Rhophilin-2-like Protein

Overview
NameRhophilin-2-like Protein
Smed IDSMED30033108
Length (bp)2194
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rhophilin-2-like Protein (SMED30033108) t-SNE clustered cells

Violin plots show distribution of expression levels for Rhophilin-2-like Protein (SMED30033108) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rhophilin-2-like Protein (SMED30033108) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rhophilin-2-like Protein (SMED30033108) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033108

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033108SMESG000022872.1 Contig49558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033108SMESG000022872.1 Contig49558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30033108SMESG000022872.1 dd_Smed_v4_6255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rhophilin-2-like Protein vs. Ensembl Human
Match: RHPN2 (rhophilin Rho GTPase binding protein 2 [Source:HGNC Symbol;Acc:HGNC:19974])

HSP 1 Score: 258.07 bits (658), Expect = 3.302e-75
Identity = 160/559 (28.62%), Postives = 295/559 (52.77%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQII----SQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N + QT RSKL   R  +N++I K +RM++GA NL+++  + +++ ++ +E+ F  S+L++ KEELE  N ++  YQ+ +    +P+IP+ +K T D+DF    ++ +  HY ED   Y + I  +   R+A + P R   G+   + Y+  +  +E RFF P R  G++F+W D  TGVP  Q+  + EK+ ++FN GALY+Q+ +   + TQAGLE + + F  +    N+L   F + PS DM P ML +L  +M  QA E  F  +    +  + F  ++  +   E+  +  +++ ++++++   ++  E+IP +W +L  VK+++Y ALA+   A   I   +    D++ QE  +  L   + + + P    L    +  +   L K  +  A+   EES++ A++ K LR++  L   L    +    +L      E  DLL+     ++A + V        II    S+   +D F+ LGP+ +F++  +  P R +    ++    GFT++G  P++V  ++   +A  +G + GD+++S+   D +W
Sbjct:   26 NPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNSKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQNTEEAFTIPLIPLGLKETKDVDFAVVLKDFILEHYSEDGYLYEDEIADLMDLRQACRTPSRDEAGVELLMTYFIQLGFVESRFFPPTRQMGLLFTWYDSLTGVPVSQQNLLLEKASVLFNTGALYTQIGTRCDRQTQAGLESAIDAFQRAAGVLNYLKDTFTHTPSYDMSPAMLSVLVKMMLAQAQESVFEKISLPGIRNEFFMLVKVAQ---EAAKVGEVYQQLHAAMSQAPVK--ENIPYSWASLACVKAHHYAALAHYFTAILLIDHQVKPGTDLDHQEKCLSQLYDHMPEGLTP----LATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQER--SRLTYAQHQEEDDLLNL----IDAPSVVAKTEQEVDIILPQFSKLTVTDFFQKLGPLSVFSANKRWTPPRSIRFTAEEG-DLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKW 568          
BLAST of Rhophilin-2-like Protein vs. Ensembl Human
Match: RHPN1 (rhophilin Rho GTPase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:19973])

HSP 1 Score: 233.032 bits (593), Expect = 3.966e-66
Identity = 163/578 (28.20%), Postives = 291/578 (50.35%), Query Frame = 1
Query:  139 RDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDT--YQDLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFX--XXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLH---LPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMK---IGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLR-WSSQEVLVQITA 1836
            R +  + + Q Q  +L   R +I+++I+K+L+M++GA NL   T + R++  + +E+ +  SNL+L KEELE  +  +D   +      +PMIP+ +K T ++D+    + ++  H+GED   Y   I  + + R+A++ P R+  G+     YYN +  ++ RF  P RS G+ F W D  TGVP QQR   FEK  ++FN+GAL++Q+ +   ++   G   +   F  +   F+ L  NF + PS DM    L  L  LM  QA EC F           +D  + LR   L  E+  ++  +  V+ ++    +   +++P +W  LV VK+ Y+++LA+  +A          D +     E  + E   L  PT        LP    E   L K  +  A+   EE+++L A+ + LR ++ L   ++   +  + +   L++ + + +    P++Q   +T    ++   + +SQ    D F  LGP+ +F+++ +   +GP   V + R +  GFG T++G  P+ +  V   S A  +GLK GD+++S++    R W   EV+ ++ A
Sbjct:   18 RLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQMRTGAENLYRATSNNRVRETVALELSYVNSNLQLLKEELEELSGGVDPGRHGSEAVTVPMIPLGLKETKELDWSTPLKELISVHFGEDGASYEAEIRELEALRQAMRTPSRNESGLELLTAYYNQLCFLDARFLTPARSLGLFFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCLAQLR---LAQEAAQVAAEYRLVHRTMAQPPVH--DYVPVSWTALVHVKAEYFRSLAHYHVAMALC------DGSPATEGELPTHEQVFLQPPTSSKPRGPVLPQELEERRQLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAKYAELDREDDFCEAAEAPDIQ--PKTHQKPEARMPR-LSQGKGPDIFHRLGPLSVFSAKNRWRLVGP---VHLTRGEG-GFGLTLRGDSPVLIAAVIPGSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTELKA 577          
BLAST of Rhophilin-2-like Protein vs. Ensembl Human
Match: PTPN23 (protein tyrosine phosphatase non-receptor type 23 [Source:HGNC Symbol;Acc:HGNC:14406])

HSP 1 Score: 89.3521 bits (220), Expect = 1.673e-17
Identity = 69/278 (24.82%), Postives = 131/278 (47.12%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKY---IEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRF-FFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQE 1218
            +PMI + +K   D  F+ + +  +  +YGE+P+ Y   ++ +EL+  R+ A++ PR   EG      Y   +++++ R      +   +  +W ++F+G         +E++ I++NLGAL+S L +   + ++ G++ S  +F  +   F +L  +F    SVDM  ++L +  NLM  QA EC           +    N ++  +   S  +   ++    +L N +    L  I + W  LVQ+K  Y+ A+A         +L M K    Q+
Sbjct:    7 MPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELL--RQNAVRVPR-DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLL--------EKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVA---------HLHMGKQAEEQQ 264          
BLAST of Rhophilin-2-like Protein vs. Ensembl Human
Match: PDCD6IP (programmed cell death 6 interacting protein [Source:HGNC Symbol;Acc:HGNC:8766])

HSP 1 Score: 80.1073 bits (196), Expect = 1.102e-15
Identity = 53/194 (27.32%), Postives = 92/194 (47.42%), Query Frame = 1
Query:  406 MIPIAMKNTVDIDFKNSFRNILENHY---GEDPDKYIEAIE-LVNSRRKAIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-------TGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNP----PSVDMKPEMLQMLANLMRVQAME 939
             I + +K T ++D        ++  Y   GE+  +Y  A E L   RR A+  P   +EG ++ +L YY+ I  IE +F F +    + F+W D F         V     +  +EKS ++FN  AL SQ+A+  +     GL+ +  ++  +   F H+    ++     P+VD+ P+ +  L+ +M  QA E
Sbjct:    4 FISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQE 197          
BLAST of Rhophilin-2-like Protein vs. Ensembl Human
Match: PDCD6IP (programmed cell death 6 interacting protein [Source:HGNC Symbol;Acc:HGNC:8766])

HSP 1 Score: 78.1814 bits (191), Expect = 3.111e-14
Identity = 54/196 (27.55%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  409 IPIAMKNTVDIDFKNSFRNILENHY---GEDPDKYIEAIE-LVNSRRKAIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-------TGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNP----PSVDMKPEMLQMLANLMRVQAMECKF 948
            I + +K T ++D        ++  Y   GE+  +Y  A E L   RR A+  P   +EG ++ +L YY+ I  IE +F F +    + F+W D F         V     +  +EKS ++FN  AL SQ+A+  +     GL+ +  ++  +   F H+    ++     P+VD+ P+ +  L+ +M  QA E  F
Sbjct:    5 ISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFF 200          
BLAST of Rhophilin-2-like Protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 71.2478 bits (173), Expect = 1.866e-12
Identity = 64/261 (24.52%), Postives = 119/261 (45.59%), Query Frame = 1
Query:  421 MKNTVDIDFKNSFRNILENHYGEDPD---KYIEAIELVNS-RRKAIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-TGVPFQQRTSV------FEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVN----PPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALA 1155
            +K+T ++D      + ++N Y    +      EA++ +N  R KA   P   ++  +D +  YY+ +  IE +       N ++F W D F  G  F  R S+      FE++ ++FN+G+L SQ+ +     T   ++ S   F  S   F  L    +      P+ D+ P+ L  L+ LM  QA E  +     +K  +DK   ++A  +V  S  ++  +      ++ ++++ L    + W  +V  K+  Y+ALA
Sbjct:   11 LKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIY-----IKGHKDK---MKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWD--KDWSAIVSGKNLAYQALA 261          
BLAST of Rhophilin-2-like Protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 71.2478 bits (173), Expect = 2.069e-12
Identity = 64/261 (24.52%), Postives = 119/261 (45.59%), Query Frame = 1
Query:  421 MKNTVDIDFKNSFRNILENHYGEDPD---KYIEAIELVNS-RRKAIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-TGVPFQQRTSV------FEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVN----PPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALA 1155
            +K+T ++D      + ++N Y    +      EA++ +N  R KA   P   ++  +D +  YY+ +  IE +       N ++F W D F  G  F  R S+      FE++ ++FN+G+L SQ+ +     T   ++ S   F  S   F  L    +      P+ D+ P+ L  L+ LM  QA E  +     +K  +DK   ++A  +V  S  ++  +      ++ ++++ L    + W  +V  K+  Y+ALA
Sbjct:   11 LKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIY-----IKGHKDK---MKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWD--KDWSAIVSGKNLAYQALA 261          
BLAST of Rhophilin-2-like Protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 70.8626 bits (172), Expect = 2.550e-12
Identity = 64/261 (24.52%), Postives = 119/261 (45.59%), Query Frame = 1
Query:  421 MKNTVDIDFKNSFRNILENHYGEDPD---KYIEAIELVNS-RRKAIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-TGVPFQQRTSV------FEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVN----PPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALA 1155
            +K+T ++D      + ++N Y    +      EA++ +N  R KA   P   ++  +D +  YY+ +  IE +       N ++F W D F  G  F  R S+      FE++ ++FN+G+L SQ+ +     T   ++ S   F  S   F  L    +      P+ D+ P+ L  L+ LM  QA E  +     +K  +DK   ++A  +V  S  ++  +      ++ ++++ L    + W  +V  K+  Y+ALA
Sbjct:   11 LKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIY-----IKGHKDK---MKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWD--KDWSAIVSGKNLAYQALA 261          
BLAST of Rhophilin-2-like Protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 70.8626 bits (172), Expect = 2.550e-12
Identity = 64/261 (24.52%), Postives = 119/261 (45.59%), Query Frame = 1
Query:  421 MKNTVDIDFKNSFRNILENHYGEDPD---KYIEAIELVNS-RRKAIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-TGVPFQQRTSV------FEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVN----PPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALA 1155
            +K+T ++D      + ++N Y    +      EA++ +N  R KA   P   ++  +D +  YY+ +  IE +       N ++F W D F  G  F  R S+      FE++ ++FN+G+L SQ+ +     T   ++ S   F  S   F  L    +      P+ D+ P+ L  L+ LM  QA E  +     +K  +DK   ++A  +V  S  ++  +      ++ ++++ L    + W  +V  K+  Y+ALA
Sbjct:   11 LKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIY-----IKGHKDK---MKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWD--KDWSAIVSGKNLAYQALA 261          
BLAST of Rhophilin-2-like Protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 68.1662 bits (165), Expect = 1.054e-11
Identity = 64/261 (24.52%), Postives = 119/261 (45.59%), Query Frame = 1
Query:  421 MKNTVDIDFKNSFRNILENHYGEDPD---KYIEAIELVNS-RRKAIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-TGVPFQQRTSV------FEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVN----PPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALA 1155
            +K+T ++D      + ++N Y    +      EA++ +N  R KA   P   ++  +D +  YY+ +  IE +       N ++F W D F  G  F  R S+      FE++ ++FN+G+L SQ+ +     T   ++ S   F  S   F  L    +      P+ D+ P+ L  L+ LM  QA E  +     +K  +DK   ++A  +V  S  ++  +      ++ ++++ L    + W  +V  K+  Y+ALA
Sbjct:   11 LKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIY-----IKGHKDK---MKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWD--KDWSAIVSGKNLAYQALA 261          
BLAST of Rhophilin-2-like Protein vs. Ensembl Fly
Match: Rhp (gene:FBgn0026374 transcript:FBtr0074095)

HSP 1 Score: 300.442 bits (768), Expect = 4.315e-91
Identity = 203/614 (33.06%), Postives = 315/614 (51.30%), Query Frame = 1
Query:  169 TQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRAL-ELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIY---LFMSKDVN-SQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLH------SLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKL---------------------------------GFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKC-SLIKLTVTT 1869
            T RSKL   R K+N++INK+LR+++GA NL + T +++++  + +E+ F  SNL+L KE+L   N +++ YQ       +PMIP+ +K T +I+F   F + +  HY E+P  YI+AI  +   R+A + P R   G+     YYN + ++E+RFF PDR+ G+ F W D  TGVP  QRT  FEK+  +FNLG +Y+Q+ +   +TT+ GL+ + + FL +   F H+   F N PS+D+KP++L +L +LM  QA EC F        +E    + +A  +L GE+  IS  +  ++   NI+      ++P+ W  LV VK+  YKA A+   A        L  SK    +QE+    S E+++ I    Y     +S   A  L+ L   EAL  IEE+ +L  M ++L+N   L+  +   H    ++L       S    E  DLL   E  VEA +     SL     + +   DPFK LGPI IF++R      R V + +   L                                  FGF V+G  P+ + +VE NS A+  G+K GDF++ +   D++W S + +VQ+   C S ++L V T
Sbjct:   41 TCRSKLQNRRCKLNKEINKELRLRAGAENLYKATSNRKLRDTVALELSFVNSNLQLLKEQLAELNSSVEIYQSESHNGIMPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTGVPSCQRTIAFEKACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLVSLMLSQARECLF--EKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHK--NIQANDTHTYLPECWAGLVPVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQEVER-ITTADYGASDEASTSIANKLAHL--KEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRLQASAKNIEDGDLL---ERSVEA-SSKFTLSLTGPDFTSHKVKDPFKRLGPIAIFSARRHWTAPRCVRLQKGSSLYHSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSLADLGGIKEGDFIVEIAGVDVKWYSHQQVVQLIQSCGSTLELRVIT 643          
BLAST of Rhophilin-2-like Protein vs. Ensembl Fly
Match: Rhp (gene:FBgn0026374 transcript:FBtr0074096)

