WD repeat-containing protein 97 isoform X2

Overview
NameWD repeat-containing protein 97 isoform X2
Smed IDSMED30033098
Length (bp)4584
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 97 isoform X2 (SMED30033098) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 97 isoform X2 (SMED30033098) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 97 isoform X2 (SMED30033098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 97 isoform X2 (SMED30033098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033098

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033098SMESG000010382.1 SmedASXL_017258SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30033098SMESG000010382.1 dd_Smed_v6_11828_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30033098SMESG000010382.1 dd_Smed_v4_11828_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Human
Match: WDR97 (WD repeat domain 97 [Source:HGNC Symbol;Acc:HGNC:26959])

HSP 1 Score: 161.384 bits (407), Expect = 1.286e-39
Identity = 170/767 (22.16%), Postives = 318/767 (41.46%), Query Frame = 2
Query:  257 SVSDIIEKQ---DLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCA-VRLFDSNGRCKDFMAYGGIPVKFRRLQYA----NCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKE----LLYNEDRNEIISSHRNRLLIWQFRYANKHLIPR---LSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQ-----YIGSDITRT----SFFTLSTNFIDIWHQNHLSDDLLSLTAPV-----SKMVNIDANKCL-----VQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDDSLVL--LTVYKPLS------------------------ITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDIAALSNVTPLEVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDI 2377
            S+ +++EK+   +L   +L+HG+E +RR+     +      P    ++ LDG   + L   +G  ++ +     PV+   L           R++ W P    LA+L  +  ++ L +Q +   P       L   + R  +++   + L +WQFR   + L+ R   L    S   +   +           R F A  + V   +L   ++      LH   IS L +   ++ + T  RD ++KVW  AD +I  +MVFVGHT  V+ +   P  +   + S   D TLR W L+   +V  + L +  Q      +G  +          +L  + + +W    L   L  L A V     +  +   A++ L       C +  ++ L +++ RI++  ++   D          +  +   +  L +L +   ++       PM ++ R       +     L +Y  L+                            K+ N+ L   G   G + V +    +K  F+ +AH+   VV + S   NS + +SG D ++K+W V+P+A E LS + +F C      L  +   +   F D D A Y  V + +    R DH P DD  + ++ +  C  +KL+ +CS+  +  ++IWT +N LLR ++++       F S  GD++  +G ++  ++H  YLP  ++ K++     D+    +  PL +   + Q   +S    +L  +       S+  +
Sbjct:   76 SLHEVVEKEKRAELRAARLTHGLEPLRRLEVAAGLRSVAQDPVGGRFVVLDGAGRLHLHKEDGWAQETLL---APVRLTGLVTVLGPLGAVGRFVGWGP--AGLAILRPNLSLLWLSEQGVGRAPGWAPTCCLPVPDLRLLLVAEMNSSLALWQFRSGGRRLVLRGSALHPPPSPTGRLMRLAVAPVPPHHVLRCFAAYGSAVLTFDLHAWTLVDVRRDLHKTTISDLAYCEEVEAMVTASRDSTVKVWE-ADWQI--RMVFVGHTGPVTAMTVLP--NTTLVLSASQDGTLRTWDLQAAAQVGEVALGFWGQDKLSRRVGRLLAPVRPGWPVLSLCASSMQLWRVRELYSPLAQLPAKVLHVQVAPALPAPAHQSLPTRLVCACADGSVYLLSAATGRIVSSLLLEPEDC-------AAAVAYCLPREALWLLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHLTDLEGAFSSWEIVRQHWGELRCSSVACAWKNKNRYLPVVGHTDGTLSVLEWLS-SKTVFQTEAHSPGPVVAIAST-WNS-IVSSGGDLTVKMWRVFPYAEESLSLLRTFSCCYPAVALCALGRRVTAGFEDPDSATYGLVQFGLGDSPRLDHRPQDDPTDHITGLCCCPTLKLY-ACSS-LDCTVRIWTAENRLLRLLQLNGAPQALAFCSNSGDLVLALGSRLCLVSHRLYLPTSYLVKKMCRKAPDVV---DDPPLPL---MSQESLTSAQLQRLTNLHGAASLRSHAGL 814          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Human
Match: WDR97 (WD repeat domain 97 [Source:HGNC Symbol;Acc:HGNC:26959])

