Dihydropteridine reductase

Overview
NameDihydropteridine reductase
Smed IDSMED30033100
Length (bp)877
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dihydropteridine reductase (SMED30033100) t-SNE clustered cells

Violin plots show distribution of expression levels for Dihydropteridine reductase (SMED30033100) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dihydropteridine reductase (SMED30033100) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dihydropteridine reductase (SMED30033100) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033100

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033100SMESG000060612.1 dd_Smed_v4_2408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033100SMESG000060612.1 dd_Smed_v4_2408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033100SMESG000060612.1 dd_Smed_v4_2408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30033100SMESG000060612.1 dd_Smed_v4_2408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033100SMESG000060612.1 dd_Smed_v4_2408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033100SMESG000060612.1 dd_Smed_v4_2408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033100SMESG000060612.1 dd_Smed_v4_2408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033100SMESG000060612.1 Contig51144uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033100SMESG000060612.1 Contig51144newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033100SMESG000060612.1 Contig14514uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033100SMESG000060612.1 Contig14514newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30033100SMESG000060612.1 SMED30033100smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30033100SMESG000060612.1 dd_Smed_v6_2408_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dihydropteridine reductase vs. Ensembl Human
Match: QDPR (quinoid dihydropteridine reductase [Source:HGNC Symbol;Acc:HGNC:9752])

HSP 1 Score: 211.46 bits (537), Expect = 2.752e-67
Identity = 110/228 (48.25%), Postives = 148/228 (64.91%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  ++ V SVD+ +NE+A  +++V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ IW+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G   +PSSGSLIQ++T    T
Sbjct:   11 RRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKN-RPSSGSLIQVVTTEGRT 237          
BLAST of Dihydropteridine reductase vs. Ensembl Human
Match: QDPR (quinoid dihydropteridine reductase [Source:HGNC Symbol;Acc:HGNC:9752])

HSP 1 Score: 187.193 bits (474), Expect = 2.913e-58
Identity = 100/228 (43.86%), Postives = 131/228 (57.46%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  +++   V     E+                               + +AI+CVAGGWAGG+A  +++  N  LM KQ IW+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G   +PSSGSLIQ++T    T
Sbjct:   11 RRVLVYGGRGALGSRCVQAFRARNWVTAEVGKLLGEE-------------------------------KVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKN-RPSSGSLIQVVTTEGRT 206          
BLAST of Dihydropteridine reductase vs. Ensembl Human
Match: QDPR (quinoid dihydropteridine reductase [Source:HGNC Symbol;Acc:HGNC:9752])

HSP 1 Score: 111.309 bits (277), Expect = 1.402e-29
Identity = 59/137 (43.07%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGM 489
              VL+YGG GALG  CV  F+  ++ V SVD+ +NE+A  +++V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ IW+S I ++LA   L + G L L GA AAL+ TPG+
Sbjct:   11 RRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGL 147          
BLAST of Dihydropteridine reductase vs. Ensembl Human
Match: QDPR (quinoid dihydropteridine reductase [Source:HGNC Symbol;Acc:HGNC:9752])

HSP 1 Score: 111.309 bits (277), Expect = 1.402e-29
Identity = 59/137 (43.07%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGM 489
              VL+YGG GALG  CV  F+  ++ V SVD+ +NE+A  +++V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ IW+S I ++LA   L + G L L GA AAL+ TPG+
Sbjct:   11 RRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGL 147          
BLAST of Dihydropteridine reductase vs. Ensembl Human
Match: QDPR (quinoid dihydropteridine reductase [Source:HGNC Symbol;Acc:HGNC:9752])

HSP 1 Score: 108.612 bits (270), Expect = 1.881e-28
Identity = 58/135 (42.96%), Postives = 83/135 (61.48%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTP 483
              VL+YGG GALG  CV  F+  ++ V SVD+ +NE+A  +++V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ IW+S I ++LA   L + G L L GA AAL+ TP
Sbjct:   11 RRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTP 145          
BLAST of Dihydropteridine reductase vs. Ensembl Celegans
Match: qdpr-1 (Quinoid DihydroPteridine Reductase [Source:UniProtKB/TrEMBL;Acc:Q9XVJ3])

HSP 1 Score: 211.075 bits (536), Expect = 8.815e-68
Identity = 112/223 (50.22%), Postives = 148/223 (66.37%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKN 750
            V++YGG GALG A ++ FK N + V+++D+  N+QAD N+LV+ N N  EQ   + +    S   +Q + + CVAGGWAGGSA  ++ V N  LM KQ +WSS I A LA   L   G L LTGA+AA+ PTP M+GYGM KAAVH LT SL A DS LP  + V  I+PVTLDT  NR+ MPNAD SSWTPL +++  +  W    + +PSSG+L++I T+N
Sbjct:    6 VIVYGGKGALGSAILEFFKKNGYTVLNIDLSANDQADSNILVDGNKNWTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSASSKDFVKNADLMIKQSVWSSAIAAKLATTHLKPGGLLQLTGAAAAMGPTPSMIGYGMAKAAVHHLTSSLAAKDSGLPDNSAVLTIMPVTLDTPMNRKWMPNADHSSWTPLSFISEHLLKWTTETSSRPSSGALLKITTEN 228          
BLAST of Dihydropteridine reductase vs. Ensembl Fly
Match: Dhpr (gene:FBgn0035964 transcript:FBtr0076531)