HSP 1 Score: 300.442 bits (768), Expect = 4.315e-91
Identity = 203/614 (33.06%), Postives = 315/614 (51.30%), Query Frame = 1
Query:  169 TQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRAL-ELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIY---LFMSKDVN-SQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLH------SLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKL---------------------------------GFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKC-SLIKLTVTT 1869
            T RSKL   R K+N++INK+LR+++GA NL + T +++++  + +E+ F  SNL+L KE+L   N +++ YQ       +PMIP+ +K T +I+F   F + +  HY E+P  YI+AI  +   R+A + P R   G+     YYN + ++E+RFF PDR+ G+ F W D  TGVP  QRT  FEK+  +FNLG +Y+Q+ +   +TT+ GL+ + + FL +   F H+   F N PS+D+KP++L +L +LM  QA EC F        +E    + +A  +L GE+  IS  +  ++   NI+      ++P+ W  LV VK+  YKA A+   A        L  SK    +QE+    S E+++ I    Y     +S   A  L+ L   EAL  IEE+ +L  M ++L+N   L+  +   H    ++L       S    E  DLL   E  VEA +     SL     + +   DPFK LGPI IF++R      R V + +   L                                  FGF V+G  P+ + +VE NS A+  G+K GDF++ +   D++W S + +VQ+   C S ++L V T
Sbjct:   41 TCRSKLQNRRCKLNKEINKELRLRAGAENLYKATSNRKLRDTVALELSFVNSNLQLLKEQLAELNSSVEIYQSESHNGIMPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTGVPSCQRTIAFEKACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLVSLMLSQARECLF--EKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHK--NIQANDTHTYLPECWAGLVPVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQEVER-ITTADYGASDEASTSIANKLAHL--KEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRLQASAKNIEDGDLL---ERSVEA-SSKFTLSLTGPDFTSHKVKDPFKRLGPIAIFSARRHWTAPRCVRLQKGSSLYHSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSLADLGGIKEGDFIVEIAGVDVKWYSHQQVVQLIQSCGSTLELRVIT 643          
BLAST of Rhophilin-2-like Protein vs. Ensembl Fly
Match: mop (gene:FBgn0036448 transcript:FBtr0075700)

HSP 1 Score: 54.6842 bits (130), Expect = 3.779e-7
Identity = 39/185 (21.08%), Postives = 85/185 (45.95%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFS--WNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNF--VNPPSVDMKPEMLQMLANLMRVQAMEC 942
            L M+  A+K++ +     + +  +   Y EDP+ Y + +  + + R    +  +    ++    YY  ++ ++ RF  P  ++  IF+  W D++     +     FE++ ++FN+ AL++Q  +  ++    G++ +  +F  +   +  L   +  VN     M PE+L     +   QA EC
Sbjct:    7 LHMLWFALKSSPEGTSFAALKKYIAEFYHEDPEAYSKEVHALETLRNQAMHTTKDGAPVMKR--YYCQLHALQNRF--PQLADRGIFTFKWKDLYHSAVHEVTDLRFERAAVLFNIAALHTQSGASVTRGDVDGMKMACTHFQAAAWAYGELRERYANVNGGGDFMTPELLVFQQQVCFAQAQEC 187          
BLAST of Rhophilin-2-like Protein vs. Ensembl Zebrafish
Match: rhpn1 (rhophilin, Rho GTPase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-081031-79])

HSP 1 Score: 278.1 bits (710), Expect = 4.430e-83
Identity = 186/606 (30.69%), Postives = 327/606 (53.96%), Query Frame = 1
Query:  160 IFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGL--PMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLI-----KPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGV-INQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKC--SLIKLTVTTITEMGLTRNHTFSTSAPFDLNKSSQ 1944
            +  TQRSKL + R K+N++IN++L ++SGA NL   + ++++K  + +E+ F  SNL+L KEELE  N +++ YQ     L  PMIP+ +K T +ID     ++ +  HYGED   Y+  I+     R+A++ P R+  G    + Y+N +  +++RFF P RS G+ F W D  TGVP  QR   FEK  ++FN+GALY+Q+ +   ++T +G+E++ + F  +   F +L  NF + PS+DM    L ML  LM  Q  EC  +    L  ++D   N+  L+   E+  +S ++  V  ++++ LL+  +++P +WI++VQVK+++++ALA+   A   + L     V  ++  ED  AE+K L+     +P K +L  P  K     L K  + +A+   EE+++L  + K LR ++ L   L++ H   +++   +++ + + ++   PE+Q   +    I    F+ +      +D F  LGP+ +F++R +    R V ++R +  G G T++G  P+ V  V     A   GL+ GD++++++  D RW+    +V     C    ++L + T+    + R    S S   D    SQ
Sbjct:   28 LVSTQRSKLQQRRAKLNQQINRELLLRSGAENLYRASTNQKVKETVALELSFVNSNLQLLKEELEELNSSMNIYQTESETLNVPMIPLGLKETKEIDMTVPLQDFIAEHYGEDASLYLNEIQDFMELRQAMRTPSRNEAGQELLMEYFNQLYFLDQRFFSPHRSLGVHFHWYDSLTGVPSVQRALAFEKGSVLFNIGALYTQIGARQDRSTLSGIEDAIDAFQRAAGAFLYLQENFSHAPSLDMSGSALSMLVRLMVAQVQEC--VCEKVLLNIQDIHLNV-LLQAAQEAARVSDVYSLVLQAMSVPLLK--DYVPFSWISMVQVKTHHFRALAHYYTA---VALCDCSGVGDED--ED-GAEIKALVQIHTRQPEKLNLQDPEDKRR---LGKAHLRKAIIRHEEALRLHGVCKMLRKMDILQEVLSDAHTRSLEKYSDIDQEDDFCEVAEAPEVQSHTQQKPDIKAPDFSVVRV----TDIFHRLGPLSVFSARNRW-TRRHVCLVRGEA-GLGLTLRGDSPVLVAGVLPGGCA-AGGLREGDYIVAVNSVDCRWAEHAEVVHALKSCPDRGLELDIITLQTHEVERRMNLSPSGEQDYQSGSQ 612          
BLAST of Rhophilin-2-like Protein vs. Ensembl Zebrafish
Match: rhpn1 (rhophilin, Rho GTPase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-081031-79])

HSP 1 Score: 276.559 bits (706), Expect = 1.363e-82
Identity = 178/581 (30.64%), Postives = 315/581 (54.22%), Query Frame = 1
Query:  160 IFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGL--PMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLI-----KPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGV-INQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTIT 1875
            +  TQRSKL + R K+N++IN++L ++SGA NL   + ++++K  + +E+ F  SNL+L KEELE  N +++ YQ     L  PMIP+ +K T +ID     ++ +  HYGED   Y+  I+     R+A++ P R+  G    + Y+N +  +++RFF P RS G+ F W D  TGVP  QR   FEK  ++FN+GALY+Q+ +   ++T +G+E++ + F  +   F +L  NF + PS+DM    L ML  LM  Q  EC  +    L  ++D   N+  L+   E+  +S ++  V  ++++ LL+  +++P +WI++VQVK+++++ALA+   A           V   +   +  AE+K L+     +P K +L  P  K     L K  + +A+   EE+++L  + K LR ++ L   L++ H   +++   +++ + + ++   PE+Q   +    I    F+ +      +D F  LGP+ +F++R +    R V ++R +  G G T++G  P+ V  V     A + GL+ GD++++++  D RW+    +V     C    L +  IT
Sbjct:   28 LVSTQRSKLQQRRAKLNQQINRELLLRSGAENLYRASTNQKVKETVALELSFVNSNLQLLKEELEELNSSMNIYQTESETLNVPMIPLGLKETKEIDMTVPLQDFIAEHYGEDASLYLNEIQDFMELRQAMRTPSRNEAGQELLMEYFNQLYFLDQRFFSPHRSLGVHFHWYDSLTGVPSVQRALAFEKGSVLFNIGALYTQIGARQDRSTLSGIEDAIDAFQRAAGAFLYLQENFSHAPSLDMSGSALSMLVRLMVAQVQEC--VCEKVLLNIQDIHLNV-LLQAAQEAARVSDVYSLVLQAMSVPLLK--DYVPFSWISMVQVKTHHFRALAHYYTA-----------VALCDCSGNYGAEIKALVQIHTRQPEKLNLQDPEDKRR---LGKAHLRKAIIRHEEALRLHGVCKMLRKMDILQEVLSDAHTRSLEKYSDIDQEDDFCEVAEAPEVQSHTQQKPDIKAPDFSVVRV----TDIFHRLGPLSVFSARNRW-TRRHVCLVRGEA-GLGLTLRGDSPVLVAGVLPGGCAAEGGLREGDYIVAVNSVDCRWAEHAEVVHALKSCPDRGLELDIIT 583          
BLAST of Rhophilin-2-like Protein vs. Ensembl Zebrafish
Match: rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:NCBI gene;Acc:321330])

HSP 1 Score: 261.922 bits (668), Expect = 8.252e-77
Identity = 166/563 (29.48%), Postives = 297/563 (52.75%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLK--TGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-------DLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMK-IGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N   QT RSKL   R  +N+KI K +RM++GA NL++ T + +++ ++ +E+ +  S+L+L  E+LE  N +++ YQ+++  + +P+IP+ +K T D+DF    ++ +  HY ED   +   I+ +   R+A + P R+N G+     Y++ ++ +E RFF P R  GI F+W D FTG+P  Q     EK+ ++FN+ ALYSQ+ +   + T AGLE++   F  S    + L   F + PS DM P ML ML  LM  QA EC F  +    +  + F     L++  E+  ++  +  V+ S+ IE     +++P  W  + Q+K N+Y +LA+  ++   +   L  S D + QE A+  L   + +   P    L +  +K E   + K  +  ++   EE+I+     ++L+ L+ LS+ L       + +    +K + +       D++S  E + E       +   T         D F+ LGP+ +F+++ +   P  I +I++D+ L  GFT+KG  P+++ +++    A   GLK GD+++++ D D +W
Sbjct:   26 NPFAQTGRSKLQNKRAVLNQKIIKQMRMRAGAENLLKATSNNKVREQVVLELSYVNSDLQLLMEQLEGLNSSVEVYQNVQESSSIPLIPLGLKETKDVDFSVPLKDFILEHYSEDGSNFQNQIDDLMDLRQACRTPSRNNSGVDLIANYFSQLSFLETRFFSPTRQIGIFFTWYDSFTGMPVCQNNISLEKASMLFNMAALYSQIGTRADRQTLAGLEDAIAAFQKSAGVLHLLKETFTHTPSYDMSPAMLSMLFRLMLAQAQECLFEQITLPGIRNEFFC---LLKMAQEAAKVAETYAQVHQSM-IE-TPITKNVPFFWTTMSQLKINHYNSLAHYFVSTALLDHQLNPSDDEDKQEKALSQLYDAMPEGRSP----LDILKNKDERRRIGKAHLQRSIMGHEEAIRTHCRCRHLQKLDILSDILRASLNRSLTKFEQNDKEDEFTDYMLAPDIISKTEKKAEMEIPAATKVKVT---------DLFQRLGPLSVFSAKQRWTAPRTIRLILQDRDL--GFTLKGDAPVQIQSLDPLCPAAAGGLKEGDYLVAVGDTDCKW 568          
BLAST of Rhophilin-2-like Protein vs. Ensembl Zebrafish
Match: ptpn23a (protein tyrosine phosphatase, non-receptor type 23, a [Source:ZFIN;Acc:ZDB-GENE-100921-24])

HSP 1 Score: 103.99 bits (258), Expect = 2.811e-22
Identity = 81/309 (26.21%), Postives = 142/309 (45.95%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFP-DRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQ----EAIEDLSAELKQLIKPTKYHLHLPSSKLEAL 1308
            +PMI + +K   +  F  + +  +  +YGEDPD Y E ++ +   R++     R  EG      Y+  +++++ R      +   +  SW ++F+G         +E++ I++NLGAL+S L +  ++ ++ G++ S  +F  S   F +L  +F +  SVDM  ++L +  NLM  QA EC         L +    N ++  +   S  +   ++    +L N E    L  I + W  LVQ+K  Y+ A+A         +L M K    Q    E +  L + L +L +  K     P S  EAL
Sbjct:    7 MPMIWLDLKEAGEFQFSPTVKQFILKNYGEDPDNYNEQLKKLEQLRQSAVNVTRDFEGCSTLRKYFGQLHYLQSRVPLGLGQEAAVPISWTEIFSGKTVTHEDICYEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFAYLRDHFSHSYSVDMSHQILNLNINLMLGQAQEC--------LLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIA---------HLHMGKQAEEQQKYGERVAYLQSSLDKLGEAIKLAKGQPDSVQEAL 298          
BLAST of Rhophilin-2-like Protein vs. Ensembl Zebrafish
Match: ptpn23a (protein tyrosine phosphatase, non-receptor type 23, a [Source:ZFIN;Acc:ZDB-GENE-100921-24])

HSP 1 Score: 99.7525 bits (247), Expect = 5.813e-21
Identity = 66/255 (25.88%), Postives = 123/255 (48.24%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFP-DRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAY 1158
            +PMI + +K   +  F  + +  +  +YGEDPD Y E ++ +   R++     R  EG      Y+  +++++ R      +   +  SW ++F+G         +E++ I++NLGAL+S L +  ++ ++ G++ S  +F  S   F +L  +F +  SVDM  ++L +  NLM  QA EC           +    N ++  +   S  +   ++    +L N E    L  I + W  LVQ+K  Y+ A+A+
Sbjct:    7 MPMIWLDLKEAGEFQFSPTVKQFILKNYGEDPDNYNEQLKKLEQLRQSAVNVTRDFEGCSTLRKYFGQLHYLQSRVPLGLGQEAAVPISWTEIFSGKTVTHEDICYEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFAYLRDHFSHSYSVDMSHQILNLNINLMLGQAQECLL--------EKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIAH 253          
BLAST of Rhophilin-2-like Protein vs. Ensembl Xenopus
Match: rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:NCBI gene;Acc:100145690])

HSP 1 Score: 303.523 bits (776), Expect = 2.661e-92
Identity = 187/570 (32.81%), Postives = 317/570 (55.61%), Query Frame = 1
Query:  124 LAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ--DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPEL--QVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSS 1809
            L+ +N  RK   I QT RSKL   R  +N++I K +RM++GA NL+  T + +I+ ++ +E+ F  SNL+  KEELER N +++ YQ  +  + +P+IP+ +K T D+DF  +F++ +  HY ED  +Y   +  +   R+A + P R   GI   + Y+  +  +E RFF P R+ GI+F+W D FTGVP  Q     EK+ I+FN+ ALY+Q+ +  ++ T+ GLEES   F  +    N+L   F + PS DM P ML +L  ++  +A EC F   + L  ++++F  L  L++  E+  +S +   VY+ +N   ++  E++P +W  +VQVK+ +YKAL    +A   I   L +S D + QE AI  L   + + +        L   +   L L K  +++A+   EE+I+ + +   LR ++ L N L+  H+  + +     KH+ + DLLS P++  + E +  +I   L     S+   +D F+ LGP+ +F+ + +    R V I ++    FGF +KG  P++VV+++    +   GLK GD+++S++  D +W S
Sbjct:   15 LSEQNYFRKGKSIAQTGRSKLQNQRASLNQQILKAMRMRAGAENLLRATANNKIREQVLLELSFVNSNLQRLKEELERLNISVEVYQHTEQASNIPLIPLGLKETKDVDFTTAFKDFILEHYSEDASEYENELADLMDLRQACRTPSRDEAGIELLMSYFQQLGFLENRFFPPSRNMGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYTQIGTRCNRQTKIGLEESVTTFQKAAGVLNYLKETFTHTPSYDMSPAMLGVLIKMLLAEAHECYF-EKMILSGIQNEFCTL--LKVAQEAAKVSEVHMQVYTLMNQAPIK--ENVPYSWSVMVQVKAEHYKALTNYFVAVILIDYQLNLSDDEDKQEKAIAQLYDSMPEGLTAQTI---LKDQQQRTL-LGKAHLSKAIRCHEEAIRFSTLCSTLRQIDVLQNILSAFHQRSLLKFSQHQKHDDFLDLLSAPDIVSKTEYQAEMIPPQL-----SRVKATDLFQRLGPLSVFSVKQRWSAPRKVCITKEDG-DFGFLLKGDSPVQVVSLDPLCPSATEGLKEGDYIVSVEGEDCKWCS 569          
BLAST of Rhophilin-2-like Protein vs. Ensembl Xenopus
Match: rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:NCBI gene;Acc:100145690])

