTTGGAAACGATAAATCTCT
ACTCAAACAACCCTAGTGTACTTGAGAGTCCCTCGGAAACTAGTGGTGCT
ACACCATTGATTTATGCGGTTCAAATCGGGGCTGTGGACATCGTGAAAAA
ACTTCTTCAACTAAACGTAAATGTTAATGCCCAAGAAAACAACAAATACA
AACGAACAGCTTTGCATTATGCTCTATTCATAGACAATGAAGAAATTTTC
ACTCTTTTGTTGAAAAATAAGGCCAAATCAGATATTAAAGATTATAAAGA
TAAGAGTGTCATTGATCGAGTTGCGGAATACCCAAAGGATAATTTCCTCA
GAATAATTACCCATTATTCCAGTTCAGAAATCTTTTCGACTCCATCAAAT
AATCCGAACAATCCGATTGGTTATTCTCCAGTAATTATCGCGTGTAAAAA
TTCCGATTTCCAAATGCTTTCTGATTTGATTGAAAATGAATCCGATTCCG
AAGCGAAATTGAATATGTTAAAAGTCGACAATGAACTCAGAACTCCATTG
CACCATTGCGTGGATAACTCTGATACTAAATGCGCAGAAAAACTATTGAA
ATTGGACACTAGCTTAATCGGAAAAAAGGATAAAAACGGATTTACTGTAC
TCCATTTAGCTACGATTGCAAACAACATAAAGCTGGTTCAGCTTTTGGTC
AAAAATGGATCTAATACAAAAGATCAAGACAACGACGGACACACGAGTCT
TCATTGGGCGGTTGTGTGTTGTGCGACAGATCTTATTGATTTGTTTTTTA
AAATTGATCCAGATATTATCAAAATAATCGATAATCACGGTGCTTCGGCA
ATCCATTATGCCACACAATCATTTTTGAGTCCAGAAGGTTCCGTACAAGG
TCCCATTGTTATTGAAAAGCTATTGAAAAACAACAAGGAAAATGTAAATT
GTGTTGATTACGATAGTAGAACTCCTTTATTATGGGCAGCAAGTTTAGGA
ATTACCGATTGTTGTCAAATTTTGTTGGAAAATAGCGCAGATCTCAATCA
TAGAGATTGCAATGGTTTGTCCGTGTTGCACTGTGCAGCTAGCCGAGGAC
ATTACGATGTAATAGATTTGATAGTAAACACATGGTCAATGCCAGTAGAT
ATTGAAGACAATAATTTGTGTACTCCATTATTTTATGCAGTTACTCTCAA
ACACATGTCTATTATTCATTTTTTAATTGAGCAGAGAAGCAACCCTAATC
AACAAGACATTAAAGGTCGAAGTGTTGCACATTGTGCTGCTTTAAAAGGT
TACTGTGATATTTTAGATTTAATCAGAAAAGCAGGTGGGTCTTTAACTTT
GAGGAATAATAATGGAGATCTACCATTACACGAAGCCGCAGAAACGGGGA
AGTTTGACGTATGTGAATTGTTGTTAAATAAGATGGAGGAATGTAATGAA
TTAGAATTAATTAACGAGTTTAACAAAAAAGGAATGACCCCTCTACATAA
AGCTGCTCATAATAATCATCACAAAATCTGTAAACTTCTCATAAGCCGAG
GTGCTAATGTAAACATCTTGTCAAAATCAAATCAAGATATTACAAAAGAA
ACTGCAAATTTAAATTTAACTCCTTTGGATCTAGCATCTGATTCGTTGAC
AATTGATATACTAAAAGATTTTCGTGGGAAAAAGGCTACAGAACTTAAAG
TAGAATCTTTATCAGAAAATTACCCAATAAACAACTCAAACGACAAAGAT
CAAAGTTCCGCAAATAACCTTTCTGTAGAAGTCTTAACAAAGACAGAAGA
ATCAAAATCAGATGAAAAAGAAAAAAATCATTTATTTATTAAAAAGAATA
GTAAGTTATTAAAATCCCCATCAAAAAATTCCGAAATCAGAAGACCTCTA
TCGTCTAAAACATTAAAAGTCAATCTTTCGTTTTCCAAAACTATCAGAAG
TATAAAATCGACCAATAACATGGACAGAATGCATGGGCCTATTAAAAGTA
CCAAACTTATAACAAATCGAATTAGAAGCACAAATGAAAATAAAACTCCT
TTGAAAACAACCTCCATAAATGTCAATAATTTAGAAAATAATGTAACCAT
CAATAATAAAATGCCCTCCAAATATCAATCAAATCCAATGGAAAATGAAG
GTATTGTGACATATGAAAGGCAACCCAATGAAGAACGTTGTGAATCAAAT
TTATCAGATAACCATATTTATATAGCAAAAGCAAATGGCAATAATGTTAC
AGGAAATGAAAATAAAGAAACAGAAACCATTCCTGAAAAGGCTATTATTG
AAGACCTTGGAAAATTTAGTCTAAATGCAACAAAACCAATAAGTAAAGAA
GAAATAATTGAAAATCCAGCAAATACATCTGTATCCCTAACATCATTGAA
ATCAAAAACTTCAAAAGACTCGAAAACTAAATCAAGAACCAAATCGGCTA
AACCAAAATCAGAACCAGAAATGATTGAAAACGGAATAAGTATCAAAGCA
ACGTCATACAACAGCTTGTGCCAAGACTCAAATAACACCACCAGTAGCAG
CATCAGCAGTCACATATCCAACTGTAGGAAAACTCAAAAATCAAAATCAA
CTGAATTAAGCTCGAGAGTAGTCGAGAGCGTCCGACAATACGAAAACATT
CGCGAGAAAGTCAAATCAATCACTGAACAAAGAAGAATGGAATTGTTTCA
AGGTTATAGCAAAACTTTAAAAATTAATAAAGTTCAAGCAAGAAAATCCA
TAAAATCTGCTAAAGTTAGCAAAACGTTCGAACCCAATGCGAACCATATC
AACTTACCGGATGTGGCGTTATTCGAAAATTCTCCAACATTGCATAGCAC
TCATTCCTCCAAAAAAAACCGGTCATTTCCTTCAGCAATCAATAAAAATG
ATCAGATCAGATCAGCATATGATTGTGGTTCAGTAAACTTATTACCTCTT
TTTTAATTTCACTTTCATCAATATATATTATTTTCTCTCGTC
back to top

protein sequence of SMED30033117-orf-1

>SMED30033117-orf-1 ID=SMED30033117-orf-1|Name=SMED30033117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1111bp
MEIAAREILESGNVQAFEEFLLLNSEKINIQFTFDEGSTFPIILIQTFRK
AESLTVDRSQGPIIEDYKHCLNFLFENGCDLDAQDSMGRTFAHWSILLHC
LDLLAVALGLGCNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVL
ESPSETSGATPLIYAVQIGAVDIVKKLLQLNVNVNAQENNKYKRTALHYA
LFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSS
SEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLK
VDNELRTPLHHCVDNSDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIAN
NIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATDLIDLFFKIDPDIIK
IIDNHGASAIHYATQSFLSPEGSVQGPIVIEKLLKNNKENVNCVDYDSRT
PLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLI
VNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRS
VAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELL
LNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILS
KSNQDITKETANLNLTPLDLASDSLTIDILKDFRGKKATELKVESLSENY
PINNSNDKDQSSANNLSVEVLTKTEESKSDEKEKNHLFIKKNSKLLKSPS
KNSEIRRPLSSKTLKVNLSFSKTIRSIKSTNNMDRMHGPIKSTKLITNRI
RSTNENKTPLKTTSINVNNLENNVTINNKMPSKYQSNPMENEGIVTYERQ
PNEERCESNLSDNHIYIAKANGNNVTGNENKETETIPEKAIIEDLGKFSL
NATKPISKEEIIENPANTSVSLTSLKSKTSKDSKTKSRTKSAKPKSEPEM
IENGISIKATSYNSLCQDSNNTTSSSISSHISNCRKTQKSKSTELSSRVV
ESVRQYENIREKVKSITEQRRMELFQGYSKTLKINKVQARKSIKSAKVSK
TFEPNANHINLPDVALFENSPTLHSTHSSKKNRSFPSAINKNDQIRSAYD
CGSVNLLPLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016491oxidoreductase activity
GO:00324402-alkenal reductase [NAD(P)] activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 481..496
score: 36.48
coord: 635..649
score: 39.55
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 338..367
e-value: 0.0022
score: 27.3
coord: 663..693
e-value: 1400.0
score: 4.0
coord: 580..609
e-value: 0.0044
score: 26.2
coord: 547..576
e-value: 8.5
score: 15.3
coord: 157..186
e-value: 9.8E-4
score: 28.4
coord: 480..512
e-value: 8.5
score: 15.3
coord: 371..400
e-value: 30.0
score: 13.5
coord: 192..223
e-value: 0.078
score: 22.1
coord: 447..476
e-value: 0.98
score: 18.4
coord: 304..334
e-value: 54.0
score: 12.7
coord: 619..648
e-value: 2.0E-7
score: 40.7
coord: 265..294
e-value: 270.0
score: 9.2
coord: 120..149
e-value: 640.0
score: 6.4
coord: 514..543
e-value: 0.044
score: 22.9
coord: 87..116
e-value: 2900.0
score: 1.6
coord: 405..443
e-value: 180.0
score: 10.5
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 516..545
e-value: 2.8E-4
score: 21.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 619..651
score: 14.212
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 580..612
score: 9.19
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 338..370
score: 12.342
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 447..479
score: 10.099
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 157..189
score: 11.594
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 192..224
score: 9.164
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 257..418
e-value: 1.5E-27
score: 98.3
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 609..693
e-value: 1.7E-11
score: 46.1
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 419..608
e-value: 1.7E-45
score: 157.1
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 59..256
e-value: 7.2E-31
score: 109.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 66..247
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 258..512
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 432..653
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 154..223
e-value: 5.9E-9
score: 36.4
coord: 553..648
e-value: 3.7E-13
score: 49.9
coord: 320..396
e-value: 2.0E-9
score: 37.9
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 71..651
score: 93.382
NoneNo IPR availablePFAMPF13637Ank_4coord: 449..499
e-value: 5.4E-9
score: 36.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 921..949
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 929..947
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 723..740
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 723..757
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 69..234
coord: 263..501
coord: 429..933