HSP 1 Score: 162.155 bits (409), Expect = 3.406e-39
Identity = 164/724 (22.65%), Postives = 304/724 (41.99%), Query Frame = 2
Query:  257 SVSDIIEKQ---DLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCA-VRLFDSNGRCKDFMAYGGIPVKFRRLQYA----NCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKE----LLYNEDRNEIISSHRNRLLIWQFRYANKHLIPR---LSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQ-----YIGSDITRT----SFFTLSTNFIDIWHQNHLSDDLLSLTAPV-----SKMVNIDANKCL-----VQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDDSLVL--LTVYKPLS------------------------ITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDI 2248
            S+ +++EK+   +L   +L+HG+E +RR+     +      P    ++ LDG   + L   +G  ++ +     PV+   L           R++ W P    LA+L  +  ++ L +Q +   P       L   + R  +++   + L +WQFR   + L+ R   L    S   +   +           R F A  + V   +L   ++      LH   IS L +   ++ + T  RD ++KVW  AD +I  +MVFVGHT  V+ +   P  +   + S   D TLR W L+   +V  + L +  Q      +G  +          +L  + + +W    L   L  L A V     +  +   A++ L       C +  ++ L +++ RI++  ++   D          +  +   +  L +L +   ++       PM ++ R       +     L +Y  L+                            K+ N+ L   G   G + V +    +K  F+ +AH+   VV + S   NS + +SG D ++K+W V+P+A E LS + +F C      L  +   +   F D D A Y  V + +    R DH P DD  + ++ +  C  +KL+ +CS+  +  ++IWT +N LLR ++++       F S  GD++  +G ++  ++H  YLP  ++ K++     D+
Sbjct:   76 SLHEVVEKEKRAELRAARLTHGLEPLRRLEVAAGLRSVAQDPVGGRFVVLDGAGRLHLHKEDGWAQETLL---APVRLTGLVTVLGPLGAVGRFVGWGP--AGLAILRPNLSLLWLSEQGVGRAPGWAPTCCLPVPDLRLLLVAEMNSSLALWQFRSGGRRLVLRGSALHPPPSPTGRLMRLAVAPVPPHHVLRCFAAYGSAVLTFDLHAWTLVDVRRDLHKTTISDLAYCEEVEAMVTASRDSTVKVWE-ADWQI--RMVFVGHTGPVTAMTVLP--NTTLVLSASQDGTLRTWDLQAAAQVGEVALGFWGQDKLSRRVGRLLAPVRPGWPVLSLCASSMQLWRVRELYSPLAQLPAKVLHVQVAPALPAPAHQSLPTRLVCACADGSVYLLSAATGRIVSSLLLEPEDC-------AAAVAYCLPREALWLLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHLTDLEGAFSSWEIVRQHWGELRCSSVACAWKNKNRYLPVVGHTDGTLSVLEWLS-SKTVFQTEAHSPGPVVAIAST-WNS-IVSSGGDLTVKMWRVFPYAEESLSLLRTFSCCYPAVALCALGRRVTAGFEDPDSATYGLVQFGLGDSPRLDHRPQDDPTDHITGLCCCPTLKLY-ACSS-LDCTVRIWTAENRLLRLLQLNGAPQALAFCSNSGDLVLALGSRLCLVSHRLYLPTSYLVKKMCRKAPDV 777          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Human
Match: COPA (coatomer protein complex subunit alpha [Source:HGNC Symbol;Acc:HGNC:2230])

HSP 1 Score: 53.1434 bits (126), Expect = 3.144e-6
Identity = 33/105 (31.43%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  815 GVTVVEL--STGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVE 1123
            G+T V+L  +T +V    +  HDR ++   F   + L+ +G  D  +K+W   +SK        GH + VSC  F P   Q  I S   DK++RVW +     V+
Sbjct:  183 GITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHP--RQELILSNSEDKSIRVWDMSKRTGVQ 285          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Human
Match: COPA (coatomer protein complex subunit alpha [Source:HGNC Symbol;Acc:HGNC:2230])

HSP 1 Score: 53.1434 bits (126), Expect = 4.578e-6
Identity = 32/98 (32.65%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  815 GVTVVEL--STGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            G+T V+L  +T +V    +  HDR ++   F   + L+ +G  D  +K+W   +SK        GH + VSC  F P   Q  I S   DK++RVW +
Sbjct:  183 GITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHP--RQELILSNSEDKSIRVWDM 278          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Human
Match: COPA (coatomer protein complex subunit alpha [Source:HGNC Symbol;Acc:HGNC:2230])

HSP 1 Score: 52.7582 bits (125), Expect = 4.773e-6
Identity = 33/105 (31.43%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  815 GVTVVEL--STGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVE 1123
            G+T V+L  +T +V    +  HDR ++   F   + L+ +G  D  +K+W   +SK        GH + VSC  F P   Q  I S   DK++RVW +     V+
Sbjct:  183 GITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHP--RQELILSNSEDKSIRVWDMSKRTGVQ 285          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Fly
Match: Rack1 (gene:FBgn0020618 transcript:FBtr0079565)

HSP 1 Score: 57.3806 bits (137), Expect = 4.662e-8
Identity = 48/184 (26.09%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  602 GPIKELLYN-EDRNEIISSHRNR-LLIWQFR--------------YANKHLIPRLSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            G + ++  N +D + IIS+ R++ L++W+                Y + H I    + +S    +A   S ++T R              + +L+ G  T  +   H + + ++ F    + + +G RD +IK+W + A+ K  ++    GHT  VSC+ F P  S   I SCG D+T++VW+L
Sbjct:   16 GWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRLYGHSHFIS--DVVLSSDGNYALSGSWDQTLR--------------LWDLAAGKTTRRFEG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLAECKFTIQED--GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNL 180          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Fly
Match: Rack1 (gene:FBgn0020618 transcript:FBtr0331238)