HSP 1 Score: 298.901 bits (764), Expect = 1.102e-90
Identity = 183/563 (32.50%), Postives = 312/563 (55.42%), Query Frame = 1
Query:  145 RKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ--DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPEL--QVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSS 1809
            +    I QT RSKL   R  +N++I K +RM++GA NL+  T + +I+ ++ +E+ F  SNL+  KEELER N +++ YQ  +  + +P+IP+ +K T D+DF  +F++ +  HY ED  +Y   +  +   R+A + P R   GI   + Y+  +  +E RFF P R+ GI+F+W D FTGVP  Q     EK+ I+FN+ ALY+Q+ +  ++ T+ GLEES   F  +    N+L   F + PS DM P ML +L  ++  +A EC F   + L  ++++F  L  L++  E+  +S +   VY+ +N   ++  E++P +W  +VQVK+ +YKAL    +A   I   L +S D + QE AI  L   + + +        L   +   L L K  +++A+   EE+I+ + +   LR ++ L N L+  H+  + +     KH+ + DLLS P++  + E +  +I   L     S+   +D F+ LGP+ +F+ + +    R V I ++    FGF +KG  P++VV+++    +   GLK GD+++S++  D +W S
Sbjct:    2 KSGKSIAQTGRSKLQNQRASLNQQILKAMRMRAGAENLLRATANNKIREQVLLELSFVNSNLQRLKEELERLNISVEVYQHTEQASNIPLIPLGLKETKDVDFTTAFKDFILEHYSEDASEYENELADLMDLRQACRTPSRDEAGIELLMSYFQQLGFLENRFFPPSRNMGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYTQIGTRCNRQTKIGLEESVTTFQKAAGVLNYLKETFTHTPSYDMSPAMLGVLIKMLLAEAHECYF-EKMILSGIQNEFCTL--LKVAQEAAKVSEVHMQVYTLMNQAPIK--ENVPYSWSVMVQVKAEHYKALTNYFVAVILIDYQLNLSDDEDKQEKAIAQLYDSMPEGLTAQTI---LKDQQQRTL-LGKAHLSKAIRCHEEAIRFSTLCSTLRQIDVLQNILSAFHQRSLLKFSQHQKHDDFLDLLSAPDIVSKTEYQAEMIPPQL-----SRVKATDLFQRLGPLSVFSVKQRWSAPRKVCITKEDG-DFGFLLKGDSPVQVVSLDPLCPSAVKGLKEGDYIVSVEGEDCKWCS 549          
BLAST of Rhophilin-2-like Protein vs. Ensembl Xenopus
Match: rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:NCBI gene;Acc:100145690])

HSP 1 Score: 298.516 bits (763), Expect = 2.505e-90
Identity = 183/558 (32.80%), Postives = 311/558 (55.73%), Query Frame = 1
Query:  160 IFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ--DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPEL--QVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSS 1809
            I QT RSKL   R  +N++I K +RM++GA NL+  T + +I+ ++ +E+ F  SNL+  KEELER N +++ YQ  +  + +P+IP+ +K T D+DF  +F++ +  HY ED  +Y   +  +   R+A + P R   GI   + Y+  +  +E RFF P R+ GI+F+W D FTGVP  Q     EK+ I+FN+ ALY+Q+ +  ++ T+ GLEES   F  +    N+L   F + PS DM P ML +L  ++  +A EC F   + L  ++++F  L  L++  E+  +S +   VY+ +N   ++  E++P +W  +VQVK+ +YKAL    +A   I   L +S D + QE AI  L   + + +        L   +   L L K  +++A+   EE+I+ + +   LR ++ L N L+  H+  + +     KH+ + DLLS P++  + E +  +I   L     S+   +D F+ LGP+ +F+ + +    R V I ++    FGF +KG  P++VV+++    +   GLK GD+++S++  D +W S
Sbjct:   34 IAQTGRSKLQNQRASLNQQILKAMRMRAGAENLLRATANNKIREQVLLELSFVNSNLQRLKEELERLNISVEVYQHTEQASNIPLIPLGLKETKDVDFTTAFKDFILEHYSEDASEYENELADLMDLRQACRTPSRDEAGIELLMSYFQQLGFLENRFFPPSRNMGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYTQIGTRCNRQTKIGLEESVTTFQKAAGVLNYLKETFTHTPSYDMSPAMLGVLIKMLLAEAHECYF-EKMILSGIQNEFCTL--LKVAQEAAKVSEVHMQVYTLMNQAPIK--ENVPYSWSVMVQVKAEHYKALTNYFVAVILIDYQLNLSDDEDKQEKAIAQLYDSMPEGLTAQTI---LKDQQQRTL-LGKAHLSKAIRCHEEAIRFSTLCSTLRQIDVLQNILSAFHQRSLLKFSQHQKHDDFLDLLSAPDIVSKTEYQAEMIPPQL-----SRVKATDLFQRLGPLSVFSVKQRWSAPRKVCITKEDG-DFGFLLKGDSPVQVVSLDPLCPSAVKGLKEGDYIVSVEGEDCKWCS 576          
BLAST of Rhophilin-2-like Protein vs. Ensembl Xenopus
Match: rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:NCBI gene;Acc:100145690])

HSP 1 Score: 290.041 bits (741), Expect = 1.535e-87
Identity = 178/551 (32.30%), Postives = 306/551 (55.54%), Query Frame = 1
Query:  181 KLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ--DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPEL--QVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSS 1809
            KL   R  +N++I K +RM++GA NL+  T + +I+ ++ +E+ F  SNL+  KEELER N +++ YQ  +  + +P+IP+ +K T D+DF  +F++ +  HY ED  +Y   +  +   R+A + P R   GI   + Y+  +  +E RFF P R+ GI+F+W D FTGVP  Q     EK+ I+FN+ ALY+Q+ +  ++ T+ GLEES   F  +    N+L   F + PS DM P ML +L  ++  +A EC F   + L  ++++F  L  L++  E+  +S +   VY+ +N   ++  E++P +W  +VQVK+ +YKAL    +A   I   L +S D + QE AI  L   + + +        L   +   L L K  +++A+   EE+I+ + +   LR ++ L N L+  H+  + +     KH+ + DLLS P++  + E +  +I   L     S+   +D F+ LGP+ +F+ + +    R V I ++    FGF +KG  P++VV+++    +   GLK GD+++S++  D +W S
Sbjct:    7 KLQNQRASLNQQILKAMRMRAGAENLLRATANNKIREQVLLELSFVNSNLQRLKEELERLNISVEVYQHTEQASNIPLIPLGLKETKDVDFTTAFKDFILEHYSEDASEYENELADLMDLRQACRTPSRDEAGIELLMSYFQQLGFLENRFFPPSRNMGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYTQIGTRCNRQTKIGLEESVTTFQKAAGVLNYLKETFTHTPSYDMSPAMLGVLIKMLLAEAHECYF-EKMILSGIQNEFCTL--LKVAQEAAKVSEVHMQVYTLMNQAPIK--ENVPYSWSVMVQVKAEHYKALTNYFVAVILIDYQLNLSDDEDKQEKAIAQLYDSMPEGLTAQTI---LKDQQQRTL-LGKAHLSKAIRCHEEAIRFSTLCSTLRQIDVLQNILSAFHQRSLLKFSQHQKHDDFLDLLSAPDIVSKTEYQAEMIPPQL-----SRVKATDLFQRLGPLSVFSVKQRWSAPRKVCITKEDG-DFGFLLKGDSPVQVVSLDPLCPSAVKGLKEGDYIVSVEGEDCKWCS 542          
BLAST of Rhophilin-2-like Protein vs. Ensembl Xenopus
Match: rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:NCBI gene;Acc:100145690])

HSP 1 Score: 290.812 bits (743), Expect = 2.217e-87
Identity = 182/573 (31.76%), Postives = 312/573 (54.45%), Query Frame = 1
Query:  124 LAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ--DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSL-----GPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSS 1809
            L+ +N  RK   I QT RSKL   R  +N++I K +RM++GA NL+  T + +I+ ++ +E+ F  SNL+  KEELER N +++ YQ  +  + +P+IP+ +K T D+DF  +F++ +  HY ED  +Y   +  +   R+A + P R   GI   + Y+  +  +E RFF P R+ GI+F+W D FTGVP  Q     EK+ I+FN+ ALY+Q+ +  ++ T+ GLEES   F  +    N+L   F + PS DM P ML +L  ++  +A EC F   + L  ++++F  L  L++  E+  +S +   VY+ +N   ++  E++P +W  +VQVK+ +YKAL    +A   I   L +S D + QE AI  L   + + +        L   +   L L K  +++A+   EE+I+ + +   LR ++ L N L+  H+  + +     KH+ + DLLS P++  +    +       +++S   +   F        GP+ +F+ + +    R V I ++    FGF +KG  P++VV+++    +   GLK GD+++S++  D +W S
Sbjct:   15 LSEQNYFRKGKSIAQTGRSKLQNQRASLNQQILKAMRMRAGAENLLRATANNKIREQVLLELSFVNSNLQRLKEELERLNISVEVYQHTEQASNIPLIPLGLKETKDVDFTTAFKDFILEHYSEDASEYENELADLMDLRQACRTPSRDEAGIELLMSYFQQLGFLENRFFPPSRNMGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYTQIGTRCNRQTKIGLEESVTTFQKAAGVLNYLKETFTHTPSYDMSPAMLGVLIKMLLAEAHECYF-EKMILSGIQNEFCTL--LKVAQEAAKVSEVHMQVYTLMNQAPIK--ENVPYSWSVMVQVKAEHYKALTNYFVAVILIDYQLNLSDDEDKQEKAIAQLYDSMPEGLTAQTI---LKDQQQRTL-LGKAHLSKAIRCHEEAIRFSTLCSTLRQIDVLQNILSAFHQRSLLKFSQHQKHDDFLDLLSAPDIVSKYGLPLFLLLCIHELLSNISKWTYFTYFTFNVQGPLSVFSVKQRWSAPRKVCITKEDG-DFGFLLKGDSPVQVVSLDPLCPSAVKGLKEGDYIVSVEGEDCKWCS 577          
BLAST of Rhophilin-2-like Protein vs. Ensembl Mouse
Match: Rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:MGI Symbol;Acc:MGI:1289234])

HSP 1 Score: 270.396 bits (690), Expect = 5.169e-80
Identity = 165/559 (29.52%), Postives = 304/559 (54.38%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLS---CPELQVEARTGV-INQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N + QT RSKL   R  +N++I K +RM++GA NL+++  +++++ ++ +E+ F  S+L++ KEELE  N ++  YQ  +    +P+IP+ +K T ++DF   F++ +  HY ED   Y + I  +   R+A + P R   G+   + Y+  +  +E RFF P R  G++F+W D FTGVP  Q+T + EK+ ++FN+GALY+Q+ +  ++ TQAGLE + + F  +    N+L   F + PS DM P ML +L  +M  QA E  F  +    +  + F  ++  +   E+  ++  +  ++++++ E ++  E+IP +W ++  VK+ +Y ALA+   A   I   L    D + QE  +  L   + + + P    L    +  + + L K  ++ A+   EES++ A + K LR++  L + L+  H+    QL      E  DLL+    P++  +    V I    F+++      +D F+ LGP+ +F++  +  P R +    ++    GFT++G  P++V  ++ + +A  +G K GD+++S+   D +W
Sbjct:   26 NPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNQKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQGTEEAFTIPLIPLGLKETKEVDFSIVFKDFILEHYSEDSYLYEDDIADLMDLRQACRTPSRDEAGVELLMSYFIQLGFVESRFFPPTRHMGLLFTWYDSFTGVPVSQQTLLLEKASVLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQESVFEKVCLPGIQNEFFVLVKVAQ---EAAKVAEAYRQLHAAMSQEPVK--ENIPYSWASVAYVKAYHYGALAHYFAATLLIDHQLKPGADEDHQEKCLSQLYDRMPEGMTP----LATLKNAGQRVLLGKGHLHRAIGFHEESLREANLCKKLRDIQVLRDVLSAAHQR--TQLKHTQHREDDDLLNLIDAPDVLPKTEREVKITFPDFSKVTV----TDFFQKLGPLSVFSASKRWSPPRGIHFTVEEG-DLGFTLRGNTPVQVHFLDPHCSASLAGAKEGDYIVSIQGVDCKW 568          
BLAST of Rhophilin-2-like Protein vs. Ensembl Mouse
Match: Rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:MGI Symbol;Acc:MGI:1289234])

HSP 1 Score: 270.396 bits (690), Expect = 5.169e-80
Identity = 165/559 (29.52%), Postives = 304/559 (54.38%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLS---CPELQVEARTGV-INQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N + QT RSKL   R  +N++I K +RM++GA NL+++  +++++ ++ +E+ F  S+L++ KEELE  N ++  YQ  +    +P+IP+ +K T ++DF   F++ +  HY ED   Y + I  +   R+A + P R   G+   + Y+  +  +E RFF P R  G++F+W D FTGVP  Q+T + EK+ ++FN+GALY+Q+ +  ++ TQAGLE + + F  +    N+L   F + PS DM P ML +L  +M  QA E  F  +    +  + F  ++  +   E+  ++  +  ++++++ E ++  E+IP +W ++  VK+ +Y ALA+   A   I   L    D + QE  +  L   + + + P    L    +  + + L K  ++ A+   EES++ A + K LR++  L + L+  H+    QL      E  DLL+    P++  +    V I    F+++      +D F+ LGP+ +F++  +  P R +    ++    GFT++G  P++V  ++ + +A  +G K GD+++S+   D +W
Sbjct:   26 NPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNQKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQGTEEAFTIPLIPLGLKETKEVDFSIVFKDFILEHYSEDSYLYEDDIADLMDLRQACRTPSRDEAGVELLMSYFIQLGFVESRFFPPTRHMGLLFTWYDSFTGVPVSQQTLLLEKASVLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQESVFEKVCLPGIQNEFFVLVKVAQ---EAAKVAEAYRQLHAAMSQEPVK--ENIPYSWASVAYVKAYHYGALAHYFAATLLIDHQLKPGADEDHQEKCLSQLYDRMPEGMTP----LATLKNAGQRVLLGKGHLHRAIGFHEESLREANLCKKLRDIQVLRDVLSAAHQR--TQLKHTQHREDDDLLNLIDAPDVLPKTEREVKITFPDFSKVTV----TDFFQKLGPLSVFSASKRWSPPRGIHFTVEEG-DLGFTLRGNTPVQVHFLDPHCSASLAGAKEGDYIVSIQGVDCKW 568          
BLAST of Rhophilin-2-like Protein vs. Ensembl Mouse
Match: Rhpn1 (rhophilin, Rho GTPase binding protein 1 [Source:MGI Symbol;Acc:MGI:1098783])