HSP 1 Score: 213.772 bits (543), Expect = 8.828e-69
Identity = 115/226 (50.88%), Postives = 153/226 (67.70%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            V+IYGG GALG ACVD FK N++ V S+D+ +NE+AD +++V  + + VEQ + V   + +S    + +A++CVAGGWAGG+A  +++  N  LM KQ + +S I A +AA  L   G L LTGA  ALE TPGM+GYGM KAAVHQLT+SL A  S LP+G+   +ILPVTLDT  NR+ MP+ADF +WTPL  VA     W   D  +P +GSL+Q+IT N  T
Sbjct:    6 VVIYGGKGALGSACVDHFKANNYWVGSIDLTENEKADVSIVVPRDASWVEQEETVVSKVGESLAGEKLDAVICVAGGWAGGNA-KKDLAKNADLMWKQSVLTSAISAAVAAQHLKAGGLLALTGAKPALEGTPGMIGYGMAKAAVHQLTRSLGAEKSGLPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTPLTEVAGLFLKWTQ-DQERPKTGSLLQLITTNGIT 229          
BLAST of Dihydropteridine reductase vs. Ensembl Fly
Match: Dhpr (gene:FBgn0035964 transcript:FBtr0100531)

HSP 1 Score: 213.772 bits (543), Expect = 8.828e-69
Identity = 115/226 (50.88%), Postives = 153/226 (67.70%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            V+IYGG GALG ACVD FK N++ V S+D+ +NE+AD +++V  + + VEQ + V   + +S    + +A++CVAGGWAGG+A  +++  N  LM KQ + +S I A +AA  L   G L LTGA  ALE TPGM+GYGM KAAVHQLT+SL A  S LP+G+   +ILPVTLDT  NR+ MP+ADF +WTPL  VA     W   D  +P +GSL+Q+IT N  T
Sbjct:    6 VVIYGGKGALGSACVDHFKANNYWVGSIDLTENEKADVSIVVPRDASWVEQEETVVSKVGESLAGEKLDAVICVAGGWAGGNA-KKDLAKNADLMWKQSVLTSAISAAVAAQHLKAGGLLALTGAKPALEGTPGMIGYGMAKAAVHQLTRSLGAEKSGLPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTPLTEVAGLFLKWTQ-DQERPKTGSLLQLITTNGIT 229          
BLAST of Dihydropteridine reductase vs. Ensembl Fly
Match: Dhpr (gene:FBgn0035964 transcript:FBtr0100532)

HSP 1 Score: 213.772 bits (543), Expect = 8.828e-69
Identity = 115/226 (50.88%), Postives = 153/226 (67.70%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            V+IYGG GALG ACVD FK N++ V S+D+ +NE+AD +++V  + + VEQ + V   + +S    + +A++CVAGGWAGG+A  +++  N  LM KQ + +S I A +AA  L   G L LTGA  ALE TPGM+GYGM KAAVHQLT+SL A  S LP+G+   +ILPVTLDT  NR+ MP+ADF +WTPL  VA     W   D  +P +GSL+Q+IT N  T
Sbjct:    6 VVIYGGKGALGSACVDHFKANNYWVGSIDLTENEKADVSIVVPRDASWVEQEETVVSKVGESLAGEKLDAVICVAGGWAGGNA-KKDLAKNADLMWKQSVLTSAISAAVAAQHLKAGGLLALTGAKPALEGTPGMIGYGMAKAAVHQLTRSLGAEKSGLPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTPLTEVAGLFLKWTQ-DQERPKTGSLLQLITTNGIT 229          
BLAST of Dihydropteridine reductase vs. Ensembl Zebrafish
Match: qdprb1 (quinoid dihydropteridine reductase b1 [Source:ZFIN;Acc:ZDB-GENE-050522-320])

HSP 1 Score: 208.379 bits (529), Expect = 2.183e-66
Identity = 109/228 (47.81%), Postives = 147/228 (64.47%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              V++YGG GALG ACV  FK  H+ V S+D+  NE+A+ NV V    +  EQ + V   +       + +AI CVAGGWAGGSA  + +  N  LM KQ +W+S IC++LA   L + G L L GA AAL PT G +GYGM KA+VHQL +SL A +S LP G+   AILPVTLDT  NR+ MP+AD S WTPL+Y+    + W  G++ +P SG+L+Q++T + +T
Sbjct:    7 QKVIVYGGKGALGSACVQYFKAKHWWVASIDLSANEEANANVTVKMTESFTEQANQVTADVGDLLGEEKVDAIFCVAGGWAGGSAKAKTLFKNADLMWKQSVWTSTICSHLATKHLREGGLLTLAGAKAALGPTAGCIGYGMAKASVHQLCQSLSAPNSGLPPGSAAVAILPVTLDTPMNRKFMPDADVSCWTPLEYITELFYKWTTGES-RPPSGTLMQLVTADGKT 233          
BLAST of Dihydropteridine reductase vs. Ensembl Zebrafish
Match: qdprb1 (quinoid dihydropteridine reductase b1 [Source:ZFIN;Acc:ZDB-GENE-050522-320])

HSP 1 Score: 207.608 bits (527), Expect = 4.096e-66
Identity = 109/228 (47.81%), Postives = 147/228 (64.47%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              V++YGG GALG ACV  FK  H+ V S+D+  NE+A+ NV V    +  EQ + V   +       + +AI CVAGGWAGGSA  + +  N  LM KQ +W+S IC++LA   L + G L L GA AAL PT G +GYGM KA+VHQL +SL A +S LP G+   AILPVTLDT  NR+ MP+AD S WTPL+Y+    + W  G++ +P SG+L+Q++T + +T
Sbjct:    7 QKVIVYGGKGALGSACVQYFKAKHWWVASIDLSANEEANANVTVKMTESFTEQANQVTADVGDLLGEEKVDAIFCVAGGWAGGSAKAKTLFKNADLMWKQSVWTSTICSHLATKHLREGGLLTLAGAKAALGPTAGCIGYGMAKASVHQLCQSLSAPNSGLPLGSAAVAILPVTLDTPMNRKFMPDADVSCWTPLEYITELFYKWTTGES-RPPSGTLMQLVTADGKT 233          
BLAST of Dihydropteridine reductase vs. Ensembl Zebrafish
Match: qdprb1 (quinoid dihydropteridine reductase b1 [Source:ZFIN;Acc:ZDB-GENE-050522-320])