HSP 1 Score: 57.3806 bits (137), Expect = 4.662e-8
Identity = 48/184 (26.09%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  602 GPIKELLYN-EDRNEIISSHRNR-LLIWQFR--------------YANKHLIPRLSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            G + ++  N +D + IIS+ R++ L++W+                Y + H I    + +S    +A   S ++T R              + +L+ G  T  +   H + + ++ F    + + +G RD +IK+W + A+ K  ++    GHT  VSC+ F P  S   I SCG D+T++VW+L
Sbjct:   16 GWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRLYGHSHFIS--DVVLSSDGNYALSGSWDQTLR--------------LWDLAAGKTTRRFEG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLAECKFTIQED--GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNL 180          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Fly
Match: Rack1 (gene:FBgn0020618 transcript:FBtr0345448)

HSP 1 Score: 57.3806 bits (137), Expect = 4.662e-8
Identity = 48/184 (26.09%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  602 GPIKELLYN-EDRNEIISSHRNR-LLIWQFR--------------YANKHLIPRLSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            G + ++  N +D + IIS+ R++ L++W+                Y + H I    + +S    +A   S ++T R              + +L+ G  T  +   H + + ++ F    + + +G RD +IK+W + A+ K  ++    GHT  VSC+ F P  S   I SCG D+T++VW+L
Sbjct:   16 GWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRLYGHSHFIS--DVVLSSDGNYALSGSWDQTLR--------------LWDLAAGKTTRRFEG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLAECKFTIQED--GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNL 180          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Zebrafish
Match: si:ch73-174h16.5 (si:ch73-174h16.5 [Source:ZFIN;Acc:ZDB-GENE-160728-123])

HSP 1 Score: 134.42 bits (337), Expect = 4.749e-31
Identity = 125/500 (25.00%), Postives = 222/500 (44.40%), Query Frame = 2
Query:  830 ELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLE-YCSQ--YIGSDITRTSFFTLSTNFIDIWHQN-----HLSDDLLSL--TAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITK---TVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVL------VTRFQYESD-----------------------DSLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLP 2203
            +L+ G +     +LH  +I+ L  + PL+ +     D +I+VW        L+M FVGHT+LV+ LA  P       +S   D T+R WS E+ D V+ + +   CS    +G   +  +FF+ STN +D W  N     H   D ++      +S   N  + +  V C +       +S+  ++      V+T+F +      KV+       + +LL+L +D  +   +T ++P+ +      + R++  S                        +SL     +KP  I      N+ L+  G   G++ V ++ +  K+ F   AH    +  M + P +  L T+G D ++ +W V+P A + LS   S  C   P  L  +   L     D +      V ++++S+ RYD  PS+ H + ++ + AC ++ +F S S   +  ++IW  KN LLR +E++       +    GD+L GI   +  I ++  LP
Sbjct:   55 DLTEGCIIEHKKNLHLGEITGL-IYCPLRDIVFTSGDTTIRVWR---PDWELQMCFVGHTALVTSLALCPVSGLLLSSS--LDGTVRCWSPEVGDHVQIVSIPNECSPPLIMGGSDSAANFFSYSTNSVDFWTFNCLYYLHCRLDWVNRLPICQISTPPNPPSFQACVVCTHG------NSNITVVAADKDAVLTRFQTKG----KVVCADCCVPKKILLVLTEDGVVTIASTLTSPITIQDEWRGIERWEGPSGQTEAKIGTVSCMVLYYDITDKEWESLQTQRAHKPKKIRLLHDENRFLVILGHLGGYVSVLNM-NSAKVQFRTSAHNNKNINSMQAYPDSGFLLTAGEDKAVLVWRVFPCAKQCLSLHFSVLCDHPPVLLALLGTQLILALEDPENKTDSLVQHSLDSQTRYDQQPSERHHKKITGLCACCQLGVFASSSQ--DETVRIWDMKNCLLRILELNVEPECLAYCGESGDLLLGITGDLYRIPNTHLLP 535          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Zebrafish
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:795104])

HSP 1 Score: 52.373 bits (124), Expect = 2.337e-6
Identity = 26/88 (29.55%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  872 HDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDL 1135
            H R +  + +    K L++   D +  +W   D       V  GH + V C+A+ P GS   +A+C  DK++ +W ++  DE ECL +
Sbjct:   60 HQRTVRKVAWSPCGKYLASASFDATTCIWKKTDEDFECLTVLEGHENEVKCVAWAPSGS--LLATCSRDKSVWIWEVDEEDEYECLSV 145          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Zebrafish
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:30722])

HSP 1 Score: 51.6026 bits (122), Expect = 4.333e-6
Identity = 45/165 (27.27%), Postives = 77/165 (46.67%), Query Frame = 2
Query:  644 IISSHRNRLLI-WQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ +I W+  R    + IP+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W+         +    HT  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTL-GVCKYTIQDDSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Xenopus
Match: ENSXETT00000024226.1 (WD repeat-containing protein 97-like [Source:NCBI gene;Acc:101732312])