HSP 1 Score: 249.21 bits (635), Expect = 2.363e-72
Identity = 162/571 (28.37%), Postives = 288/571 (50.44%), Query Frame = 1
Query:  145 RKNNRIF-QTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGL--PMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSK-DVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHES-YDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMK---IGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQ-EVLVQI 1830
            RK    F Q Q  +L  +R +++++I+K+LRM++GA NL   T +  ++  + +E+ +  SNL+L KEEL   + ++D  Q    G+  PMIP+ +K T ++D+    + ++  H+GED   +   I+ +   R+A + P R   G+     YY+ +  ++ RFF P RS G++F W D  TGVP QQR   FEK  ++FN+GAL++Q+ +    +   G   +   F  +   F  L  NF + PS DM    L ML  LM  QA EC F  LL            + L+L  E+  ++  +  V+ ++    ++  +++P +W NL  VK+ ++ ALA+   A        +K ++  QE +   S   + L  PT     LP    +   L+K  +  A+   EE+++L  + + LR ++ L   +    +  + +   L + +  ++    P++Q +         +    +SQ   +D F  LGP+ +F+++ +   +GP   V + R +   FGFT++G  P+ +  V     AE +GLK GD+++S++    +W    EV+ Q+
Sbjct:   26 RKGYGSFVQNQPGQLQSHRARLHQQISKELRMRTGAENLYRATSNTWVRETVALELSYVNSNLQLLKEELAELSTSVDVDQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFGEDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQ-LQLAQEAAQVATEYGLVHRAMAQPPVR--DYLPASWTNLAHVKAEHFCALAHYHAAMALCESHPAKGELARQEHVFQPSTPHEPL-GPT-----LPQHPEDRRKLAKAHLKRAILGQEEALRLHTLCRVLRKVDLLQVVVTQALRRSLAKYSQLEREDDFFEATEAPDIQPKTHQ---TPEVRMPSLSQVKVTDFFHRLGPLSVFSTKNRWQLVGP---VHMTRGEG-SFGFTLRGDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQL 580          
BLAST of Rhophilin-2-like Protein vs. Ensembl Mouse
Match: Rhpn1 (rhophilin, Rho GTPase binding protein 1 [Source:MGI Symbol;Acc:MGI:1098783])

HSP 1 Score: 243.047 bits (619), Expect = 3.516e-70
Identity = 160/571 (28.02%), Postives = 283/571 (49.56%), Query Frame = 1
Query:  145 RKNNRIF-QTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGL--PMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSK-DVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHES-YDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMK---IGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQ-EVLVQI 1830
            RK    F Q Q  +L  +R +++++I+K+LRM++GA NL   T +  ++  + +E+ +  SNL+L KEEL   + ++D  Q    G+  PMIP+ +K T ++D+    + ++  H+GED   +   I+ +   R+A + P R   G+     YY+ +  ++ RFF P RS G++F W D  TGVP QQR   FEK  ++FN+GAL++Q+ +    +   G   +   F  +   F  L  NF + PS DM    L ML  LM  QA EC F  LL            + L+L  E+  ++  +  V+ ++    ++  +++P +W NL  VK+ ++ ALA+   A        +K ++  QE +   S   + L  PT     LP    +   L+K  +  A+   EE+++L  + + LR ++ L   +    +  + +   L + +  ++    P++Q +                Q PE       GP+ +F+++ +   +GP   V + R +   FGFT++G  P+ +  V     AE +GLK GD+++S++    +W    EV+ Q+
Sbjct:   26 RKGYGSFVQNQPGQLQSHRARLHQQISKELRMRTGAENLYRATSNTWVRETVALELSYVNSNLQLLKEELAELSTSVDVDQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFGEDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQ-LQLAQEAAQVATEYGLVHRAMAQPPVR--DYLPASWTNLAHVKAEHFCALAHYHAAMALCESHPAKGELARQEHVFQPSTPHEPL-GPT-----LPQHPEDRRKLAKAHLKRAILGQEEALRLHTLCRVLRKVDLLQVVVTQALRRSLAKYSQLEREDDFFEATEAPDIQPKTH--------------QTPE-------GPLSVFSTKNRWQLVGP---VHMTRGEG-SFGFTLRGDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQL 562          
BLAST of Rhophilin-2-like Protein vs. Ensembl Mouse
Match: Rhpn1 (rhophilin, Rho GTPase binding protein 1 [Source:MGI Symbol;Acc:MGI:1098783])

HSP 1 Score: 203.371 bits (516), Expect = 1.624e-57
Identity = 109/341 (31.96%), Postives = 183/341 (53.67%), Query Frame = 1
Query:  145 RKNNRIF-QTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGL--PMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAY 1158
            RK    F Q Q  +L  +R +++++I+K+LRM++GA NL   T +  ++  + +E+ +  SNL+L KEEL   + ++D  Q    G+  PMIP+ +K T ++D+    + ++  H+GED   +   I+ +   R+A + P R   G+     YY+ +  ++ RFF P RS G++F W D  TGVP QQR   FEK  ++FN+GAL++Q+ +    +   G   +   F  +   F  L  NF + PS DM    L ML  LM  QA EC F  LL            + L+L  E+  ++  +  V+ ++    ++  +++P +W NL  VK+ ++ ALA+
Sbjct:   26 RKGYGSFVQNQPGQLQSHRARLHQQISKELRMRTGAENLYRATSNTWVRETVALELSYVNSNLQLLKEELAELSTSVDVDQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFGEDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQ-LQLAQEAAQVATEYGLVHRAMAQPPVR--DYLPASWTNLAHVKAEHFCALAH 363          
BLAST of Rhophilin-2-like Protein vs. UniProt/SwissProt
Match: sp|Q63ZR5|RHN2B_XENLA (Rhophilin-2-B OS=Xenopus laevis OX=8355 GN=rhpn2-b PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 7.941e-89
Identity = 184/568 (32.39%), Postives = 317/568 (55.81%), Query Frame = 1
Query:  124 LAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ--DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSS 1809
            L+ +N  RK   I QT RSKL   R  +N++I K +RM++GA NL+  T + +I+ ++ +E+ F  SNL+  KEELER N +++ YQ  +  + +P+IP+ +K T D+DF  +F++ +  HY ED  +Y   +  +   R+A + P R   G+   + Y+  + ++E RFF P R+ GI+F+W D FTGVP  Q     EK+ I+FN+ ALYSQ+ +  ++ T+ GLEE+   F  +    N+L   F + PS DM P ML  L  ++  +A EC F   + L  ++++F  L  L+   E+  +S +   VY+ +N   ++  E++P +W  +VQVK+ +YKALA   +A   I   L +S D + QE AI  L   + + +        L   +   L L K  +++A+   EE+I+ + +   LR ++ L   L+  H+  + +     K + + DLLS P+  + ++T    +++  Q +S++  +D F+ LGP+ IF+ + +    R + I ++    FGF +KG  P++V++++    A   GLK GD+++S+   D +W S
Sbjct:   15 LSEQNYFRKGKSIAQTGRSKLQNQRAILNQQILKAMRMRAGAENLLRATANNKIREQVLLELSFVNSNLQRLKEELERLNISVEVYQHTEQASNIPLIPLGLKETKDVDFTTAFKDFILEHYSEDASEYENELADLMDLRQACRTPSRDEAGVELLVSYFQQLGYLENRFFPPSRNIGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYSQIGTRCNRQTKIGLEEAVTTFQKAAGVLNYLKETFTHTPSYDMSPAMLGALIKMLLAEAHECYF-EKMILSGIQNEFCTL--LKAAQEAAKVSEVHMQVYTLMNQAPIK--ENVPYSWSVMVQVKAEHYKALANYFVAITLIDYQLNLSDDEDKQEKAISQLYDSMPEGLTAQTI---LKDQQQRTL-LGKAHLSKAIRSHEEAIRFSTLCSTLRQIDVLQLILSAFHQRSLLKFSQHQKPDDFLDLLSAPD--IVSKTEYQAETIPPQ-LSKDKVTDIFQRLGPLSIFSVKQRWSAPRKMCITKEDG-DFGFVLKGDCPVQVISLDPLCPAATEGLKEGDYIVSVAGKDCKWCS 569          
BLAST of Rhophilin-2-like Protein vs. UniProt/SwissProt
Match: sp|Q6DJJ6|RHN2A_XENLA (Rhophilin-2-A OS=Xenopus laevis OX=8355 GN=rhpn2-a PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.323e-88
Identity = 188/596 (31.54%), Postives = 326/596 (54.70%), Query Frame = 1
Query:  124 LAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLK--TGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPEL--QVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEV---LVQITAKCSLIKLTVTTITE 1878
            L+ +N  RK   I QT RSKL   R  +N++I K +RM+ GA NL+  T + +I+ ++ +E+ F  SNL+  KEELER N +++ YQ  +  + +P+IP+ +K T D+DF  +F++ +  HY ED  +Y   +  +   R+A + P R   G+   + Y+  + ++E RFF P R+ GI+F+W D FTGVP  Q     EK+ I+FN+ ALY+Q+ +  ++ T+ GLEE+   F  +    N+L   F + PS DM P ML +L  ++  +A EC F   + L  ++++F  L  L+   E+  +  +   VY+ +N   ++  E++P +W  +VQVK+ +YKALA   +A   I   L +S D + QE AI  L   + + +        L   +   L L K  +++A+   EE+I+ + +   LR ++ L   L+  H+    +     K + + DLLS P++  + E +   I+  L     S++  +D F+ LGP+ +F+ + +    R + I ++    FGF ++G  P++V++++    A   GLK GD+++S+   D +W S      ++Q T K S I++ V +I +
Sbjct:   15 LSEQNYFRKGKSIAQTGRSKLQNQRASLNQQILKAMRMRVGAENLLRATSNNKIREQVLLELSFVNSNLQRLKEELERLNISVEVYQHTEQDSNIPLIPLGLKETKDVDFTTAFKDFISEHYSEDASEYENELADLMDLRQACRTPSRDEAGVELLVSYFQQLGYLENRFFPPSRNLGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYTQIGTRCNRQTKIGLEEAVTAFQKATGVLNYLKETFTHTPSYDMSPAMLGVLIKMLLAEAHECYF-EKMILSGIQNEFCTL--LKAAQEAAKVGEVHMQVYTLMNQAPIK--ENVPYSWSVMVQVKAEHYKALANYFVAIILIDYQLSLSDDEDKQEKAISQLYDSMPEGLTAQTI---LKDQQQRTL-LGKAHLSKAIRSHEEAIRFSTLCSTLRQIDVLQKILSAFHQRSQLKFSQHQKPDDFLDLLSAPDIVSKTEYQAKTISPQL-----SKDKVTDIFQRLGPLSVFSVKQRWSAPRKICITKEDG-DFGFVLRGDCPVQVISLDPLCPAATEGLKEGDYIVSVAGKDCKWCSTSQVMDMLQATGKQS-IEIQVISIQD 594          
BLAST of Rhophilin-2-like Protein vs. UniProt/SwissProt
Match: sp|A4FUC9|RHPN2_BOVIN (Rhophilin-2 OS=Bos taurus OX=9913 GN=RHPN2 PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 7.796e-82
Identity = 173/564 (30.67%), Postives = 316/564 (56.03%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKP--TKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEH-KSWI--DQLHS----LNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N + QT RSKL   R  +N++I K +RM++GA NL++   +++++ ++ +E+ F  S+L++ KEELE  N ++  YQ+ +    +P+IP+ +K T D+DF  + ++ +  HY ED   Y + I  +   R+A + P R+  G+   + Y+  +  +E RFF P R  GI+F+W D  TGVP  Q+  + EK+ I+FN+GALY+Q+ +  ++ T+AGLE + + F  +    N+L   F + PS DM P ML +L  +M  QA E  F  +    L  + F  ++  +   E+  +  ++  +++++N E ++  E+IP +W +L  VK+++Y+ALA+   A   I   L   +D + QE  +  L + + + + P  T  ++H    + + LG S L   +A+   EES++ A++ K LRN++ L   L+  H +S +   QL      LN  ++ D++S  E +VE    ++ Q  F+++      +D F+ LGP+ +F++  +    R +    ++    GFT++G  P++V  ++   +A  +G K GD+++S+ D D +W
Sbjct:   26 NPLAQTGRSKLQNQRAALNQQILKAMRMRTGAENLLKAATNQKVREQVRLELSFLNSDLQMLKEELEGLNISVGVYQNTEEAFTIPLIPLGLKETKDVDFSVALKDFILEHYSEDSYLYEDEIADLMDLRQACRTPSRNEAGVELLMSYFMQLGFVESRFFPPTRQMGILFTWYDSLTGVPVSQQNLLLEKASILFNIGALYTQIGTRCNRQTEAGLESTVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQESTFEKVCLPGLQNEFFLLVKVAQ---EAAKVGEVYRQLHTAMNQEPVK--ENIPYSWASLACVKAHHYEALAHYFTATLLIDHQLKPGEDEDHQEKCLSQLYSHMPEGLTPLATLKNVH----QRQLLGKSHLC--QAVTHHEESMREASLCKKLRNIDVLQEVLSAAHDRSQLKYTQLREDDDLLNLTDAPDIVSKTEREVEI---IVPQ--FSKVTV----TDFFQKLGPLSVFSANKRWTAPRSIHFTAEEG-DLGFTLRGNSPVQVHFLDPYCSAAAAGTKEGDYIVSIQDVDCKW 568          
BLAST of Rhophilin-2-like Protein vs. UniProt/SwissProt
Match: sp|Q8BWR8|RHPN2_MOUSE (Rhophilin-2 OS=Mus musculus OX=10090 GN=Rhpn2 PE=1 SV=2)