HSP 1 Score: 207.608 bits (527), Expect = 4.096e-66
Identity = 109/228 (47.81%), Postives = 147/228 (64.47%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              V++YGG GALG ACV  FK  H+ V S+D+  NE+A+ NV V    +  EQ + V   +       + +AI CVAGGWAGGSA  + +  N  LM KQ +W+S IC++LA   L + G L L GA AAL PT G +GYGM KA+VHQL +SL A +S LP G+   AILPVTLDT  NR+ MP+AD S WTPL+Y+    + W  G++ +P SG+L+Q++T + +T
Sbjct:    7 QKVIVYGGKGALGSACVQYFKAKHWWVASIDLSANEEANANVTVKMTESFTEQANQVTADVGDLLGEEKVDAIFCVAGGWAGGSAKAKTLFKNADLMWKQSVWTSTICSHLATKHLREGGLLTLAGAKAALGPTAGCIGYGMAKASVHQLCQSLSAPNSGLPLGSAAVAILPVTLDTPMNRKFMPDADVSCWTPLEYITELFYKWTTGES-RPPSGTLMQLVTADGKT 233          
BLAST of Dihydropteridine reductase vs. Ensembl Zebrafish
Match: qdpra (quinoid dihydropteridine reductase a [Source:ZFIN;Acc:ZDB-GENE-070705-197])

HSP 1 Score: 206.453 bits (524), Expect = 1.202e-65
Identity = 115/228 (50.44%), Postives = 149/228 (65.35%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            N VL+YGG GALG ACV  FK   + V S+DI  NE+A+ NVLV  + +  +Q   V   + +    ++  AIVCVAGGWAGG+   +++  N  +M KQ +W+S I ++LA+  L   G L L GA A+L+ TPGM+GYGM KAAVHQL KSLA  +S LPSG    AILPVTLDT  NR+ MP+ADF SWTPL+Y+A     W  G   +P+SGSLIQ+ T   +T
Sbjct:    5 NRVLVYGGKGALGSACVHYFKSKGWWVASIDIGANEEANANVLVKLSESFTDQAAQVTSDVSKLLGEHKVEAIVCVAGGWAGGNCSSKDLYKNSDMMWKQSVWTSTISSHLASLHLKPGGLLTLAGAKASLDATPGMVGYGMAKAAVHQLCKSLAGENSGLPSGAVAVAILPVTLDTPMNRKFMPDADFGSWTPLEYIAETFHSWATGSG-RPASGSLIQLETTGGKT 231          
BLAST of Dihydropteridine reductase vs. Ensembl Zebrafish
Match: zgc:171517 (zgc:171517 [Source:ZFIN;Acc:ZDB-GENE-080219-12])

HSP 1 Score: 183.726 bits (465), Expect = 1.402e-56
Identity = 104/229 (45.41%), Postives = 141/229 (61.57%), Query Frame = 1
Query:   76 VNSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            V  V++YGG GALG   V  F+  H+ VVSVD+R N++A+ NV V    +  +Q   V   + +     + +AI CVAGG A G+A  +++     LM KQ +W+S IC +LA  +L   G L LTGA  AL PT   + +GM KA+VHQLT+SL   +S LP  +   AILPVTLDT  NR+ MPNAD SSWTPL +V    F W  G + +P SGSL++++T N +T
Sbjct:   22 VKKVIVYGGKGALGTESVRYFRAKHWWVVSVDVRVNKEANANVKVKMTESFTDQAKQVTVGVGKLLGVEKVDAIFCVAGGQAEGNAKAKSLYKYADLMWKQNVWTSTICTHLATRYLRVGGLLTLTGAKVALGPTAESVSFGMAKASVHQLTRSLGGPNSGLPPRSVALAILPVTLDTPTNRKIMPNADVSSWTPLNHVTQLFFKWTVGKS-RPPSGSLVELVTTNGKT 249          
BLAST of Dihydropteridine reductase vs. Ensembl Xenopus
Match: ifrd2 (interferon-related developmental regulator 2 [Source:Xenbase;Acc:XB-GENE-1003246])