HSP 1 Score: 68.5514 bits (166), Expect = 4.537e-11
Identity = 82/370 (22.16%), Postives = 154/370 (41.62%), Query Frame = 2
Query:  410 VRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRLSINISHKE-QFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRT--SFFTLSTNF-IDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLS-TIHLENQSLLLILIQDNEILHYTTKSNPM 1504
            +R   ++GR +   A   +P+    L YA  S + +AW     EL +L+++   + +   A     +   +YN  R+++++     + +W F   + HL  +  +    KE     I +++         F     GV   +L  G +   + +LH R I+ L +    + L T  R+G+IK+W        LK V V HT  V+ L+F   G      S   D+T+R W LE  ++V   +       +G +  R    F    + F +D+W   +L      L A V+ M  +   + +      +      S+ R++         SL    P  +    H E+   + +L+++ ++L  ++  +PM
Sbjct:   48 IRQHHTDGRVQA-CAQASLPLCG--LLYAWHSQKLVAWA--HQELRVLDTTLTPLTVCRVAR---GVFCCVYNPGRDQLLTGGTGGVQLWAFSEGSWHLTCKQVLKEGLKETDRVNIIALDTAAPLAHTCFAVCGAGVWEYDLGHGELRRVWNNLHLRPITGLIYSQSRQTLITASREGTIKLWG---KSAELKGVCVAHTGPVTALSFSSSGRYFLSGS--EDRTVRTWDLETQEQVG--EQVLAQPVLGLETFRADGKFLVSRSEFCLDLWQIQNLYQYHTPLGASVTDM-KVSGGQFV----PRVACLCSDSAVRLVATGTGQLLSSLALDGPLAIEFCPHTES---VYVLLKNGDLLRASSVGSPM 394          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Xenopus
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:448353])

HSP 1 Score: 53.5286 bits (127), Expect = 1.383e-6
Identity = 46/166 (27.71%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  644 IISSHRNRLLI-WQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+SS R++ +I W+  R    + +P+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W +  D           HT  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSSSRDKTVIMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGDDTPE------SHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 175          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Xenopus
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:448353])

HSP 1 Score: 51.6026 bits (122), Expect = 3.347e-6
Identity = 46/166 (27.71%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  644 IISSHRNRLLI-WQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+SS R++ +I W+  R    + +P+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++     HT  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSSSRDKTVIMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTVQEE--SHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Xenopus
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:448353])

HSP 1 Score: 52.373 bits (124), Expect = 3.758e-6
Identity = 46/166 (27.71%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  644 IISSHRNRLLI-WQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+SS R++ +I W+  R    + +P+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++     HT  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSSSRDKTVIMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTVQEE--SHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Mouse
Match: Gm35339 (predicted gene, 35339 [Source:MGI Symbol;Acc:MGI:5594498])

HSP 1 Score: 161.77 bits (408), Expect = 2.803e-39
Identity = 164/722 (22.71%), Postives = 298/722 (41.27%), Query Frame = 2
Query:  266 DIIEKQ---DLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGI--PVKFRRLQYANCS----DRYIAWTPDETELAMLNSSFDIVEL----IDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIP---RLSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDL---------EYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKM-------VNIDAN---KCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDDSLVLLTVYKPLSITTDKSP------------------------NKN--LIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDI 2248
            DI+EK+   +L   +++HG+E +R +     +      P  + ++ LDG        +   KD      +  PV    L           R++ W P    L++L   F ++ L    ++++L + P   L        I++     L +W+FR   + L+P    L         F  +         +   F A  + V   +L   ++      LH   IS L +   +  + T  RD ++KVW  AD +I  +MVFVGHT  V+ +   P  + A  AS   D T+R W L    +V  + L         E  S  +          +L +  I++W    L   L  L+APV  +          D +   + +  C +  +  + +++ R ++  ++   D             +  ++  L +L +   ++       PMV+V R +     +     ++    +T  +S                         NKN  L   G   G + V D    +   F  +AH+   V  + S    S + TSG D ++K+W V+P+A E LS + +F C      L  +   +   F D +RA Y  V + +  + R DH P DD ++ ++ +  C  +K+F +CS+  +  I+IWT +N LLR +++  P     F+S  GD++  +G ++  +++S YLP  ++ K++ +   D+
Sbjct:   85 DIVEKEKRAELRVARMTHGLEPLRHLEVEAGLCSVAQDPVGERFMVLDGEGYL----HQHTKDGWEQAKLKPPVILNGLVTVPGPLGEIGRFVGWGP--AGLSILGPDFHLLWLSKPRVNKSLDQEPFCCLPVPSLSLLIVAQMGGSLELWKFRSGGRCLVPCGSPLRPPPGLSGSFKCLALGLEPDHCSWHCFAAYGSAVLTFDLDDWALINVSQDLHKTIISDLDYCEEMDAMVTASRDSTVKVWE-ADWQI--RMVFVGHTGPVTAMTVLPNSTLAVSAS--QDGTIRTWDLRAAAQVGEVTLGCWTEDIISEKVSHLLAPASPGWPVLSLCSKSIELWRVRTLYSPLAQLSAPVLHIQVAPVLPAPTDPSLPARLVCACADGSVHLVSATTGRTVSSLLLEPEDC-------AAGVAYCLSREALWVLTRSGHLVRANAARCPMVVVHRLRPPPPPAPQPCCLHLYSHLTDSRSAFACWEIVRQNQGDMLRSAIAWAWKNKNRFLPVMGHSDGTLSVLDWRT-SVTVFHTEAHSPGPVTAIGST--WSSIVTSGGDLTVKMWRVFPYAEECLSLLQTFSCCHPVVMLCVLGKRITAGFEDPERATYGLVQFGLGDKMRCDHRPQDDPMDHITGLCCCPTLKIF-ACSS-LDCTIRIWTRENHLLRLLQLDGPPQALAFASNYGDLVFSLGSRLHLVSYSTYLPTSYLVKKLCLKASDV 783          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Mouse
Match: Wdr37 (WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:1920393])