HSP 1 Score: 270.396 bits (690), Expect = 3.615e-79
Identity = 165/559 (29.52%), Postives = 304/559 (54.38%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLS---CPELQVEARTGV-INQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N + QT RSKL   R  +N++I K +RM++GA NL+++  +++++ ++ +E+ F  S+L++ KEELE  N ++  YQ  +    +P+IP+ +K T ++DF   F++ +  HY ED   Y + I  +   R+A + P R   G+   + Y+  +  +E RFF P R  G++F+W D FTGVP  Q+T + EK+ ++FN+GALY+Q+ +  ++ TQAGLE + + F  +    N+L   F + PS DM P ML +L  +M  QA E  F  +    +  + F  ++  +   E+  ++  +  ++++++ E ++  E+IP +W ++  VK+ +Y ALA+   A   I   L    D + QE  +  L   + + + P    L    +  + + L K  ++ A+   EES++ A + K LR++  L + L+  H+    QL      E  DLL+    P++  +    V I    F+++      +D F+ LGP+ +F++  +  P R +    ++    GFT++G  P++V  ++ + +A  +G K GD+++S+   D +W
Sbjct:   26 NPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNQKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQGTEEAFTIPLIPLGLKETKEVDFSIVFKDFILEHYSEDSYLYEDDIADLMDLRQACRTPSRDEAGVELLMSYFIQLGFVESRFFPPTRHMGLLFTWYDSFTGVPVSQQTLLLEKASVLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQESVFEKVCLPGIQNEFFVLVKVAQ---EAAKVAEAYRQLHAAMSQEPVK--ENIPYSWASVAYVKAYHYGALAHYFAATLLIDHQLKPGADEDHQEKCLSQLYDRMPEGMTP----LATLKNAGQRVLLGKGHLHRAIGFHEESLREANLCKKLRDIQVLRDVLSAAHQR--TQLKHTQHREDDDLLNLIDAPDVLPKTEREVKITFPDFSKVTV----TDFFQKLGPLSVFSASKRWSPPRGIHFTVEEG-DLGFTLRGNTPVQVHFLDPHCSASLAGAKEGDYIVSIQGVDCKW 568          
BLAST of Rhophilin-2-like Protein vs. UniProt/SwissProt
Match: sp|Q8HXG3|RHPN2_CANLF (Rhophilin-2 OS=Canis lupus familiaris OX=9615 GN=RHPN2 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 6.638e-79
Identity = 170/576 (29.51%), Postives = 312/576 (54.17%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEH-KSWIDQLH------SLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCS 1845
            N + QT RSKL   R  +N++I K +RM++GA NL+++  + +++ ++ +E+ F  S+L++ KEELE  N ++  YQ  +    +P+IP+ +K T DIDF    ++ +  HY ED   Y + I  +   R+A + P R   G+   + Y+  +  +E RFF P R  GI+F+W D  TGVP  Q+  + EK+ I+FN+GALY+Q+ +  ++ TQAGL+ + + F  +    +HL   F + PS DM P ML +L  +M  QA E  F  +    +  + F  ++  +   E+  +  ++  ++++++   ++  E+IP +W +LV VK+++Y ALA+   A   I   L    D + QE  +  L   + + + P    L    S  +   L K  +  A+   EES++ A++ K LRN+  L + L+  H +S +           LN  ++ D++S  E +VE    ++ Q  F+++ +    +D F+ LGP+ +F++  +  P R +    ++    GFT++G  P++V  ++ + +A  +G K GD+++S+ D D +W +   ++++   C 
Sbjct:   26 NPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNHKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQSTEEAFTVPLIPLGLKETKDIDFSVVLKDFILEHYSEDSYLYEDEIADLMDLRQACRTPSRDEAGVELLMSYFIQLGFVESRFFPPTRQMGILFTWYDSLTGVPVSQQNLLLEKASILFNIGALYTQIGTRCNRRTQAGLDGAVDAFQRAAGVLHHLKETFTHTPSYDMSPAMLSVLVKMMLAQAQENVFEKICLPGIRNEFFVLVKVAQ---EAAKVGEVYRQLHTAMSQAPVK--ENIPYSWASLVCVKAHHYAALAHYFAATLLIDHQLKPGADEDHQEKCLSQLYDHMPEGLTP----LATLKSGHQRRQLGKSHLRRAVAHHEESVREASLCKKLRNIEVLQDVLSVAHERSRLKYAQHQDDDDLLNLIDAPDIISKTEQEVEI---ILPQ--FSKVTA----TDFFQKLGPLSVFSANKRWTPPRSIHFTAEEG-DLGFTLRGNSPVQVHFLDPHCSAALAGAKEGDYIVSIQDVDCKWLTVSEVMKLLKACG 582          
BLAST of Rhophilin-2-like Protein vs. TrEMBL
Match: A0A139WFV4 (Rhophilin-2-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC033522 PE=4 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 7.810e-106
Identity = 207/588 (35.20%), Postives = 335/588 (56.97%), Query Frame = 1
Query:   85 MNSSSKMSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSK-DVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHES--YDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKL-GFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQI 1830
            M  S    E F  L  +   R ++    T R KL   R K+N++INK+LR+++GA NL + T ++++K  + +E+ F  SNL+L KE+L   N +++ YQ   T   +PMIP+ +K T +IDF++ F++ +  HY ED ++Y +AI      R+AI+ P R   GI     YYN +  +E+RFF PDRS GI F W D  TGVP  QRT  FEK+ ++FN+GA+Y+Q+ +   ++T  GL+ + + FL +   F +++ NF N PS+D+ PEML+ML  LM  QA EC  L  L L+  E +  ++  L+L  E+  ++  +  VY  +  E +   +++P +WI+LVQVK  YY  +A+  +A+  ++   +K    ++  ++ L AE       T+  + LP    E   L +  + E+L L EE  +L  M + LR    L+  L N HK+ + Q ++ N++E    D+L  P +Q   +      +L     +Q   +D F++LGPI IF+++      R+V + R +   GFGF+V+G  P+ V  VE NS AE  G+K GDF++++ D D++WSS + +V +
Sbjct:    1 MCESDLRIEDFSDLPKKPFVRGSDPRVATCRGKLQNRRSKLNQEINKELRLRAGAENLFKATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQSDSTDAVMPMIPLGLKETKEIDFRDPFKDFILEHYSEDANQYEDAIADFMDTRQAIRTPLRDTTGISLLFRYYNQLYFVERRFFPPDRSLGIYFEWFDSLTGVPSCQRTVAFEKACVLFNMGAIYTQIGAKQDRSTAKGLDAAVDSFLRAAGTFRYIHENFTNAPSMDLGPEMLEMLVQLMLAQAREC-LLEKLDLQSKESRSIDI-CLDLAQEAAHLADCYSQVYQLIMTESVH--DYVPYSWISLVQVKKEYYTGMAHYHVASGVLHKEAAKMSPTTKTTLQFLHAE----TASTQLDIRLPKDDAERRLLGRAHLRESLVLHEECQRLHRMCRELRGKQALTAVLRNAHKTAL-QAYTNNENEDDFSDVLDPPRVQAATK---FQLALTPPDFAQYRVNDLFRALGPIAIFSAKRHWTAPRLVQLHRGRTSEGFGFSVRGDAPVIVAIVESNSLAEFGGVKEGDFIVAISDKDVKWSSHDEVVAL 576          
BLAST of Rhophilin-2-like Protein vs. TrEMBL
Match: A0A139WFS4 (Rhophilin-2-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC033522 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.333e-105
Identity = 201/560 (35.89%), Postives = 326/560 (58.21%), Query Frame = 1
Query:  169 TQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSK-DVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHES--YDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKL-GFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQI 1830
            T R KL   R K+N++INK+LR+++GA NL + T ++++K  + +E+ F  SNL+L KE+L   N +++ YQ   T   +PMIP+ +K T +IDF++ F++ +  HY ED ++Y +AI      R+AI+ P R   GI     YYN +  +E+RFF PDRS GI F W D  TGVP  QRT  FEK+ ++FN+GA+Y+Q+ +   ++T  GL+ + + FL +   F +++ NF N PS+D+ PEML+ML  LM  QA EC  L  L L+  E +  ++  L+L  E+  ++  +  VY  +  E +   +++P +WI+LVQVK  YY  +A+  +A+  ++   +K    ++  ++ L AE       T+  + LP    E   L +  + E+L L EE  +L  M + LR    L+  L N HK+ + Q ++ N++E    D+L  P +Q   +      +L     +Q   +D F++LGPI IF+++      R+V + R +   GFGF+V+G  P+ V  VE NS AE  G+K GDF++++ D D++WSS + +V +
Sbjct:   30 TCRGKLQNRRSKLNQEINKELRLRAGAENLFKATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQSDSTDAVMPMIPLGLKETKEIDFRDPFKDFILEHYSEDANQYEDAIADFMDTRQAIRTPLRDTTGISLLFRYYNQLYFVERRFFPPDRSLGIYFEWFDSLTGVPSCQRTVAFEKACVLFNMGAIYTQIGAKQDRSTAKGLDAAVDSFLRAAGTFRYIHENFTNAPSMDLGPEMLEMLVQLMLAQAREC-LLEKLDLQSKESRSIDI-CLDLAQEAAHLADCYSQVYQLIMTESVH--DYVPYSWISLVQVKKEYYTGMAHYHVASGVLHKEAAKMSPTTKTTLQFLHAE----TASTQLDIRLPKDDAERRLLGRAHLRESLVLHEECQRLHRMCRELRGKQALTAVLRNAHKTAL-QAYTNNENEDDFSDVLDPPRVQAATK---FQLALTPPDFAQYRVNDLFRALGPIAIFSAKRHWTAPRLVQLHRGRTSEGFGFSVRGDAPVIVAIVESNSLAEFGGVKEGDFIVAISDKDVKWSSHDEVVAL 577          
BLAST of Rhophilin-2-like Protein vs. TrEMBL
Match: A0A1Y1L5A0 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_02495 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 6.381e-105
Identity = 199/566 (35.16%), Postives = 330/566 (58.30%), Query Frame = 1
Query:  169 TQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQD--LKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIK-------PTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHES--YDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKL-GFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQI 1830
            T R KL   R K+N++INK+LR+++GA NL + T +++++  + +E+ F  SNL+L KE+L   N +++ YQ   + + +PMIP+ +K T +IDF + F++ +  HY ED  +Y + I      R+A++ P R N GI     YYN +  +E+RFF PDRS GI F W D  TGVP  QRT  FEK+ ++FN+GA+Y+Q+ +   + T  GL+ + + FL +   F +++ NF N PS+D+ PEML+ML  LM  QA EC  L  L+L+  ED+  ++ + +L  E+  +S  + NV+  +  E ++  +++P +W++LVQVK  Y+  +A+   A+  ++          EA   +SA  K +++        T+ ++ LP   +E   L K  + EAL L EE  +L  M + L++   L+  L   H   + Q ++ N+HE    +LL  P++Q   +      SL     +Q+  +D F++LGPI IF+++      R+V + R +   GFGF+V+G  P+ + NVE NS AE  G+K GDF++++ D D++WSS + +V+ 
Sbjct:   32 TCRGKLQNKRSKLNQEINKELRLRAGAENLFKATTNRKLRETVALELSFVNSNLQLLKEQLAELNSSVELYQSDSMDSVMPMIPLGLKETKEIDFMDPFKDFILEHYSEDAFQYEDPITDFMDTRQAMRTPLRDNAGIALLFRYYNQLYFVERRFFPPDRSLGIYFEWFDSLTGVPSCQRTVAFEKACVLFNIGAIYTQIGTKQDRCTAKGLDSAVDSFLRAAGTFKYIHENFTNAPSMDLGPEMLEMLVQLMLAQAREC-LLEKLELQSREDRSVDI-SFDLAQEAAQLSQCYANVHQLITHETVR--DYVPYSWVSLVQVKREYFNGMAHYHAASGILH----------EAASQMSAATKDILRFLHVESTSTQLNIRLPKDDVERRLLGKAHLREALVLHEECQRLQRMCRELKSKLALTCVLRIAHSEAL-QSYTANEHEDDFRELLDPPQIQPSTK---FQLSLTAPDFAQHRVNDLFRALGPIAIFSAKRHWTAPRLVQLHRGRNSDGFGFSVRGDAPVIIANVESNSLAEFGGVKEGDFIVNILDKDVKWSSHDEVVKC 579          
BLAST of Rhophilin-2-like Protein vs. TrEMBL
Match: A0A151X327 (Rhophilin-2 OS=Trachymyrmex zeteki OX=64791 GN=ALC60_06461 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 7.052e-105
Identity = 199/577 (34.49%), Postives = 328/577 (56.85%), Query Frame = 1
Query:  169 TQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG---LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLA----NRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRD-QKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCS-LIKLTVTT 1869
            T R KL   R K+N++INK+LR+++GA NL + T ++++K  + +E+ F  SNL+L KE+L   N +++ YQ++ +    +PMIP+ +K T DIDF++ F++ +  HY ED + Y EAI  +   R+A + P R + GI   + YYN +  IE+RFF PDRS GI F W D  TGVP  QRT  FEK+ I+FN GALY+QLA+   + T  GL+++ + FL +   F +++ NF N PS+D+ P+ML+ML  LM  QA EC F         +D  S    L+L  E+  +++++ +V+  ++ E ++  +++P+ WI+L+ VK  ++ ALA+K +A    +R I  F  +   + E I+    +       T+    +P    E   L K  + EAL L +ES +L  M + L+    L+  L    ++ ++  +     + + +LL  P++    +      S+      Q+   D FKSLGP+ IF+++      R+V + R     GFGF+V+G  P+ V  V+ NS A+  G+K GDF++ + D D++W+S E +V++  +C   I L + T
Sbjct:   31 TCRGKLQNKRSKLNQEINKELRLRAGAENLFKATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNVDSTEPVMPMIPLGLKETKDIDFRDPFKDFILEHYSEDGENYEEAIADLMETRQATRTPTRDSAGIALLLRYYNQLYFIERRFFPPDRSLGIYFEWFDSLTGVPSCQRTVAFEKASILFNAGALYTQLAAKQDRLTARGLDQAVDAFLRAAGTFRYIHENFTNAPSMDLGPDMLEMLVQLMLAQARECLF--EKLELQSKDSRSIDVCLDLAQEAAQVAVIYNDVHGLISREPVR--DYVPETWISLILVKREHHLALAHKHIAVGLLDRPIAEFRVETKLTLEHIQKSDGK-------TQLDATIPRDDNERKLLGKAHLREALVLHDESQRLQRMCRELKGKQALAKVLKKAQEATLESYNRFGNEDDFRELLDPPDIIASTK---FQLSITHPDFGQHGVDDLFKSLGPVAIFSAKRHWTAPRLVQLQRGPDGEGFGFSVRGDAPVIVAAVDHNSLADVGGMKEGDFIVGIGDKDVKWASHEQVVRMIKQCGDFINLKLVT 593          
BLAST of Rhophilin-2-like Protein vs. TrEMBL
Match: A0A026X5U6 (Rhophilin-2 OS=Ooceraea biroi OX=2015173 GN=X777_16433 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 3.075e-104
Identity = 196/580 (33.79%), Postives = 324/580 (55.86%), Query Frame = 1
Query:  169 TQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG---LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIK-------PTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRD-QKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCS-LIKLTVTT 1869
            T R KL   R K+N++INK+LR+++GA NL + T ++++K  + +E+ F  SNL+L KE+L   N +++ YQ++      +PMIP+ +K T DIDF++ F++ +  HY ED + Y EAI  +   R+A + P R + GI   + YYN +  IE+RFF PDRS GI F W D  TGVP  QRT  FEK+ I+FN GALY+QLA+   + T  GL+++ + FL +   F +++ NF N PS+D+ P+ML+ML  LM  QA EC F          D  +    L+L  E+  ++ ++ +V+  ++ E ++  +++P+ WI+L+ VK  ++ ALA+K +A   +             I D   E++  ++        T+    +P    E   L K  + EAL L +ES +L  M + L+    L+  L   H++ +D  +     + + +LL  P++    +      S+      Q+   D F+SLGP+ IF+++      R+V + R     GFGF+V+G  P+ +  V+ NS A+  G+K GDF++ + D D++W+S E +V++  +C   I L + T
Sbjct:   80 TCRGKLQNKRSKLNQEINKELRLRAGAENLFKATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNVDGDEPVMPMIPLGLKETKDIDFRDPFKDFILEHYSEDGENYEEAIADLMETRQATRTPTRDSAGIALLLRYYNQLYFIERRFFPPDRSLGIYFEWFDSLTGVPSCQRTVAFEKASILFNAGALYTQLAAKQDRMTARGLDQAVDAFLRAAGTFRYIHENFTNAPSMDLGPDMLEMLVQLMLAQARECLF--EKLELQSRDGRNIDVCLDLAQEAAQVATIYNDVHGLISREPVR--DYVPETWISLILVKREHHLALAHKHIAVGLL----------DRPITDFRVEIRLTLEHIQKSDGKTQLDATVPRDDSERKLLGKAHLREALVLHDESQRLQRMCRDLKGKQALARVLKKAHEATLDSYNRFGSEDDFRELLDPPDIIASTK---FQLSITHPDFGQHGVDDLFRSLGPVAIFSAKRHWTAPRLVQLQRGPDGEGFGFSVRGDAPVIIAAVDHNSLADVGGMKEGDFIVGIGDKDVKWASHEQVVRMIKQCGDFINLKLVT 642          
BLAST of Rhophilin-2-like Protein vs. Ensembl Cavefish
Match: rhpn1 (rhophilin Rho GTPase binding protein 1 [Source:NCBI gene;Acc:103039738])