HSP 1 Score: 203.756 bits (517), Expect = 1.734e-64
Identity = 103/226 (45.58%), Postives = 147/226 (65.04%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            VL+YGG GALG  CV+ F+   + V S+DI +N  A  +++V  + +  EQ+D V   + +     + +AI+CVAGGWAGGSA  ++   +   M KQ +W+S I ++LA   L + G L L+GA A L  TPGM  YGM KAA+HQL +SL A  S +P+ +   AILPVTLDT ANR +MP+AD++ WTPL ++A   ++WI G   +P SGSLI++IT+  +T
Sbjct:   10 VLVYGGRGALGSKCVEYFRSKQWWVASIDITENASASASIVVKLSDSFTEQSDQVTAAVEELLSGQKVDAILCVAGGWAGGSAKAKSFYKSCDQMWKQSVWTSAISSHLATKHLKEGGLLTLSGAKAGLSATPGMSAYGMSKAAIHQLCQSLGAEKSGMPAKSAAVAILPVTLDTPANRASMPDADYTCWTPLDFIAETFYNWITGQN-RPQSGSLIEVITEKGKT 234          
BLAST of Dihydropteridine reductase vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 207.608 bits (527), Expect = 4.086e-66
Identity = 107/228 (46.93%), Postives = 151/228 (66.23%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  ++ V S+D+ +NE+A  +V+V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  +M KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G+  +P+SGSLIQ++T + +T
Sbjct:    8 RRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNK-RPNSGSLIQVVTTDGKT 234          
BLAST of Dihydropteridine reductase vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 171.785 bits (434), Expect = 9.053e-53
Identity = 87/177 (49.15%), Postives = 120/177 (67.80%), Query Frame = 1
Query:  232 EQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  +M KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G+  +P+SGSLIQ++T + +T
Sbjct:    7 EQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNK-RPNSGSLIQVVTTDGKT 182          
BLAST of Dihydropteridine reductase vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 171.785 bits (434), Expect = 9.053e-53
Identity = 87/177 (49.15%), Postives = 120/177 (67.80%), Query Frame = 1
Query:  232 EQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  +M KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G+  +P+SGSLIQ++T + +T
Sbjct:    7 EQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNK-RPNSGSLIQVVTTDGKT 182          
BLAST of Dihydropteridine reductase vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 171.785 bits (434), Expect = 9.053e-53
Identity = 87/177 (49.15%), Postives = 120/177 (67.80%), Query Frame = 1
Query:  232 EQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  +M KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G+  +P+SGSLIQ++T + +T
Sbjct:    7 EQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNK-RPNSGSLIQVVTTDGKT 182          
BLAST of Dihydropteridine reductase vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 153.68 bits (387), Expect = 1.994e-45
Identity = 91/229 (39.74%), Postives = 130/229 (56.77%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFH-WINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  ++ V S+D+ +NE+A  +V+V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  +M KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LP                              FH WI G+  +P+SGSLIQ++T + +T
Sbjct:    8 RRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPT-----------------------------FHDWITGNK-RPNSGSLIQVVTTDGKT 206          
BLAST of Dihydropteridine reductase vs. UniProt/SwissProt
Match: sp|Q3T0Z7|DHPR_BOVIN (Dihydropteridine reductase OS=Bos taurus OX=9913 GN=QDPR PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 3.972e-67
Identity = 114/234 (48.72%), Postives = 154/234 (65.81%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLAHDST-LPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET-FTAIS 774
              VL+YGG GALG  CV  F+  ++ V S+D+++NE+A  NV+V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM KAAVHQL +SLA  S+ LP G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI  +  +PSSGSLIQ++T   +T  TA S
Sbjct:    9 RRVLVYGGRGALGSRCVQAFRARNWWVASIDVQENEEASANVVVKMTDSFTEQADQVTAEVGKLLGTEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSVWTSTISSHLATKHLKEGGLLTLAGARAALDGTPGMIGYGMAKAAVHQLCQSLAGKSSGLPPGAAAVALLPVTLDTPVNRKSMPEADFSSWTPLEFLVETFHDWIT-EKNRPSSGSLIQVVTTEGKTELTAAS 241          
BLAST of Dihydropteridine reductase vs. UniProt/SwissProt
Match: sp|P11348|DHPR_RAT (Dihydropteridine reductase OS=Rattus norvegicus OX=10116 GN=Qdpr PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 5.331e-67
Identity = 110/228 (48.25%), Postives = 152/228 (66.67%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  ++ V S+D+ +NE+A  +V+V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ IW+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +PSG    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G+  +P+SGSLIQ++T + +T
Sbjct:    8 RRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVIVKMTDSFTEQADQVTAEVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPSGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNK-RPNSGSLIQVVTTDGKT 234          
BLAST of Dihydropteridine reductase vs. UniProt/SwissProt
Match: sp|P09417|DHPR_HUMAN (Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 1.322e-66
Identity = 110/228 (48.25%), Postives = 148/228 (64.91%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  ++ V SVD+ +NE+A  +++V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ IW+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G   +PSSGSLIQ++T    T
Sbjct:   11 RRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKN-RPSSGSLIQVVTTEGRT 237          
BLAST of Dihydropteridine reductase vs. UniProt/SwissProt
Match: sp|Q8MJ30|DHPR_PIG (Dihydropteridine reductase OS=Sus scrofa OX=9823 GN=QDPR PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 7.427e-66
Identity = 111/228 (48.68%), Postives = 151/228 (66.23%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  ++ V S+D+ +NE+A  NV+V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  LM KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  DS +PSG    A+LPVTLDT  NR++MP+ADFSSWTPL+++      WI  +  +PSSGSLIQ++T   +T
Sbjct:   10 RRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASANVVVKMTDSFTEQADQVTAEVGKLLGTEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKDSGMPSGAAAIAVLPVTLDTPLNRKSMPHADFSSWTPLEFLVETFHDWII-EKNRPSSGSLIQVVTTQGKT 236          
BLAST of Dihydropteridine reductase vs. UniProt/SwissProt
Match: sp|Q8BVI4|DHPR_MOUSE (Dihydropteridine reductase OS=Mus musculus OX=10090 GN=Qdpr PE=1 SV=2)