HSP 1 Score: 51.2174 bits (121), Expect = 2.193e-6
Identity = 37/134 (27.61%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  728 ISHKEQFATIFSIERTQ--------RENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLE 1105
            I H++    + S+ RTQ         ++  L  + +TG  +V+ +     G   S HD++++        +L+ T  RD + ++W F D  IH   VF GHT  V+   F  G +   + S   D+T++VW L+
Sbjct:   34 IGHRDGIWDV-SVTRTQPIVLGTASADHTALLWSIETGKCLVKYA-----GHVGSGHDQELTHCCTHPTQRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLK 158          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Mouse
Match: Copa (coatomer protein complex subunit alpha [Source:MGI Symbol;Acc:MGI:1334462])

HSP 1 Score: 53.1434 bits (126), Expect = 3.235e-6
Identity = 32/98 (32.65%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  815 GVTVVEL--STGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            G+T V+L  +T +V    +  HDR ++   F   + L+ +G  D  +K+W   +SK        GH + VSC  F P   Q  I S   DK++RVW +
Sbjct:  183 GITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHP--RQELILSNSEDKSIRVWDM 278          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Mouse
Match: Copa (coatomer protein complex subunit alpha [Source:MGI Symbol;Acc:MGI:1334462])

HSP 1 Score: 53.1434 bits (126), Expect = 3.437e-6
Identity = 32/98 (32.65%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  815 GVTVVEL--STGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            G+T V+L  +T +V    +  HDR ++   F   + L+ +G  D  +K+W   +SK        GH + VSC  F P   Q  I S   DK++RVW +
Sbjct:  183 GITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHP--RQELILSNSEDKSIRVWDM 278          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Mouse
Match: Rack1 (receptor for activated C kinase 1 [Source:MGI Symbol;Acc:MGI:101849])