HSP 1 Score: 286.96 bits (733), Expect = 1.968e-86
Identity = 176/575 (30.61%), Postives = 313/575 (54.43%), Query Frame = 1
Query:  169 TQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ--DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYL--FMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMK-IGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTIT 1875
            TQRSKL + R K+N++IN++LR+++GA NL   T ++++K  +++E+ F  SNL+L KEELE  N +++ YQ    K  +PMIP+ +K T +ID     ++ +  HYGED   Y+  ++     R+A++ P R++ G+   + YYN +  +++RFF P R+ G+ F W D  TGVP  QR   FEK  ++FN+GALY+Q+ +   ++T  G++ + + F  +   F +L  NF + PS+DM    L ML  LM  Q  EC    +       D  SNL+A +   ES  +S ++  V  ++++ LL+  +++P +W+++VQVK+ +++ALA+   A         + K  +   A++ L  +L     P    L  P  +L    L K  + +A+   EE+++L  + K LR ++ L   L+  H   +++   +++ + + ++   PE+Q           + T   S    +D F  LGP+ +F +R + +G  R + ++R +  G G T++G  P+ V  V     A ++GL  GD++++++  D RW+    +V +   CS   + +  IT
Sbjct:   33 TQRSKLQQRRAKLNQQINRELRLRTGAENLYRATTNQKVKETVSLELSFVNSNLQLLKEELEELNSSMEVYQTESEKVNVPMIPLGLKETKEIDMTIPLQDFISEHYGEDASLYMSEVKEFMDLRQAMRTPSRNDAGLELLMEYYNQLYFLDQRFFAPHRTLGVHFHWYDSLTGVPSCQRALAFEKGSVLFNIGALYTQIGARQDRSTLPGIQNAIDAFQRAAGAFLYLQENFSHAPSLDMSSPALSMLVRLMVAQVQECICERVTLTMEENDLMSNLQAAQ---ESARVSDVYSLVLQAMSVPLLK--DYVPFSWLSVVQVKTQHFRALAHYYTAAALCDCSDMIDKVNDCGSAVKAL--KLVHTRPPDTLCLQEPEDRLR---LGKGHLRKAIIRHEEALRLHGVCKMLRKMDILQEVLSYAHTRSLEKYSDIDQEDDFCEIAEAPEIQSHTYQ---KPDIKTPDFSSVRVTDIFHRLGPLSLFCARNRWVG--RRLCLVRGEA-GLGLTLRGDSPVLVAGVLPEGCAAEAGLHEGDYIVAVNGSDCRWAEHAEVVHVLKGCSERGVELDVIT 591          
BLAST of Rhophilin-2-like Protein vs. Ensembl Cavefish
Match: rhpn2 (rhophilin Rho GTPase binding protein 2 [Source:NCBI gene;Acc:103031065])

HSP 1 Score: 285.034 bits (728), Expect = 1.603e-85
Identity = 171/560 (30.54%), Postives = 308/560 (55.00%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTG--LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESY-DLLSCPEL--QVEARTGV-INQSLFTQIISQNPESDPFKSLGPIEIFNSRMK-IGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N + QT RSKL   R  +N++I K +RM++GA NL++ T + +++  + +E+ +  S+L+L  E+LE  N +++ YQ+++    +P+IP+ +K T D+DF   F++ +  HY ED   Y + I+ +   RKA + P R++ GI     Y+  ++ +E RFF P+R  GI F+W D FTGVP  Q+    EK+ I+FN+ ALY+Q+ + + + T +GLEES   F  S    +HL   F + PS DM P ML ML  +M  QA EC F  L    +  + FS    L++  E+  +  ++E V+ S+    ++  +++P  W  + QVK+++Y++LA+  ++   +   L  S D + QE A+  L   +     P     H    K E   + K  +  A+   EE++++  + + LR L+ L++ L   HK  + +    +K + + D +  P++  + E +  + +  S+  ++       D F  LGP+ +F+++ +   P  + + + D+ L  GFT+KG  P+++ +++   +A   GLK GD+V+++ D D +W
Sbjct:   27 NPLAQTGRSKLQNQRASLNQQIIKQMRMRAGAENLLKATSNNKVRDMVMLELSYVNSDLQLLMEQLEGLNSSVEVYQNVQGTAIIPLIPLGLKETKDVDFSVPFKDFILEHYSEDGANYQDEIDDLMDLRKACRTPSRNDAGIELLANYFTQLSLLESRFFSPNRQMGIFFTWYDSFTGVPVCQQNMSLEKASILFNMAALYTQIGTRSDRQTSSGLEESITAFQRSAGVLSHLKETFTHTPSYDMSPAMLSMLVKMMFAQAQECLFEKLALPGIRNEFFS---LLKMAQEAAMVGEMYEQVHQSMIQTPIK--DNVPFFWSIMAQVKTHHYRSLAHYFVSTALLDHQLNPSDDEDKQEKALSQLYDAMPDGRSPLDVLRH----KDERRRIGKAHLQRAVVGQEEALRIQGLCRDLRKLSVLNDILQASHKRSLAKFEQKDKEDEFTDYMEAPDIISKTEQKAEMEVPASIKVKV------KDLFHRLGPLSVFSAKQRWTAPRTVRLKVEDRDL--GFTLKGDAPVQIQSLDPLCHAAADGLKEGDYVVAVGDADSKW 569          
BLAST of Rhophilin-2-like Protein vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 108.227 bits (269), Expect = 1.242e-23
Identity = 81/309 (26.21%), Postives = 145/309 (46.93%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRF-FFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQ----EAIEDLSAELKQLIKPTKYHLHLPSSKLEAL 1308
            +PMI + +K   + +F  + +  +  +YGEDPD Y E ++ +   R++     R  EG      Y+  +++++ R    P +   +  SW ++F+G         +E++ I++NLGAL+S L +  ++ ++ G++ S  +F  S   F++L  +F +  SVDM  ++L +  NLM  QA EC         L +    N ++  +   S  +   ++    +L N +    L  I + W  LVQ+K  Y+ A+A         +L M K    Q    E +  L + L +L +  K     P S  EAL
Sbjct:    7 MPMIWLDLKEAGEFEFGAAVKQFILKNYGEDPDNYNEQLKKLEQLRQSAVNVTRDFEGCSTLRKYFGQLHYLQSRVPLGPGQEAAVPISWTEIFSGKTVTHEDISYEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFSYLRDHFSHSYSVDMSHQILNLNINLMLGQAQEC--------LLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSDTASMLGKIQKDWKKLVQMKIYYFAAIA---------HLHMGKQAEEQQKYGERLAYLQSSLDKLNEAIKLAKGQPDSVQEAL 298          
BLAST of Rhophilin-2-like Protein vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 99.7525 bits (247), Expect = 4.644e-21
Identity = 90/353 (25.50%), Postives = 161/353 (45.61%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRF-FFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQ----EAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLI---------------NEALPLIE--ESIKLAAMNKYL 1389
            +PMI + +K   + +F  + +  +  +YGEDPD Y E ++ +   R++     R  EG      Y+  +++++ R    P +   +  SW ++F+G         +E++ I++NLGAL+S L +  ++ ++ G++ S  +F  S   F++L  +F +  SVDM  ++L +  NLM  QA EC           +    N ++  +   S  +   ++    +L N +    L  I + W  LVQ+K  Y+ A+A         +L M K    Q    E +  L + L +L +  K     P S  EAL  +  +I               +EA+P +E   S+K A + K L
Sbjct:    7 MPMIWLDLKEAGEFEFGAAVKQFILKNYGEDPDNYNEQLKKLEQLRQSAVNVTRDFEGCSTLRKYFGQLHYLQSRVPLGPGQEAAVPISWTEIFSGKTVTHEDISYEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFSYLRDHFSHSYSVDMSHQILNLNINLMLGQAQECLL--------EKSMLDNRKSFLVARISAQVVDYYKEACRALENSDTASMLGKIQKDWKKLVQMKIYYFAAIA---------HLHMGKQAEEQQKYGERLAYLQSSLDKLNEAIKLAKGQPDSVQEALRFTMDVIGGKFNSAKKDNDFIYHEAVPSLETLPSVKGAPLVKAL 342          
BLAST of Rhophilin-2-like Protein vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 96.6709 bits (239), Expect = 4.685e-20
Identity = 66/255 (25.88%), Postives = 126/255 (49.41%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRF-FFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAY 1158
            +PMI + +K   + +F  + +  +  +YGEDPD Y E ++ +   R++     R  EG      Y+  +++++ R    P +   +  SW ++F+G         +E++ I++NLGAL+S L +  ++ ++ G++ S  +F  S   F++L  +F +  SVDM  ++L +  NLM  QA EC           +    N ++  +   S  +   ++    +L N +    L  I + W  LVQ+K  Y+ A+A+
Sbjct:    7 MPMIWLDLKEAGEFEFGAAVKQFILKNYGEDPDNYNEQLKKLEQLRQSAVNVTRDFEGCSTLRKYFGQLHYLQSRVPLGPGQEAAVPISWTEIFSGKTVTHEDISYEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFSYLRDHFSHSYSVDMSHQILNLNINLMLGQAQECLL--------EKSMLDNRKSFLVARISAQVVDYYKEACRALENSDTASMLGKIQKDWKKLVQMKIYYFAAIAH 253          
BLAST of Rhophilin-2-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004835.1 (pep scaffold:Pmarinus_7.0:GL480606:4394:25584:1 gene:ENSPMAG00000004381.1 transcript:ENSPMAT00000004835.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.498 bits (602), Expect = 7.282e-72
Identity = 122/338 (36.09%), Postives = 202/338 (59.76%), Query Frame = 1
Query:  166 QTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGL--PMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRAL-ELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLA 1170
            QTQRSKL   R K+N++INK++R+++GA NL+  T + ++K  + +E+ F  SNL+L KEEL   N +++ YQ+   G+  P+IP+ +K T ++DF   F+  +E HYGE  +KY E I+ +   R+A++ PRR+  G+   + YYN +  +E RF  P R +G+ F+W D  TG+P  QRT  FE+  ++FN+GALY+Q+ +   +T   GL  + + F  +   FN+L  NF + P++DM P  L ML  LM  Q  EC F   L   L  D    + AL  +  E+  +S ++   + +++   +   +++P +W  +V+VKS ++ AL++  +A
Sbjct:    7 QTQRSKLQTRRAKLNQQINKEMRLRAGAENLLRATNNNKVKETVALELSFVNSNLQLLKEELAELNSSMEIYQNDSEGISVPLIPLGLKETKEVDFLTPFKAFIEEHYGECGEKYEEEIKDLLELRQAMRTPRRNEVGVELLMEYYNQLYFVENRFCPPHRHSGVFFTWYDSLTGMPACQRTLAFERGSVLFNVGALYTQIGARQDRTAHDGLHSAIDAFQKAAGAFNYLKENFTHAPTLDMSPASLTMLVRLMAAQVQECVFERFLLQGLHND----VPALFNIAQEATRVSDVYNVTHQTMDQTAIT--DYVPVSWRTMVRVKSLHFLALSHHYVA 338          
BLAST of Rhophilin-2-like Protein vs. Ensembl Sea Lamprey
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 98.2117 bits (243), Expect = 3.630e-21
Identity = 69/275 (25.09%), Postives = 124/275 (45.09%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPD-RSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQE 1218
            +PMI + +K   D  F ++ +  +  HYGE+PDKY E +      R +     R  EG      Y+  +++++ R    + +   +   W D+FTG   +     FE++ I++NLGAL+S L    S+ ++ G++ S  +F  +   F +L  +F +  S DM   +L +   LM  QA EC           +    N ++  +   S  ++  ++     L N E+   L    + W   +QVK +Y+  +A          L+M K  + Q+
Sbjct:   23 MPMISLELKIADDFPFVDAVKQYIFGHYGEEPDKYNEELRKFEQLRSSAVAVTRDFEGCSTLRKYFGQLHYLQSRVPMGEGQDAAVTVIWKDIFTGKAVKYDDIHFEQAAILYNLGALHSLLGVMDSRQSEEGMKVSCTHFQCAAGAFTYLRDHFSHSYSADMSLGILNLYITLMLGQAQECLL--------EKSMLDNRKSFLIARISAQVAEYYKEACHFLENHEVSSLLGREQKEWKKQIQVKISYFSCIA---------NLYMGKQADEQQ 280          
BLAST of Rhophilin-2-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001449.1 (pep scaffold:Pmarinus_7.0:GL478971:7755:10135:1 gene:ENSPMAG00000001310.1 transcript:ENSPMAT00000001449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.094e-6
Identity = 23/96 (23.96%), Postives = 50/96 (52.08%), Query Frame = 1
Query: 1594 GPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEM 1881
            GP+ +F+++      R V ++     G+G  ++G  P++V  VE  S AE +G+K GD ++++   D +W+    +V+         +T+  ++ +
Sbjct:    1 GPLSVFSAKHSWTSPRSVKLVPCAD-GYGLVLRGDSPVRVATVETGSVAELAGVKNGDCIVALGGEDCKWAKHVDVVEAMRSADAAGVTLLIVSPL 95          
BLAST of Rhophilin-2-like Protein vs. Ensembl Yeast
Match: RIM20 (Protein involved in proteolytic activation of Rim101p; part of response to alkaline pH; PalA/AIP1/Alix family member; interaction with the ESCRT-III subunit Snf7p suggests a relationship between pH response and multivesicular body formation [Source:SGD;Acc:S000005801])

HSP 1 Score: 68.5514 bits (166), Expect = 1.886e-12
Identity = 68/266 (25.56%), Postives = 120/266 (45.11%), Query Frame = 1
Query:  406 MIPIAMKNTVDIDFKNSFRNILENHYGEDPDKY-IEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFT--GVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHL---NTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENV--YSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRF 1179
            ++ I +K T+++DF      +++    +    +  + +++V++R  AI  P  S +G+     YY ++  +EK+F  P+  N I F+W    +       Q +  +EK  II+N+G +YS LA  ++      L+ S  YF N+  CF H+     N    P VD     L  L +LM  QA EC +                +A++   +   I+ L + +  +    I   Q  + I   WIN ++ K  Y+ A+ Y  +A  F
Sbjct:    4 LLAIPLKRTLEVDFATELSKLIDTTSFQTASFFQSDILKVVDARNNAIA-PDISIDGLSALKEYYVILLQLEKKF--PN--NQIEFTWFQTLSQKSRGTSQYSLQWEKLTIIYNIGCMYSLLALNSNNDAAESLKTSCLYFQNAAGCFKHVLDHQKNLETIPVVD--DATLNALTSLMLAQAQECFW---------------FKAVQDKHKDSLIAKLSQQIVDFYCEAINDAQRGKLIRSDWINHLKAKKAYFSAVTYYRIALSF 247          
BLAST of Rhophilin-2-like Protein vs. Ensembl Yeast
Match: BRO1 (Cytoplasmic class E vacuolar protein sorting (VPS) factor; coordinates deubiquitination in the multivesicular body (MVB) pathway by recruiting Doa4p to endosomes [Source:SGD;Acc:S000006005])

HSP 1 Score: 62.003 bits (149), Expect = 2.443e-10
Identity = 45/189 (23.81%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  406 MIPIAMKNTVDIDFKNSFRNILENHYGED------PDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDV-----FTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAME 939
            +  + +K+T  +D+K    + L+  YG         +K    ++ + +       P   +E    ++ YY+ + H+  R         + F+W D        G+ + Q T  FEKS  +FN+  +++Q+A    +      + S      + +CF +L+ NF+N PSVD++ E  + LAN+   +A E
Sbjct:    5 LFDLKLKDTEKLDWKKGLSSYLKKSYGSSQWRTFYDEKATSELDHLRNNANGELAPSSLSE---QNLKYYSFLEHLYFRLGSKGSRLKMDFTWYDAEYSSAQKGLKYTQHTLAFEKSCTLFNIAVIFTQIAR---ENINEDYKNSIANLTKAFSCFEYLSENFLNSPSVDLQSENTRFLANICHAEAQE 187          
BLAST of Rhophilin-2-like Protein vs. Ensembl Nematostella
Match: EDO34525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP33])