HSP 1 Score: 207.608 bits (527), Expect = 2.858e-65
Identity = 107/228 (46.93%), Postives = 151/228 (66.23%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              VL+YGG GALG  CV  F+  ++ V S+D+ +NE+A  +V+V    +  EQ D V   + +     + +AI+CVAGGWAGG+A  +++  N  +M KQ +W+S I ++LA   L + G L L GA AAL+ TPGM+GYGM K AVHQL +SLA  +S +P G    A+LPVTLDT  NR++MP ADFSSWTPL+++      WI G+  +P+SGSLIQ++T + +T
Sbjct:    8 RRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNK-RPNSGSLIQVVTTDGKT 234          
BLAST of Dihydropteridine reductase vs. TrEMBL
Match: A0A443R7G4 (Uncharacterized protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_04371 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.163e-71
Identity = 126/235 (53.62%), Postives = 153/235 (65.11%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQAD----FXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNETFTAIS 774
            VLIYGG GALG  CV  FK   + V SVD   NE+A+       L +      E +D V  +L   +L    +AI+CVAGGWAGGSA   + + N  LM KQ +WSS I A LA++ L + G L LTGA AAL+PTPGM+GYG  KAAVHQLT+SL A +S LP  + V AILPVTLDT  NR+ MP ADFSSWTPL+YVAN    W+     +P SGSL+Q+ITKNNET   I+
Sbjct:    7 VLIYGGKGALGSTCVQYFKSKQWWVASVDTSANEEANESVIIKTLDSWTAQETEVSDRVNSILKGEKL----DAIICVAGGWAGGSASSSDFIKNSDLMIKQSVWSSGIAAKLASNHLKEGGLLTLTGAKAALDPTPGMIGYGFAKAAVHQLTRSLGAQNSGLPENSSVLAILPVTLDTPMNRKFMPKADFSSWTPLEYVANLFHDWVIDLNKRPKSGSLVQLITKNNETELVIA 237          
BLAST of Dihydropteridine reductase vs. TrEMBL
Match: A0A401PKV0 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0002824 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 2.446e-69
Identity = 117/228 (51.32%), Postives = 160/228 (70.18%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            + V++YGG GALG  CV+ FK   + V S+D+  NE+A+ N++V  + +  EQ D V   +       + +AI+CVAGGWAGGSA  +++  N  LM KQ +W+S I ++LA   L D G L LTGASAAL  T GM+GYGM KAAVHQL +SLA   S +PSG+   AILPVTLDT  NR++MP+ADFSSWTPL++VA  +F+WI+ +T +P+SGSL+Q+IT  ++T
Sbjct:    5 HKVIVYGGKGALGSKCVEFFKSKQWWVASIDLTSNEEANANIIVKMSDSFTEQADQVTVDVASLLGEQKVDAIICVAGGWAGGSAKAKSLYKNTDLMWKQSMWTSTISSHLATKHLKDGGLLTLTGASAALNGTAGMVGYGMAKAAVHQLCRSLAGEKSGMPSGSSALAILPVTLDTPMNRKSMPSADFSSWTPLEFVAETLFNWIDKET-RPTSGSLVQLITTGSKT 231          
BLAST of Dihydropteridine reductase vs. TrEMBL
Match: A0A1I8M7I9 (Uncharacterized protein OS=Musca domestica OX=7370 GN=101888037 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 2.532e-69
Identity = 120/229 (52.40%), Postives = 154/229 (67.25%), Query Frame = 1
Query:   76 VNSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            V  VLIYGG GALG ACV  FK N++ V S+D+ +NE AD +++V  +    EQ   V   +      N+ +A++CVAGGWAGG+A  +++  N  LM +Q +W+S I A +AAH+L D G L LTGA  ALE TPGM+GYGM KAAVHQLT+SL   DS LP+   V +ILPVTLDT  NR+ MP ADFS+WTPL  VA     W NG   +P SGSL+Q+ITK++ T
Sbjct:    3 VGRVLIYGGKGALGAACVSHFKSNNYWVGSIDLSENELADVSIVVPRDGCWTEQEQHVLSKVGDVLQDNKLDAVICVAGGWAGGNA-KKDLAKNADLMWRQSVWTSTISAAVAAHYLKDGGVLALTGAKPALEGTPGMIGYGMAKAAVHQLTRSLGGKDSGLPNDALVVSILPVTLDTPMNRKWMPKADFSTWTPLTEVAGLFLKWTNG-VERPKSGSLLQLITKDSVT 229          
BLAST of Dihydropteridine reductase vs. TrEMBL
Match: A0A452H9F7 (Quinoid dihydropteridine reductase OS=Gopherus agassizii OX=38772 GN=QDPR PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 9.482e-69
Identity = 115/228 (50.44%), Postives = 156/228 (68.42%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            + VL+YGG GALG  CV  F+  H+ V S+D+ +NE+A+ +V+V    +  EQ D V   + +     + +AI+CVAGGWAGGSA  +++  N  LM KQ +W+S I ++LA   L + G L LTGA AAL  TPGM+GYGM K AVHQL +SLA  +S LPSG+   A+LPVTLDT  NR++MP+ADFSSWTPL+++A   + WI G   +PSSGSLIQ++T   +T
Sbjct:   10 HRVLVYGGRGALGAKCVQYFRAKHWWVASIDLAENEEANASVVVKMTDSFTEQADQVTADVEKLLGEQKVDAILCVAGGWAGGSAKAKSLYKNSDLMWKQSVWTSTISSHLATKHLKEGGLLTLTGAKAALAGTPGMVGYGMAKGAVHQLCQSLAGANSGLPSGSAALAVLPVTLDTPINRKSMPDADFSSWTPLEFLAETFYDWITGKN-RPSSGSLIQVVTTGGKT 236          
BLAST of Dihydropteridine reductase vs. TrEMBL
Match: A0A401SZA5 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0014207 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.317e-68
Identity = 116/228 (50.88%), Postives = 158/228 (69.30%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            + V++YGG GALG  CV+ FK  H+ V S+D+  NE+A+ N++V  + +  EQ + V   +       + +AI+CVAGGWAGGSA  +++  N  LM KQ +W+S I ++LA   L D G L LTGAS AL+ T GM+GYGM KAAVHQL +SLA   S +P G+   AILPVTLDT  NR++MPNADFSSWTPL++VA  +F+W   +T +P+SGSLIQ+IT  ++T
Sbjct:    7 HRVIVYGGKGALGTKCVEFFKSKHWWVASIDLMSNEEANANIIVKMSESFTEQAEQVTTEIASLLGEQKVDAIICVAGGWAGGSAKAKSLFKNADLMWKQSVWTSTISSHLATKHLKDDGLLTLTGASPALKGTAGMVGYGMAKAAVHQLCQSLAGEKSGMPPGSSALAILPVTLDTPMNRKSMPNADFSSWTPLEFVAETLFNWTFKET-RPTSGSLIQLITTESKT 233          
BLAST of Dihydropteridine reductase vs. Ensembl Cavefish
Match: zgc:171517 (dihydropteridine reductase [Source:NCBI gene;Acc:103041363])