HSP 1 Score: 50.447 bits (119), Expect = 9.838e-6
Identity = 44/165 (26.67%), Postives = 78/165 (47.27%), Query Frame = 2
Query:  644 IISSHRNRLLI-WQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ +I W+  R    + IP+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F +  + + +G RD +IK+W+         +    H+  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTL-GVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. UniProt/SwissProt
Match: sp|A6NE52|WDR97_HUMAN (WD repeat-containing protein 97 OS=Homo sapiens OX=9606 GN=WDR97 PE=2 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 1.636e-38
Identity = 164/724 (22.65%), Postives = 304/724 (41.99%), Query Frame = 2
Query:  257 SVSDIIEKQ---DLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCA-VRLFDSNGRCKDFMAYGGIPVKFRRLQYA----NCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKE----LLYNEDRNEIISSHRNRLLIWQFRYANKHLIPR---LSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQ-----YIGSDITRT----SFFTLSTNFIDIWHQNHLSDDLLSLTAPV-----SKMVNIDANKCL-----VQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDDSLVL--LTVYKPLS------------------------ITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDI 2248
            S+ +++EK+   +L   +L+HG+E +RR+     +      P    ++ LDG   + L   +G  ++ +     PV+   L           R++ W P    LA+L  +  ++ L +Q +   P       L   + R  +++   + L +WQFR   + L+ R   L    S   +   +           R F A  + V   +L   ++      LH   IS L +   ++ + T  RD ++KVW  AD +I  +MVFVGHT  V+ +   P  +   + S   D TLR W L+   +V  + L +  Q      +G  +          +L  + + +W    L   L  L A V     +  +   A++ L       C +  ++ L +++ RI++  ++   D          +  +   +  L +L +   ++       PM ++ R       +     L +Y  L+                            K+ N+ L   G   G + V +    +K  F+ +AH+   VV + S   NS + +SG D ++K+W V+P+A E LS + +F C      L  +   +   F D D A Y  V + +    R DH P DD  + ++ +  C  +KL+ +CS+  +  ++IWT +N LLR ++++       F S  GD++  +G ++  ++H  YLP  ++ K++     D+
Sbjct:   76 SLHEVVEKEKRAELRAARLTHGLEPLRRLEVAAGLRSVAQDPVGGRFVVLDGAGRLHLHKEDGWAQETLL---APVRLTGLVTVLGPLGAVGRFVGWGP--AGLAILRPNLSLLWLSEQGVGRAPGWAPTCCLPVPDLRLLLVAEMNSSLALWQFRSGGRRLVLRGSALHPPPSPTGRLMRLAVAPVPPHHVLRCFAAYGSAVLTFDLHAWTLVDVRRDLHKTTISDLAYCEEVEAMVTASRDSTVKVWE-ADWQI--RMVFVGHTGPVTAMTVLP--NTTLVLSASQDGTLRTWDLQAAAQVGEVALGFWGQDKLSRRVGRLLAPVRPGWPVLSLCASSMQLWRVRELYSPLAQLPAKVLHVQVAPALPAPAHQSLPTRLVCACADGSVYLLSAATGRIVSSLLLEPEDC-------AAAVAYCLPREALWLLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHLTDLEGAFSSWEIVRQHWGELRCSSVACAWKNKNRYLPVVGHTDGTLSVLEWLS-SKTVFQTEAHSPGPVVAIAST-WNS-IVSSGGDLTVKMWRVFPYAEESLSLLRTFSCCYPAVALCALGRRVTAGFEDPDSATYGLVQFGLGDSPRLDHRPQDDPTDHITGLCCCPTLKLY-ACSS-LDCTVRIWTAENRLLRLLQLNGAPQALAFCSNSGDLVLALGSRLCLVSHRLYLPTSYLVKKMCRKAPDV 777          
BLAST of WD repeat-containing protein 97 isoform X2 vs. UniProt/SwissProt
Match: sp|O18640|GBLP_DROME (Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster OX=7227 GN=Rack1 PE=1 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 4.673e-7
Identity = 48/184 (26.09%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  602 GPIKELLYN-EDRNEIISSHRNR-LLIWQFR--------------YANKHLIPRLSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            G + ++  N +D + IIS+ R++ L++W+                Y + H I    + +S    +A   S ++T R              + +L+ G  T  +   H + + ++ F    + + +G RD +IK+W + A+ K  ++    GHT  VSC+ F P  S   I SCG D+T++VW+L
Sbjct:   16 GWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRLYGHSHFIS--DVVLSSDGNYALSGSWDQTLR--------------LWDLAAGKTTRRFEG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLAECKFTIQED--GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNL 180          
BLAST of WD repeat-containing protein 97 isoform X2 vs. UniProt/SwissProt
Match: sp|Q2UGU1|LIS1_ASPOR (Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=nudF PE=3 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 5.268e-6
Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  905 NPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECL 1129
            N    ++TG RD +IK+W   DS+    M  VGH S V  L F PGG    + S   DKTLR W  +LN + +C+
Sbjct:  320 NGADFMATGSRDNTIKIW---DSRGTCLMTLVGHDSWVQALVFHPGGKY--LLSVSDDKTLRCW--DLNQQGKCV 387          
BLAST of WD repeat-containing protein 97 isoform X2 vs. UniProt/SwissProt