HSP 1 Score: 261.922 bits (668), Expect = 4.602e-77
Identity = 179/632 (28.32%), Postives = 297/632 (46.99%), Query Frame = 1
Query:   82 SMNSSSKMSEKFETLAIENRDRKNNRIF-QTQRSKLHENREKINEKINKDLRMKSGARNLIEL---TKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ---DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEA-----IEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLF--TQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVN------------------------------------VEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQ 1827
            + N  +K      T+A   R+ +N  ++ ++ R +L   R+ +N KI+K  +++ GA NLI+    T D+++K    +E+ F    L   +EELE  NC+LD YQ    ++  +PMIP+ ++ T D+DF + F+  L++HY EDP+KY E        RK +  P R  +GI+    YYN +  +E++FF    S  + F W D  TG+P  QR++ FEK+ ++FN+GAL+SQ+ +   + T  G+EE+   F  +   F  +  NF+N PSVDM  + L+ L  LM VQA  C +     L    D F     ++   E   IS  ++ V   +N  +   ++ IP AW NLV++ S +YKAL++   A   +     +     E      I D+ +  K+  K  K HLH                  AL   EE+++   + ++ R +  L   L        ++L  + + + +D    P   V+A    + Q  F  +      P  D F  LGP+ IFN+   +G +R V I R+    FGF+V G  PM + +                                    ++    A ++G++VGD V+ ++  D++W     +V+
Sbjct:   20 TTNPVTKKRRSHGTVARVLRENENAAVYRESGRWQLQHKRQALNRKIHKQTKLRDGAENLIKALKSTNDRKLKHAARMELSFASFQLDQLQEELEGINCSLDVYQFDGTMEKQVPMIPLGLRETQDVDFCSQFKEFLQDHYDEDPEKYTEEFARYRKLRKTMCNPSRDKDGILSLYEYYNQMYFVERKFFPKRGSMAVYFHWYDAMTGLPKVQRSAAFEKASVMFNIGALWSQIGTKQDRGTAEGVEEACMAFQKAAGAFRFIRDNFMNSPSVDMTQDTLEALIPLMLVQAQACMWEKRRLLHDDVDGFQE--CIQAGQECAEISQGYKRVQLLMNSGIC--MDSIPTAWRNLVKIMSAHYKALSHYHTAAGLLQCPAGETSGLHEMLSSLYISDMDSGPKRK-KQAKAHLHA-----------------ALRHHEEAMRARQVCRFCRRVLSLHKVLTVARDMSTNKLVGMEEEDDFDAPLAP-TPVKA---YVRQKAFPISPEFHMAPVEDLFYKLGPVHIFNAENTLGASRTVTIHRENG-SFGFSVIGSAPMIIQSIDDQGAAWVSNDQEAAWVIDDQEAAWVIDDQRPFWVIDSQGAASEAGVQVGDIVIGVNGEDVKWGEHHDVVE 624          
BLAST of Rhophilin-2-like Protein vs. Ensembl Nematostella
Match: EDO45795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP2])

HSP 1 Score: 75.485 bits (184), Expect = 4.799e-14
Identity = 64/262 (24.43%), Postives = 118/262 (45.04%), Query Frame = 1
Query:  409 IPIAMKNTVDIDFKNSFRNILENHYGEDPDKY-IEAIELVNSRRKA--IQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVF-TGVPFQQR-----TSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFV----NPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALA 1155
            I I  K +  +DFK      ++N + ED  K   +AI  +N  R +  +Q P +    +   + YY+ +  IE +    +    + F+W D F  G  F  +     TS +E+  ++FN+GAL SQ+AS  +  T  GL+ +   F ++  CFN L  +        P+ DM  EML  L ++M  Q  E  +      K+ +   + + A         +S  +     +  ++ ++  + + + W  ++  K  Y+KA++
Sbjct:    5 IVIPCKRSEAVDFKKPLEKFIKNTFSEDVLKENSDAISDLNKLRNSAVMQTPDKHESALEPLLRYYDQLVAIEGKLPINESQIRVSFTWFDCFDKGSLFGYKKASLATSAYERLCLLFNIGALESQIASAQNLQTDDGLKLAAKMFQSASGCFNLLKDSVYAQLHQVPTPDMSVEMLNALGSIMLAQGQESIWFKTEHDKMKDGIIAKVAA--------QLSDFYNEANQACQVQTVK--QQLEKEWTAVLGAKQKYFKAIS 256          
BLAST of Rhophilin-2-like Protein vs. Ensembl Medaka
Match: rhpn1 (rhophilin Rho GTPase binding protein 1 [Source:NCBI gene;Acc:101168940])

HSP 1 Score: 295.819 bits (756), Expect = 1.479e-89
Identity = 179/586 (30.55%), Postives = 310/586 (52.90%), Query Frame = 1
Query:  166 QTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGL--PMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLS-----------AELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYD-LLSCPELQVEA--RTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTIT 1875
            QTQRSKL   R +IN++INK++RM++GA NL   T + ++K  + +E+ F  SNL+L KEELE  N  ++ YQ     +  PMIP+ +K T D+DF    ++ +  HYGED  +Y   +  +   R+A++ P R+  G+   + YYN + ++++RFF   R+ G+ F W D  TGVP  QR   FEK  ++FN+GALY+Q+ +   +   A ++ + + F  +   FN+L  NF N PS+DM    L ML  LM  Q  EC F  +          S LR   L  E+  +S ++  V  ++   L++  +++P  W ++VQVKS +++AL++   A       +S      +   + +             L+Q+++  +        K   LG + L    AL   EE+++L  + K LR ++ L + L+  HK  +D+  +L++ + +D     PE+Q ++  +  V   +  T  +     +D F+ LGP+ +F +R + GP R++ + R +  G G T++G  P+ V  V     AE++GL+ GD+++++D  D +W+    +V +   CS     ++ +T
Sbjct:   44 QTQRSKLQHRRARINQQINKEMRMRAGAENLFRATTNNKVKETVALELSFVNSNLQLLKEELEELNSNMEVYQTDSEAVKVPMIPLGLKETKDVDFTIPIQDFICEHYGEDSSQYDREVRELMELRQAMRTPSRNQAGLELLMEYYNQLYYVDQRFFSAHRNLGVHFHWYDSLTGVPSSQRALAFEKGSVLFNIGALYTQIGARQDRCATADIDAAIDAFQRAAGAFNYLKENFSNAPSLDMSAPSLSMLVRLMLAQVQECVFERIALASRSAHFSSQLR---LSQEAARVSDVYLLVQQTMTQPLMK--DYVPFPWASMVQVKSEHFRALSHYYAAAALCEHTLSAKEEEGDQEAEEAFLGFYANVPAGQSLRQVLQDAE--------KRRKLGKAHLRC--ALIRHEEAMRLHGLCKILRKMDILQDVLSLAHKRSLDKYSALDREDDFDETAEAPEIQAQSQQKPDVTPPNFSTVQV-----TDIFQRLGPLSVFCARARWGPVRVICLQRREG-GLGLTLRGDSPVLVAGVVPGGCAEEAGLREGDYIVAVDGLDCKWAKHAEVVHLLKSCSDSGTDISVVT 608          
BLAST of Rhophilin-2-like Protein vs. Ensembl Medaka
Match: rhpn2 (rhophilin Rho GTPase binding protein 2 [Source:NCBI gene;Acc:101173292])

HSP 1 Score: 262.692 bits (670), Expect = 3.122e-77
Identity = 175/569 (30.76%), Postives = 300/569 (52.72%), Query Frame = 1
Query:  154 NRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLK--TGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFI--YLFMSKDVNSQE-AIEDLSAELKQLIKPTKYHLHLPSSKL-EALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKH-------------ESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRW 1803
            N + QT RSKL + R  +N++I K +R+++GA NL++ T + ++K  + +E+ F  S+L+L   +L+  N ++D YQ+ +    +P+I + +K T ++DF   F++ +  HY ED  K+ + I  +   R+A + P RS  G+     YYN +  IE RFF P    GI F+W D FTGVP  Q+    EK+ I+FN+ AL+SQ+ + +++ T AGLEE+ + F  +    N+L   F + PS DM P ML ML  LM  QA EC F     L    +KF+ +  +++  E+  ++ +++ V+  + I+  Q  +++P  W  + QVK+N+Y ++A+  +A   +   L    D + QE     +  +  +   P      L  ++L E LG  K  I ++    EE++++  M   L N + L + L   H       HSL+K+             E+ ++LS  E + E  T            S+    D F  LGP+ +F+++    P R V +  + +   GFT+KG  P++VV+++    A K GLK GD+++++ D + +W
Sbjct:   25 NPLAQTGRSKLQKERAVLNQQIIKQMRIRAGAENLLKATSNNKVKEMVLLELSFVNSDLQLLMGQLDALNSSVDVYQNKQETVNIPLIALGLKETKEVDFSAPFKDFIMEHYNEDSRKFEDEIADLMDLREACRTPSRSEAGVELLEKYYNHLPMIESRFFAPTNQTGIFFTWYDSFTGVPVCQQNLSLEKASILFNMAALFSQIGTRSNRQTTAGLEEAISSFQKASGILNYLKETFTHTPSFDMGPAMLSMLIRLMLAQAQECLF-EKSVLPGTRNKFNAM--IKVAQEAAKVAEVYDQVHQCM-IQ-TQLKDNVPLFWSTMTQVKTNHYSSMAHYFVAVALLDHQLGPKDDEDHQEKTFSQVYDQFPEGWTPLDV---LKQTELRERLG--KAHIRKSTSGHEEALRIFDMCPNLNNHDVLRDILKTSH------YHSLDKYTEFENEEEFTDYMEAPNILSKTERKAEMETPS---------TSKVKVKDFFHRLGPLTVFSAKQHWTPPRTVRLCPEGR-DLGFTLKGGSPVQVVSLDPLCVAAKDGLKEGDYIVAVGDTECKW 567          
BLAST of Rhophilin-2-like Protein vs. Ensembl Medaka
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:101156355])

HSP 1 Score: 100.523 bits (249), Expect = 2.829e-21
Identity = 67/255 (26.27%), Postives = 124/255 (48.63%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRF-FFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAY 1158
            +PMI + +K   +  F  S R  +  +YGE+PD Y E ++ + + R++     R  EG      Y+  +++++ R      +   +  SW ++F+G         +E++ I++NLGAL+S L +  ++ ++ G++ S  +F  S   F +L  +F +  SVDM  ++L +  NLM  QA EC           +    N ++  +   S  +   ++    +L N E    L  I + W  LVQ+K  Y+ A+A+
Sbjct:    7 MPMIWLDLKEAGEFQFSPSVRQFILKNYGENPDNYNEQMKKLETLRQSAVNVTRDFEGCSTLRKYFGQLHYLQSRVPMGAGQEAAVPISWTEIFSGKNVTHDDISYEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFTYLRDHFSHNFSVDMSHQILNLNINLMLGQAQECLL--------EKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIAH 253          
BLAST of Rhophilin-2-like Protein vs. Ensembl Medaka
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:101156355])

HSP 1 Score: 92.4337 bits (228), Expect = 1.032e-18
Identity = 71/275 (25.82%), Postives = 129/275 (46.91%), Query Frame = 1
Query:  400 LPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRF-FFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSL-NIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQE 1218
            +PMI + +K   +  F  S R  +  +YGE+PD Y E ++ + + R++     R  EG      Y+  +++++ R      +   +  SW ++F+G         +E++ I++NLGAL+S L +  ++ ++ G++ S  +F  S   F +L  +F +  SVDM  ++L +  NLM  QA EC           +    N ++  +   S  +   ++    +L N E    L  I + W  LVQ+K  Y+ A+A         +L M K    Q+
Sbjct:    7 MPMIWLDLKEAGEFQFSPSVRQFILKNYGENPDNYNEQMKKLETLRQSAVNVTRDFEGCSTLRKYFGQLHYLQSRVPMGAGQEAAVPISWTEIFSGKNVTHDDISYEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFTYLRDHFSHNFSVDMSHQILNLNINLMLGQAQECLL--------EKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIA---------HLHMGKQAEEQQ 264          
BLAST of Rhophilin-2-like Protein vs. Ensembl Medaka
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:101156751])

HSP 1 Score: 72.4034 bits (176), Expect = 1.208e-12
Identity = 56/223 (25.11%), Postives = 107/223 (47.98%), Query Frame = 1
Query:  409 IPIAMKNTVDIDFKNSFRNILENHY--GEDPDKYIEAIELVNSRRK-AIQYPRRSNEGIIDHIL-YYNLINHIEKRFFFPDRSNGIIFSWNDVF-------TGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNP----PSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNL--RALELVGESF 1026
            I + +K + ++D        +   Y  GED  +YI A+E +N  RK A+  P   ++  ++ +L YY+ +  +E +F F +    + F+W D F         V     +  +EK+ ++FN  AL SQ+A+  +      L+ +  Y+  +   F+H+    ++     P++D+ PE +  L+ +M  QA E  FL     K+ +   + L  +A +  G++F
Sbjct:    5 ISVPLKKSSEVDLVKPLSKYITVTYPAGEDQTEYIRAVEELNKLRKNALGRPLDKHDSSLEILLRYYDQLCALEPKFPFSENQICLSFTWKDAFDKGSLFGGSVKLSLASLGYEKTCVLFNCAALASQIAAEQNMDNDECLKTAAKYYQLASGAFSHIKDTVLSALSREPTMDICPETVGTLSLIMLAQAQEVFFLKATSDKMKDAVIAKLANQAADFYGDAF 227          
BLAST of Rhophilin-2-like Protein vs. Planmine SMEST
Match: SMESG000022872.1 (SMESG000022872.1)

HSP 1 Score: 1306.2 bits (3379), Expect = 0.000e+0
Identity = 660/663 (99.55%), Postives = 661/663 (99.70%), Query Frame = 1
Query:   85 MNSSSKMSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEMGLTRNHTFSTSAPFDLNKSSQPDXXXXXXPNRKTGKLSWKQRLSGTLXXXXXXXXQPQTVSTLF 2073
            MNSSSKMSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGI DHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFLLLLKLKLLEDKFSNLRALELVGESFA+SILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEMGLTRNHTFSTSAPFDLNKS QPDSLSLSLPNRKTGKLSWKQRLSGTLKKKSSKSSQPQTVSTLF
Sbjct:    1 MNSSSKMSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGISDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFLLLLKLKLLEDKFSNLRALELVGESFAVSILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEMGLTRNHTFSTSAPFDLNKSLQPDSLSLSLPNRKTGKLSWKQRLSGTLKKKSSKSSQPQTVSTLF 663          
BLAST of Rhophilin-2-like Protein vs. Planmine SMEST
Match: SMESG000022872.1 (SMESG000022872.1)