HSP 1 Score: 216.083 bits (549), Expect = 1.636e-69
Identity = 113/228 (49.56%), Postives = 152/228 (66.67%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              V+IYGG GALG  CV  F+  H+ V  +D+  NE+A  NV V    +  EQ + V   + +     + +AI+CVAGGWAGGSA  + +  N  LM KQ +W+S I ++LA   L + G L LTGA A+LEPTPGM+GYGM KAAVHQL +SL   +S LP+G    AILPVTLDT  NRQ MP+AD S+WTPL+YVA  ++ W  G+  +P+SGSL+Q++T +++T
Sbjct:    5 QKVIIYGGKGALGSKCVQYFRSKHWWVACIDLNVNEEASANVTVKMTDSFTEQANQVTADIGELLGEEKVDAILCVAGGWAGGSAKAKALYKNADLMWKQSVWTSTISSHLATKHLKEGGLLTLTGAKASLEPTPGMIGYGMAKAAVHQLCQSLGGANSGLPAGASAIAILPVTLDTPMNRQFMPDADVSAWTPLEYVAELLYKWAVGEE-RPASGSLVQLVTTDSKT 231          
BLAST of Dihydropteridine reductase vs. Ensembl Cavefish
Match: qdpra (dihydropteridine reductase-like [Source:NCBI gene;Acc:103021866])

HSP 1 Score: 204.527 bits (519), Expect = 5.338e-65
Identity = 111/226 (49.12%), Postives = 151/226 (66.81%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            VL+YGG GALG AC+  FK   + V S+DI  NE+A+ NVLV    +  EQ + V   + +     + +AI+C+AGGWAGG+   +++  N  LM KQ +W+S I ++LA+  L   G L L GA+A+L  TPGM+GYGM KAAVHQL +SL+  +S LP+G+   AILPVTLDT  NR+ MP+ADFSSWTPL+Y+A   + W  G   +P+SGSLIQ++T    T
Sbjct:    9 VLVYGGRGALGSACLHYFKAKGWWVASIDIVANEEANANVLVKICESFTEQAEQVTSDVARLLGEQKVDAILCLAGGWAGGNCSSKDLYKNSDLMWKQSVWTSTISSHLASKHLKAGGLLTLAGANASLSGTPGMVGYGMAKAAVHQLCQSLSGENSGLPAGSVAVAILPVTLDTPMNRKFMPDADFSSWTPLEYIAQTFYSWATGSG-RPASGSLIQLVTAGGVT 233          
BLAST of Dihydropteridine reductase vs. Ensembl Cavefish
Match: qdpra (dihydropteridine reductase-like [Source:NCBI gene;Acc:103021866])

HSP 1 Score: 184.882 bits (468), Expect = 7.825e-57
Identity = 101/201 (50.25%), Postives = 136/201 (67.66%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIF 684
            VL+YGG GALG AC+  FK   + V S+DI  NE+A+ NVLV    +  EQ + V   + +     + +AI+C+AGGWAGG+   +++  N  LM KQ +W+S I ++LA+  L   G L L GA+A+L  TPGM+GYGM KAAVHQL +SL+  +S LP+G+   AILPVTLDT  NR+ MP+ADFSSWTPL+Y+A   F
Sbjct:    9 VLVYGGRGALGSACLHYFKAKGWWVASIDIVANEEANANVLVKICESFTEQAEQVTSDVARLLGEQKVDAILCLAGGWAGGNCSSKDLYKNSDLMWKQSVWTSTISSHLASKHLKAGGLLTLAGANASLSGTPGMVGYGMAKAAVHQLCQSLSGENSGLPAGSVAVAILPVTLDTPMNRKFMPDADFSSWTPLEYIAQYFF 209          
BLAST of Dihydropteridine reductase vs. Ensembl Cavefish
Match: qdpra (dihydropteridine reductase-like [Source:NCBI gene;Acc:103021866])

HSP 1 Score: 145.976 bits (367), Expect = 1.441e-42
Identity = 91/226 (40.27%), Postives = 127/226 (56.19%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLA-HDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            VL+YGG GALG AC+  FK   + V S+DI  NE+A+ NVLV    +  EQ + V   + +     + +AI+C+AGGWAGG+   +++  N  LM KQ +W+S I ++LA+  L   G L L GA+A+L  TPGM+GYGM KAAVHQL +SL+  +S LP+G+   AILP                              + W  G   +P+SGSLIQ++T    T
Sbjct:    9 VLVYGGRGALGSACLHYFKAKGWWVASIDIVANEEANANVLVKICESFTEQAEQVTSDVARLLGEQKVDAILCLAGGWAGGNCSSKDLYKNSDLMWKQSVWTSTISSHLASKHLKAGGLLTLAGANASLSGTPGMVGYGMAKAAVHQLCQSLSGENSGLPAGSVAVAILPT----------------------------FYSWATGSG-RPASGSLIQLVTAGGVT 205          
BLAST of Dihydropteridine reductase vs. Ensembl Sea Lamprey
Match: qdpra (quinoid dihydropteridine reductase a [Source:ZFIN;Acc:ZDB-GENE-070705-197])

HSP 1 Score: 209.92 bits (533), Expect = 9.027e-68
Identity = 120/235 (51.06%), Postives = 157/235 (66.81%), Query Frame = 1
Query:   67 NIMVNSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSEL---PNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLAHD-STLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
              M   VL+YGG GALG  CV +FK   + V SVD+  N+ AD NVLV P+ +L EQ +  +QV  +        + +A++CVAGGWAGGSA  + M  N  LM KQ +W+S I A LAA  L D G L LTGASA+L PT GM+GYG+ KAAVHQLT SLA D S LP+G   A++L VTLDT  NR++MPNAD  +WTPL +VA  +  W  G+  +P+SGSL+Q++T++ +T
Sbjct:    8 RTMARRVLVYGGRGALGAECVKIFKARQWWVASVDLVANDAADANVLVKPSDSLAEQAE--QQVAGEVAALLGDAKLDALLCVAGGWAGGSAKSKAMAKNTELMLKQSVWTSTIAAQLAAKHLGDSGLLQLTGASASLGPTSGMMGYGLAKAAVHQLTTSLAADGSGLPAG---ASVL-VTLDTPMNRKSMPNADTGTWTPLGFVAETLLKWAGGEG-RPASGSLVQLLTESGKT 235          
BLAST of Dihydropteridine reductase vs. Ensembl Nematostella
Match: EDO42784 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0R5])