Match: sp|B8N9H4|LIS1_ASPFN (Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=nudF PE=3 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 5.268e-6
Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  905 NPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECL 1129
            N    ++TG RD +IK+W   DS+    M  VGH S V  L F PGG    + S   DKTLR W  +LN + +C+
Sbjct:  320 NGADFMATGSRDNTIKIW---DSRGTCLMTLVGHDSWVQALVFHPGGKY--LLSVSDDKTLRCW--DLNQQGKCV 387          
BLAST of WD repeat-containing protein 97 isoform X2 vs. UniProt/SwissProt
Match: sp|C4R6H3|LIS1_KOMPG (Nuclear distribution protein PAC1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=PAC1 PE=3 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 7.834e-6
Identity = 42/124 (33.87%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  872 HDRQISALTFFNP-----------LKLLSTGCRDGSIKVWSFADSKIHLKMV--FVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGS-DITRTSFFTLSTN 1201
            H R I+ + F N              LL+TG  D  IK+W   DS  +LK +    GH +++SCL F P    + + SC  DKT +VW       V  L     S ++ S DI RT  FTL+++
Sbjct:  170 HTRSINTIKFMNQEVMDGHSTKKNRLLLATGSSDLLIKIWDIEDSA-NLKALRTLTGHENIISCLCFHP-TEPSKLVSCSKDKTTKVWDTRTGSIV--LSFVGHSNWVRSVDINRTGEFTLTSS 289          
BLAST of WD repeat-containing protein 97 isoform X2 vs. TrEMBL
Match: K1QRV3 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10025114 PE=4 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 2.822e-128
Identity = 429/1579 (27.17%), Postives = 710/1579 (44.97%), Query Frame = 2
Query:  188 ENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRL--SINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLE------------NQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESD-DSLVLLTVYKPL---------------------SITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDIAALSNVTPLEVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDIXXXXXXXXXXXXXXXXXXXXDRLHILEDDIRKIQQGNHDKPKRKYEHFIEAPS------KSDIFNHYFSQIVKYSKITLPGE----VEDTKFKSNL----QPLVPDKYKKSDKEGFFPSRETISK---------IMAPENLRKGGYIPNSAVLQSLW-PPKVLSEKA-DIWRPTMLSDLDIKQLELLKTT------------VIENEEEETKYF-DWDSDKDSERT----------VASPEQIEVL--------------------SEDLSEDLMSKYGSIFEEKQSIKEEINEEELDTKPVENESPIEIKKRPVTTK--VSKESLKLPIIARKPATMPEIKRVRFISSADDIAEEVKSPKVSMEIPKDNSNESSFFMTQIPTESDKKSVLPRFISRFETDSWFNRICPPPHNDEKCLMSLPTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEINKAMEKAILEL----ASLEKEAQLSLLKSCLHLMASLEGISDRSLVTICLSRFFDADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDLCKIVSDWLDKWFQSMTQFAAECREIIGKEIHLIGTRHGILSNSTVTCLESVKNVFHCHILSPADLVL-------LYPHEKNPKS-----------------ILNYINCLNYF---RFKKLLKEHSIISDRK----TETEVGPKKTIVSLPKLNPEKQFLVRLGESHALGMEEKTKKDFLTLNTMSYRSNISDFTQHPSMQPFHHYQVALGGG----------FVPFMHLRLKPCLVNPFP 4471
            E  K +   KA   W+LLRRS+    + ++  DL +  +SHGI  +R++NH + I+   F+     Y+T DG  V +F  +GR K   A          + Y + S++++ +T  + EL ++N+ F   E+I QA     I    YN +  E I+      + W FRY  +HLIPR    I  +    F+ +  +E T    QR +L++   V V  +  G+       LH+R I+ LTFFNPLK L TG +DGSIKVW   D+  +LKMVFVGHT  +S L+ +P G    I S   D T+RVW+L+  DEV+   L+  +  + +++    FFT S   +D+W   HL     S+   + + V           +   L     SS R+IT             N +VLST+ L+            N+  L +++ + +IL  +TK+NPM +   ++ ++  ++   L VY+ +                     S  +  S  K ++  G K G I V D  D  ++ F IDAH    V+ M ++    +L ++G DN IK+W +YPFA E L+ ++SF+C   P ++  +   L   F D   A Y  V+YN++ R RYDH P DDH + ++ +++C+RMKL+ S S   +  I+IW   N L+R +++    Y   F S +GD+L GI + +  I ++ YLPK ++ K + M F D       TP  V+E  I+ K S  +  +L    S FKY  + DILT++EE E++  +K K+    +L   E+++ +I++ +  K +R  E   +          S+ F +YF       +  LP E    +ED   +  +     P  P++    +  GFFP     S+         + A ++    G++PNS +++ LW PP    EK+ + WRP  LSD  ++++E  K              V E++++ T    DW+ +K + ++          V +P + EV                     +      LMS++  +  +     EE  +++  T  +   SPIE K+ PVT K  +S +    P     P    E+K ++ +         VK  K S  +             + PT    ++ LP F+++F+   WF +  P     +    ++P P  A++F M  L+ L  +      + + +A+  LY+ E I    +  + K +  A+L L     +   E Q + + S L  M+   GI D+  V+  + +F D D E++  +  +L  +GL+D      +EL ++ +++V   ++R  DL K+   WLD+W  S      +  E + K  ++ G   G    S  T   S +++     +   D +L         P E+  +S                    Y++ +NYF     +K L+       RK     E  V  K T++ LPKL P K  LVRLGE+H      + + +      + YR                 Y    G G          F P ++L +K   +NPFP