HSP 1 Score: 1292.72 bits (3344), Expect = 0.000e+0
Identity = 654/657 (99.54%), Postives = 655/657 (99.70%), Query Frame = 1
Query:  103 MSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEMGLTRNHTFSTSAPFDLNKSSQPDXXXXXXPNRKTGKLSWKQRLSGTLXXXXXXXXQPQTVSTLF 2073
            MSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGI DHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFLLLLKLKLLEDKFSNLRALELVGESFA+SILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEMGLTRNHTFSTSAPFDLNKS QPDSLSLSLPNRKTGKLSWKQRLSGTLKKKSSKSSQPQTVSTLF
Sbjct:    1 MSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLRMKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQDLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSRRKAIQYPRRSNEGISDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTGVPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFLLLLKLKLLEDKFSNLRALELVGESFAVSILFENVYSSLNIELLQFLEHIPQAWINLVQVKSNYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHLPSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHKSWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPFKSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEMGLTRNHTFSTSAPFDLNKSLQPDSLSLSLPNRKTGKLSWKQRLSGTLKKKSSKSSQPQTVSTLF 657          
BLAST of Rhophilin-2-like Protein vs. Planmine SMEST
Match: SMESG000019014.1 (SMESG000019014.1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.106e-7
Identity = 46/189 (24.34%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  631 FPDRSNG--IIFSWNDVFTGVP-FQQRTSV------FEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEACFNHLNTNFVN----PPSVDMKPEMLQMLANLMRVQAMECKFXXXXXXXXXEDKFSNLRALELVGESFAISILFENVYSSLNIELLQFLEHI-PQAWINLVQVKSNYYKALA 1155
             P   NG  I F W+D F     F ++ S+      +E+  ++FN+ A+YSQ+A   + +  +GL+ +  YF  +   F++L ++  N     P+ D+  + L  L  +M  QA E  +   ++    +   + +  ++ V + +A           L +  L  ++ I P+ WI +V  K   Y A+A
Sbjct:   80 IPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKI--VQQVADLYA---------DGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMA 257          
BLAST of Rhophilin-2-like Protein vs. Planmine SMEST
Match: SMESG000022937.1 (SMESG000022937.1)

HSP 1 Score: 51.2174 bits (121), Expect = 2.662e-6
Identity = 21/57 (36.84%), Postives = 39/57 (68.42%), Query Frame = 1
Query: 1672 GFGFTVKGQGPMKVVNVEKNSNAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKC 1842
            GFGFT+ G  P+ V +V+ +S+AE +G+  GD ++ +D++++  SS E +V++   C
Sbjct:  422 GFGFTLCGGSPVYVSHVDVDSSAELAGIHPGDMIIKIDNFNVSQSSTEAVVRMFRMC 478          
The following BLAST results are available for this feature:
BLAST of Rhophilin-2-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RHPN23.302e-7528.62rhophilin Rho GTPase binding protein 2 [Source:HGN... [more]
RHPN13.966e-6628.20rhophilin Rho GTPase binding protein 1 [Source:HGN... [more]
PTPN231.673e-1724.82protein tyrosine phosphatase non-receptor type 23 ... [more]
PDCD6IP1.102e-1527.32programmed cell death 6 interacting protein [Sourc... [more]
PDCD6IP3.111e-1427.55programmed cell death 6 interacting protein [Sourc... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alx-11.866e-1224.52Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-12.069e-1224.52Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-12.550e-1224.52Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-12.550e-1224.52Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-11.054e-1124.52Apoptosis-linked gene 2-interacting protein X 1 [... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rhp4.315e-9133.06gene:FBgn0026374 transcript:FBtr0074095[more]
Rhp4.315e-9133.06gene:FBgn0026374 transcript:FBtr0074096[more]
mop3.779e-721.08gene:FBgn0036448 transcript:FBtr0075700[more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhpn14.430e-8330.69rhophilin, Rho GTPase binding protein 1 [Source:ZF... [more]
rhpn11.363e-8230.64rhophilin, Rho GTPase binding protein 1 [Source:ZF... [more]
rhpn28.252e-7729.48rhophilin, Rho GTPase binding protein 2 [Source:NC... [more]
ptpn23a2.811e-2226.21protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn23a5.813e-2125.88protein tyrosine phosphatase, non-receptor type 23... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhpn22.661e-9232.81rhophilin, Rho GTPase binding protein 2 [Source:NC... [more]
rhpn21.102e-9032.50rhophilin, Rho GTPase binding protein 2 [Source:NC... [more]
rhpn22.505e-9032.80rhophilin, Rho GTPase binding protein 2 [Source:NC... [more]
rhpn21.535e-8732.30rhophilin, Rho GTPase binding protein 2 [Source:NC... [more]
rhpn22.217e-8731.76rhophilin, Rho GTPase binding protein 2 [Source:NC... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rhpn25.169e-8029.52rhophilin, Rho GTPase binding protein 2 [Source:MG... [more]
Rhpn25.169e-8029.52rhophilin, Rho GTPase binding protein 2 [Source:MG... [more]
Rhpn12.363e-7228.37rhophilin, Rho GTPase binding protein 1 [Source:MG... [more]
Rhpn13.516e-7028.02rhophilin, Rho GTPase binding protein 1 [Source:MG... [more]
Rhpn11.624e-5731.96rhophilin, Rho GTPase binding protein 1 [Source:MG... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63ZR5|RHN2B_XENLA7.941e-8932.39Rhophilin-2-B OS=Xenopus laevis OX=8355 GN=rhpn2-b... [more]
sp|Q6DJJ6|RHN2A_XENLA1.323e-8831.54Rhophilin-2-A OS=Xenopus laevis OX=8355 GN=rhpn2-a... [more]
sp|A4FUC9|RHPN2_BOVIN7.796e-8230.67Rhophilin-2 OS=Bos taurus OX=9913 GN=RHPN2 PE=2 SV... [more]
sp|Q8BWR8|RHPN2_MOUSE3.615e-7929.52Rhophilin-2 OS=Mus musculus OX=10090 GN=Rhpn2 PE=1... [more]
sp|Q8HXG3|RHPN2_CANLF6.638e-7929.51Rhophilin-2 OS=Canis lupus familiaris OX=9615 GN=R... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A139WFV47.810e-10635.20Rhophilin-2-like Protein OS=Tribolium castaneum OX... [more]
A0A139WFS41.333e-10535.89Rhophilin-2-like Protein OS=Tribolium castaneum OX... [more]
A0A1Y1L5A06.381e-10535.16Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A151X3277.052e-10534.49Rhophilin-2 OS=Trachymyrmex zeteki OX=64791 GN=ALC... [more]
A0A026X5U63.075e-10433.79Rhophilin-2 OS=Ooceraea biroi OX=2015173 GN=X777_1... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhpn11.968e-8630.61rhophilin Rho GTPase binding protein 1 [Source:NCB... [more]
rhpn21.603e-8530.54rhophilin Rho GTPase binding protein 2 [Source:NCB... [more]
ptpn23a1.242e-2326.21protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a4.644e-2125.50protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a4.685e-2025.88protein tyrosine phosphatase non-receptor type 23 ... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004835.17.282e-7236.09pep scaffold:Pmarinus_7.0:GL480606:4394:25584:1 ge... [more]
ptpn23b3.630e-2125.09protein tyrosine phosphatase, non-receptor type 23... [more]
ENSPMAT00000001449.11.094e-623.96pep scaffold:Pmarinus_7.0:GL478971:7755:10135:1 ge... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RIM201.886e-1225.56Protein involved in proteolytic activation of Rim1... [more]
BRO12.443e-1023.81Cytoplasmic class E vacuolar protein sorting (VPS)... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO345254.602e-7728.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457954.799e-1424.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhpn11.479e-8930.55rhophilin Rho GTPase binding protein 1 [Source:NCB... [more]
rhpn23.122e-7730.76rhophilin Rho GTPase binding protein 2 [Source:NCB... [more]
ptpn23a2.829e-2126.27protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a1.032e-1825.82protein tyrosine phosphatase non-receptor type 23 ... [more]
pdcd6ip1.208e-1225.11programmed cell death 6 interacting protein [Sourc... [more]
back to top
BLAST of Rhophilin-2-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000022872.10.000e+099.55SMESG000022872.1[more]
SMESG000022872.10.000e+099.54SMESG000022872.1[more]
SMESG000019014.14.106e-724.34SMESG000019014.1[more]
SMESG000022937.12.662e-636.84SMESG000022937.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033108 ID=SMED30033108|Name=Rhophilin-2-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2194bp
TTTAATTTTGAATGTGCTTAAAGAATAATTTTTCTCACATTGAAAAATAA
GCTTCCCATCATACCATAATTTTATTTTTTGAGCATGAATTCAAGTAGCA
AAATGTCGGAAAAATTCGAAACGCTTGCAATCGAAAATAGAGATCGGAAA
AACAATAGAATATTTCAAACTCAACGTTCGAAGCTTCACGAAAATCGCGA
AAAGATCAACGAGAAAATTAACAAAGATTTACGAATGAAATCTGGAGCAC
GAAATTTAATTGAACTGACCAAAGACAAAAGAATAAAGTCTAAAATAAAT
ATCGAAATTGATTTTTTCGAGTCAAATTTGAAATTATGGAAAGAAGAATT
GGAAAGAGCGAACTGTGCATTGGATACCTATCAAGATTTAAAAACCGGGT
TACCAATGATTCCTATTGCCATGAAAAACACTGTCGACATCGATTTCAAA
AACTCATTCCGTAATATTTTGGAAAATCATTATGGAGAAGATCCTGACAA
ATATATCGAGGCGATTGAGTTGGTCAATTCCAGACGAAAAGCAATCCAAT
ATCCAAGGAGGTCAAATGAAGGAATCATCGATCACATTCTTTATTACAAT
TTGATTAACCATATTGAAAAACGATTCTTTTTCCCCGACCGAAGCAATGG
TATTATATTTTCATGGAATGACGTTTTCACCGGGGTCCCGTTTCAGCAAA
GAACTTCAGTCTTTGAAAAAAGTGGAATTATTTTCAATTTAGGAGCACTC
TACTCTCAGTTGGCATCTGGAACGAGTAAAACTACTCAAGCAGGACTCGA
AGAGTCACAGAATTATTTCCTAAATTCAGAAGCATGTTTTAATCATCTCA
ACACTAATTTTGTAAATCCACCCAGTGTAGACATGAAACCTGAAATGCTG
CAAATGTTAGCTAATTTAATGAGGGTTCAAGCAATGGAATGCAAGTTTTT
ACTGCTATTGAAATTAAAATTGCTGGAAGACAAATTTTCGAATCTTAGAG
CACTAGAACTTGTGGGAGAGTCGTTTGCAATATCTATTCTGTTTGAAAAC
GTCTACAGTAGCTTGAACATAGAATTGTTACAATTCCTAGAGCACATTCC
ACAGGCATGGATTAATCTCGTACAAGTCAAATCCAATTACTACAAAGCGC
TCGCATATAAGATGCTTGCTAATAGATTTATATACCTCTTCATGTCGAAA
GATGTCAATTCCCAGGAAGCAATTGAAGATTTAAGTGCAGAACTGAAGCA
GCTTATCAAACCGACAAAGTATCATTTACATTTACCTTCAAGCAAGCTTG
AAGCCCTTGGGCTCTCTAAGTTATTAATAAATGAAGCGTTACCTTTGATA
GAAGAATCCATCAAATTAGCTGCAATGAACAAATATTTGAGAAATCTAAA
TGATTTGTCAAATTTCTTAAATAATGAACACAAAAGTTGGATTGATCAGC
TTCATTCACTGAACAAGCATGAATCTTATGATTTACTATCGTGCCCAGAA
TTGCAAGTCGAGGCTCGAACTGGGGTCATTAATCAGTCATTATTCACGCA
AATCATTTCCCAAAATCCAGAATCCGATCCATTCAAATCCCTCGGTCCAA
TAGAAATATTCAACAGCCGAATGAAGATTGGACCGGCTCGAATCGTTGTA
ATTATTAGAGATCAGAAATTGGGATTCGGATTTACTGTCAAAGGTCAAGG
TCCAATGAAAGTTGTAAATGTCGAGAAAAACAGCAACGCAGAAAAAAGTG
GCCTTAAAGTTGGAGATTTCGTTTTATCAATGGACGATTACGATTTAAGA
TGGTCGTCCCAGGAAGTTTTAGTTCAGATCACTGCCAAATGTTCCTTGAT
CAAATTGACTGTGACAACTATTACAGAGATGGGATTGACTAGAAATCACA
CATTTTCAACATCAGCACCCTTTGATTTGAACAAATCTTCACAACCAGAC
AGTTTGAGTCTATCATTACCTAATCGGAAAACTGGAAAACTGTCATGGAA
ACAAAGACTTTCTGGTACATTGAAAAAGAAATCCTCCAAATCGTCACAAC
CCCAAACAGTCAGTACATTGTTTTAGAGAATTATTTGTTTTTATCATATC
ATTTCCGAGAGATCATTCCAAGATGCTAGCATATCATTTAAAATTAATTG
GATATTTTTTAAATTTTCATATTCATAATAAATTTTATACTGCG
back to top

protein sequence of SMED30033108-orf-1

>SMED30033108-orf-1 ID=SMED30033108-orf-1|Name=SMED30033108-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=664bp
MNSSSKMSEKFETLAIENRDRKNNRIFQTQRSKLHENREKINEKINKDLR
MKSGARNLIELTKDKRIKSKINIEIDFFESNLKLWKEELERANCALDTYQ
DLKTGLPMIPIAMKNTVDIDFKNSFRNILENHYGEDPDKYIEAIELVNSR
RKAIQYPRRSNEGIIDHILYYNLINHIEKRFFFPDRSNGIIFSWNDVFTG
VPFQQRTSVFEKSGIIFNLGALYSQLASGTSKTTQAGLEESQNYFLNSEA
CFNHLNTNFVNPPSVDMKPEMLQMLANLMRVQAMECKFLLLLKLKLLEDK
FSNLRALELVGESFAISILFENVYSSLNIELLQFLEHIPQAWINLVQVKS
NYYKALAYKMLANRFIYLFMSKDVNSQEAIEDLSAELKQLIKPTKYHLHL
PSSKLEALGLSKLLINEALPLIEESIKLAAMNKYLRNLNDLSNFLNNEHK
SWIDQLHSLNKHESYDLLSCPELQVEARTGVINQSLFTQIISQNPESDPF
KSLGPIEIFNSRMKIGPARIVVIIRDQKLGFGFTVKGQGPMKVVNVEKNS
NAEKSGLKVGDFVLSMDDYDLRWSSQEVLVQITAKCSLIKLTVTTITEMG
LTRNHTFSTSAPFDLNKSSQPDSLSLSLPNRKTGKLSWKQRLSGTLKKKS
SKSSQPQTVSTLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR038499BRO1_sf
IPR036274HR1_rpt_sf
IPR001478PDZ
IPR004328BRO1_dom
IPR011072HR1_rho-bd
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 75..102
NoneNo IPR availableGENE3DG3DSA:1.10.287.160coord: 12..95
e-value: 2.2E-5
score: 26.3
NoneNo IPR availablePANTHERPTHR23031FAMILY NOT NAMEDcoord: 9..627
NoneNo IPR availablePANTHERPTHR23031:SF15LD12055Pcoord: 9..627
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 519..593
e-value: 2.17854E-12
score: 61.0434
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 529..597
e-value: 4.9E-9
score: 46.0
IPR001478PDZ domainPFAMPF00595PDZcoord: 525..593
e-value: 1.1E-5
score: 25.7
IPR001478PDZ domainPROSITEPS50106PDZcoord: 520..572
score: 10.375
IPR004328BRO1 domainSMARTSM01041BRO1_2coord: 107..515
e-value: 3.4E-52
score: 189.4
IPR004328BRO1 domainPFAMPF03097BRO1coord: 108..511
e-value: 1.9E-54
score: 185.0
IPR004328BRO1 domainPROSITEPS51180BRO1coord: 107..663
score: 34.528
IPR011072HR1 rho-binding domainSMARTSM00742hr1_7coord: 36..99
e-value: 0.0029
score: 26.8
IPR011072HR1 rho-binding domainPFAMPF02185HR1coord: 38..98
e-value: 1.4E-8
score: 34.7
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 508..611
e-value: 8.4E-15
score: 56.5
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 512..593
IPR038499BRO1 domain superfamilyGENE3DG3DSA:1.25.40.280coord: 101..433
e-value: 1.5E-59
score: 203.7
IPR036274HR1 repeat superfamilySUPERFAMILYSSF46585HR1 repeatcoord: 22..93