HSP 1 Score: 214.927 bits (546), Expect = 2.303e-69
Identity = 118/228 (51.75%), Postives = 159/228 (69.74%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLAHD-STLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            + VLIYGG GALG  CV  FK   + V SVD+  NE+A  NV+V+P  +  EQN+ V++ + +    N+ NAI+CVAGGWAGG+A  +++V N  LM KQ +W+S+I A++AA  L+++G L LTGA  +L  TPGMLGYGM KAAVHQLT  L  D +TLP  +   AILP TLDT  NR+ MP AD S WTPL+YVA  +F W +G + +P+SGSL ++ITK+ ++
Sbjct:    8 SRVLIYGGKGALGATCVSYFKAREWWVASVDLFPNEEAHANVIVDPAKSWDEQNNEVQKKVDELLDGNKLNAIICVAGGWAGGTAKSKDVVKNADLMFKQSVWTSLIAASIAAKHLMNNGLLALTGAQPSLSGTPGMLGYGMAKAAVHQLTVGLGMDGNTLPPDSTALAILPNTLDTPMNRKFMPEADQSQWTPLEYVAKLMFDW-SGGSDRPASGSLCKLITKDGQS 234          
BLAST of Dihydropteridine reductase vs. Ensembl Medaka
Match: qdpra (quinoid dihydropteridine reductase [Source:NCBI gene;Acc:101166857])

HSP 1 Score: 186.422 bits (472), Expect = 5.547e-58
Identity = 112/228 (49.12%), Postives = 151/228 (66.23%), Query Frame = 1
Query:   79 NSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSL-AHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            N V++YGG GALG  CV  FK   + V S+D+  NE+A+ NV+V  + +  EQ   V   + Q    ++ +AI+CVAGGWAGG+   +++  N  LM KQ +W+S I ++LA+  L   G L L GA AAL  T GM+GYGM KAAVHQL +SL A +S +P G    AILPVTLDT  NR+ MPNADFSSWTPL+Y+A   F W  G+  +P+SGSL+Q++T + +T
Sbjct:    4 NRVIVYGGRGALGSKCVQHFKSQGWWVASIDMAANEEANENVIVKMSESFTEQAGQVTADVAQLLGEHKVDAILCVAGGWAGGNCSSKDLYKNTDLMWKQSVWTSTISSHLASLHLKSGGLLTLAGAKAALAGTGGMVGYGMAKAAVHQLCQSLAAKNSGMPPGAAAVAILPVTLDTPMNRKFMPNADFSSWTPLEYIAETFFKWAAGEN-RPASGSLMQLLTSDGQT 230          
BLAST of Dihydropteridine reductase vs. Planmine SMEST
Match: SMESG000060612.1 (SMESG000060612.1)

HSP 1 Score: 454.907 bits (1169), Expect = 6.198e-164
Identity = 233/234 (99.57%), Postives = 234/234 (100.00%), Query Frame = 1
Query:   73 MVNSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLAHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNETFTAIS 774
            MVNSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFNVLVNPNLNLVEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLAHDSTLPSGTWVAAILPVTLDTEANRQ+MPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNETFTAIS
Sbjct:    1 MVNSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFNVLVNPNLNLVEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLAHDSTLPSGTWVAAILPVTLDTEANRQSMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNETFTAIS 234          
BLAST of Dihydropteridine reductase vs. Planmine SMEST
Match: SMESG000042735.1 (SMESG000042735.1)

HSP 1 Score: 187.963 bits (476), Expect = 1.153e-58
Identity = 101/226 (44.69%), Postives = 144/226 (63.72%), Query Frame = 1
Query:   85 VLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFXXXXXXXXXXXEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLMEKQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVHQLTKSLAH-DSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVANQIFHWINGDTVKPSSGSLIQIITKNNET 759
            V++YGG+G+LGK CVD F  N + V+S+    NEQA+ N+ V  NL+ V + +++R+ + +     + +AI+CVAGGWAGG   ++NM+ +   M +Q ++ S I + LA   L ++G L+LT + +A   TP M+GYG+ KAAV  L KSL+H  S +P  +  A ILP TLDT+ NR +MPN DF SWTPL +VA     WI G T +P +G  I   TKN ET
Sbjct:    3 VIVYGGTGSLGKCCVDAFLKNKYWVLSIGHSKNEQANQNIEVEKNLSWVHEEEYIRKEVKKILDSEKVDAIICVAGGWAGGGIKNKNMIKSADEMWRQSVFPSTISSTLAYDCLKENGLLVLTSSKSAASGTPSMIGYGLAKAAVLHLAKSLSHPKSNMPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPLSFVAETFIKWIEG-TERPKNGDFIYFNTKNGET 227          
The following BLAST results are available for this feature:
BLAST of Dihydropteridine reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
QDPR2.752e-6748.25quinoid dihydropteridine reductase [Source:HGNC Sy... [more]
QDPR2.913e-5843.86quinoid dihydropteridine reductase [Source:HGNC Sy... [more]
QDPR1.402e-2943.07quinoid dihydropteridine reductase [Source:HGNC Sy... [more]
QDPR1.402e-2943.07quinoid dihydropteridine reductase [Source:HGNC Sy... [more]
QDPR1.881e-2842.96quinoid dihydropteridine reductase [Source:HGNC Sy... [more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
qdpr-18.815e-6850.22Quinoid DihydroPteridine Reductase [Source:UniPro... [more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dhpr8.828e-6950.88gene:FBgn0035964 transcript:FBtr0076531[more]
Dhpr8.828e-6950.88gene:FBgn0035964 transcript:FBtr0100531[more]
Dhpr8.828e-6950.88gene:FBgn0035964 transcript:FBtr0100532[more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qdprb12.183e-6647.81quinoid dihydropteridine reductase b1 [Source:ZFIN... [more]
qdprb14.096e-6647.81quinoid dihydropteridine reductase b1 [Source:ZFIN... [more]
qdprb14.096e-6647.81quinoid dihydropteridine reductase b1 [Source:ZFIN... [more]
qdpra1.202e-6550.44quinoid dihydropteridine reductase a [Source:ZFIN;... [more]
zgc:1715171.402e-5645.41zgc:171517 [Source:ZFIN;Acc:ZDB-GENE-080219-12][more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ifrd21.734e-6445.58interferon-related developmental regulator 2 [Sour... [more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Qdpr4.086e-6646.93quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr9.053e-5349.15quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr9.053e-5349.15quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr9.053e-5349.15quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr1.994e-4539.74quinoid dihydropteridine reductase [Source:MGI Sym... [more]
back to top
BLAST of Dihydropteridine reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3T0Z7|DHPR_BOVIN3.972e-6748.72Dihydropteridine reductase OS=Bos taurus OX=9913 G... [more]
sp|P11348|DHPR_RAT5.331e-6748.25Dihydropteridine reductase OS=Rattus norvegicus OX... [more]
sp|P09417|DHPR_HUMAN1.322e-6648.25Dihydropteridine reductase OS=Homo sapiens OX=9606... [more]
sp|Q8MJ30|DHPR_PIG7.427e-6648.68Dihydropteridine reductase OS=Sus scrofa OX=9823 G... [more]
sp|Q8BVI4|DHPR_MOUSE2.858e-6546.93Dihydropteridine reductase OS=Mus musculus OX=1009... [more]
back to top
BLAST of Dihydropteridine reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443R7G41.163e-7153.62Uncharacterized protein OS=Dinothrombium tinctoriu... [more]
A0A401PKV02.446e-6951.32Uncharacterized protein OS=Scyliorhinus torazame O... [more]
A0A1I8M7I92.532e-6952.40Uncharacterized protein OS=Musca domestica OX=7370... [more]
A0A452H9F79.482e-6950.44Quinoid dihydropteridine reductase OS=Gopherus aga... [more]
A0A401SZA51.317e-6850.88Uncharacterized protein OS=Chiloscyllium punctatum... [more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zgc:1715171.636e-6949.56dihydropteridine reductase [Source:NCBI gene;Acc:1... [more]
qdpra5.338e-6549.12dihydropteridine reductase-like [Source:NCBI gene;... [more]
qdpra7.825e-5750.25dihydropteridine reductase-like [Source:NCBI gene;... [more]
qdpra1.441e-4240.27dihydropteridine reductase-like [Source:NCBI gene;... [more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
qdpra9.027e-6851.06quinoid dihydropteridine reductase a [Source:ZFIN;... [more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO427842.303e-6951.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dihydropteridine reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
qdpra5.547e-5849.12quinoid dihydropteridine reductase [Source:NCBI ge... [more]
back to top
BLAST of Dihydropteridine reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000060612.16.198e-16499.57SMESG000060612.1[more]
SMESG000042735.11.153e-5844.69SMESG000042735.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033100 ID=SMED30033100|Name=Dihydropteridine reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=877bp
AAAGACAATTTATTTGGCCTTGGTAAATTTTTCTAATTTTTATCAGTTTC
AAAGGAGTTTTAGTAAAATATAATGGTGAATTCTGTTTTGATTTATGGAG
GTTCTGGAGCGTTGGGTAAAGCATGTGTGGACATGTTCAAAGGGAACCAT
TTCATTGTCGTTTCTGTGGACATAAGGGATAATGAACAGGCGGACTTCAA
TGTTCTCGTAAATCCAAATCTGAATTTAGTTGAGCAAAACGATTTTGTGC
GGCAAGTCCTTCACCAGTCTGAATTGCCGAATCAGTTCAATGCAATTGTT
TGCGTTGCTGGCGGCTGGGCAGGGGGCTCAGCTATCGATGAGAATATGGT
TAATAATGTATTTTTGATGGAGAAACAATGTATCTGGAGCTCAGTTATTT
GCGCAAATTTAGCTGCACATTTTCTTGTTGATCATGGATTTCTTCTCTTA
ACCGGAGCTAGCGCGGCACTGGAACCGACACCAGGGATGCTTGGTTATGG
AATGGTAAAGGCGGCTGTGCATCAATTGACAAAATCGTTGGCTCATGATT
CAACTCTACCCTCTGGGACATGGGTTGCAGCAATTTTACCAGTGACTCTT
GATACGGAAGCTAATAGACAGAACATGCCAAATGCTGACTTCTCTAGTTG
GACTCCCCTCAAATACGTCGCTAATCAAATTTTTCATTGGATAAATGGCG
ATACCGTCAAGCCAAGCAGTGGCTCTCTCATTCAAATAATCACCAAAAAC
AATGAGACCTTTACTGCGATTTCATAGACTTTGTTCTGTGAATATTAGAT
AAACTCTGCTAGTTGCGGAATTCTCTGTCATTTGTTTATTTGATAAATAA
AGGAAGTGGTATTTGTTTAAAAAAAAA
back to top

protein sequence of SMED30033100-orf-1

>SMED30033100-orf-1 ID=SMED30033100-orf-1|Name=SMED30033100-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
MVNSVLIYGGSGALGKACVDMFKGNHFIVVSVDIRDNEQADFNVLVNPNL
NLVEQNDFVRQVLHQSELPNQFNAIVCVAGGWAGGSAIDENMVNNVFLME
KQCIWSSVICANLAAHFLVDHGFLLLTGASAALEPTPGMLGYGMVKAAVH
QLTKSLAHDSTLPSGTWVAAILPVTLDTEANRQNMPNADFSSWTPLKYVA
NQIFHWINGDTVKPSSGSLIQIITKNNETFTAIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 164..181
score: 24.14
coord: 4..21
score: 30.01
coord: 142..161
score: 34.26
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 4..185
e-value: 2.3E-7
score: 30.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 3..233
e-value: 3.1E-36
score: 126.9
NoneNo IPR availablePANTHERPTHR15104DIHYDROPTERIDINE REDUCTASEcoord: 3..230
NoneNo IPR availableCDDcd05334DHPR_SDR_c_likecoord: 5..224
e-value: 1.16597E-88
score: 259.179
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 5..212