Sbjct:   26 ERRKTEEKRKALGHWDLLRRSVKKTVEAVKDSDLKNKVVSHGIHHLRKLNHDHSIKSVAFMKDRKEYMTTDGGNVSIFYEDGRKK---ATFTPEETMDTIIYCSHSNQFVGYTKGDDELFLMNTEF---EIISQARNPCKINLAKYNHNTMEFITFGPGYFVCWAFRYGARHLIPRKMNKIIFTADNAFSHLV-LEETASRQQRCYLSHGKDVVVYNVFMGNQLTMKKDLHERIITGLTFFNPLKYLITGAKDGSIKVW---DNDWYLKMVFVGHTRAISVLSVYPDG--PAIVSASHDSTVRVWNLDSCDEVDRAKLDAPAVGMATELNYFVFFTYSGKTVDLWRIQHL----FSIHTSIGQRVVAIKQTSHPNHQIRSLVVSRDSSVRLITPP-----------NGEVLSTLLLDPAKGIVDAAYAINEEKLFVVLNNGDILKCSTKTNPMSIEKTWKIQNPREACNYLLVYEYVPDFKSDAWAAFKRGLATNTIGSGGSQTSRAKTILLGGRKDGHICVFDWED-GRVIFSIDAHGVKGVLSMKANSKQDQLISAGKDNIIKVWRLYPFAEEALAPLMSFYCAHTPVHMTMLKTNLCVAFQDHATATYNIVIYNLKDRNRYDHQPDDDHTDTITGLTSCQRMKLYASSS--LDGTIRIWDETNNLIRLLKLKTMPYSVGFCSERGDLLVGISHHLYKIPYTAYLPKAYIFKMVSMRFADPKP---ETPFPVDENQIK-KLSKREYTRLKKSHSSFKYNHFEDILTKEEEEEVHREQKIKEEAFSKLRAREEELVQIKE-SQIKARRTEEMERKKKKKKEVKINSEAFINYFKMYYDKDRPQLPPENPYALEDFLSRGEVDEEENPFKPER----EPTGFFPPINKASRPATAAEEPLMPAYQSATTSGFVPNSVLVKILWPPPPPQPEKSQESWRPPSLSDGQLEEIEKEKEPSEGEKEITVDDLVPEDDQDRTLIIDDWEDEKSAPQSPIPSSGTRTPVYTPPRKEVTFSRQPTVHVLETPPKTPSPPASTRQSSLMSRFNDLMTK----NEEEKDDDESTVTMTPRSPIE-KEPPVTPKSSLSDKPPSEPKPPSLPPPKREVKPLKPL---------VKYTKPSAPVDPLPPKPRPVAPQREPTPPRPETPLPGFVTQFKGAEWFEKFFP-----DASEANIPKPWTADNFMM-TLNRLLRIAEYMHKIAVTDAMAMLYTQEDIGDGTVHSVAKNL-IAVLNLHKEPPTCMVEEQKNFIISALRAMSKF-GIKDKEFVSELMVQFLDGDKEVRMTVIDLLSSIGLQDPQKFFSKELDSWDIWNVE-EEDRKGDLRKMCQQWLDRWMTSYKLHLTDTIERMTKGQNIQGRMRG-GGKSRGTPPPSNRSILKKPSIGGGDTILEDQETVTTIPDERTSRSRSITVTFDKPPDPALIDSATYVDAINYFCDMMMEKALESLKRGGGRKPPGSKENVVQAKNTVLVLPKL-PHKPALVRLGETHTSTCRPQRETNL----HVDYR-----------------YPATTGRGNQPIPGDITHFTPSINLPMKTLYMNPFP 1519          
BLAST of WD repeat-containing protein 97 isoform X2 vs. TrEMBL
Match: A0A2C9JIJ0 (WD_REPEATS_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106070554 PE=4 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 1.173e-111
Identity = 275/936 (29.38%), Postives = 472/936 (50.43%), Query Frame = 2
Query:  203 DANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRLSINISHKEQ--FATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNID----ANKCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQ-------------YE-----SDDSLV-----LLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDIAALSNVTPLEVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDIXXXXXXXXXXXXXXXXXXXXDRLHILEDDIRKIQQGN---HDKPKRKYEHFIEAPSKSDIFNHYFSQIVKYSKITLPGE--VEDTKFKSNLQPLV--------PDKYK-KSDKEGFFPSRETISKIMAPENLRK---------GGYIPNSAVLQSLWPPKVLSEKADIWRPTMLSDLDIKQL 2854
            + +E+AK+ W+ LR+S+ SV  ++E+ D+ D+ L+HGI   R++NH   I Q ++IP    YL+ DG    LF  +G  KD +      +K  R  Y N +D+Y+ W   E +L ++   F I   I Q++  G +   LYNE   E+I+   + +  W FRY  K+L PR +I  +  E+  FA +  +E T  ++Q+++ A  TG+ V  L +G        LH + I+AL+FFNPLK + TG +DG IKVW   D    + MVFVGH+  ++ L  +P   +    S   D T+RVWS+E  DE++   +      IG+++    F+T +   +D+W  +HL     ++   V+++   D      + L+ CR++    +   + ++IT  ++   D L       +  ++   +  +  L+   EI+   T  NP  +V+R++             YE     + DS V     +LT           + N+ L+  G K G+I V D     ++TF+I+AH+   V+ +IS+   +++ ++GMDN IK+W ++PFA E L+ ++SF+C   P ++  I   L   F D   A +  V+Y++   +R DH P DDH++ ++  ++C RMK++ SCS   +  I+IW+H N L+R ++++   +   F S +GD+L GI   + YI+H +YLPK +++KQ+ M F  I    N   +E +E  +++     D  +L    + F +  Y DIL+ +EE  +   K+ ++     L I ++++ +I+ G    H+KPK   +      +++  F  Y        K  LP E  +++   ++  Q L          +KY+ ++   GFFP  E   K     +L            GY+PNS +L+ L+PP    E+    +P     L  KQL
Sbjct:   16 EVHERAKQCWDTLRQSVLSVKKVLEEADVKDVTLTHGIYRDRKLNHHQMIHQVMYIPEHKEYLSCDGHNFHLFQEDGIKKDVVK---CEIKLNRFVYCNQTDQYVVWNHGEEDLFLMTKEFMI---ISQSVAIGSVTIGLYNEKTGELITIGPHFITSWIFRYRAKYLTPRKTIRPTFGEENMFAAVV-LEDTASKSQKMYCAVGTGLVVYNLFSGLEVCRRTELHTQPITALSFFNPLKYVITGAKDGCIKVW---DINWKVLMVFVGHSKEINFLKLYP--HETCFISVSLDCTMRVWSMETCDEIDKTIISEPISGIGTEMNSDIFYTFTGKRVDLWRIHHLYQMHTNIGYRVNRIKVTDHVAYPKQALLLCRDSSARIVCPCNGKVITTLLLQPSDGL-------VDAVYAIAEKTVFALLASGEIVKARTNCNPCQVVSRWKCNNITEQCSNLLVYEYIVDPTGDSDVWSKAKVLTKNGRGQKNIHSNKNRTLLLGGRKDGYICVIDWMT-GEVTFKIEAHSGKSVLSIISNSKLNQIISAGMDNIIKVWRLFPFAEEALTPLMSFYCAHTPVHMTAIKTTLGVAFQDPSTATFSVVLYSLSDNSRNDHRPDDDHMDVITGFTSCARMKIYASCS--MDGTIRIWSHTNSLIRILKVNSLPHSLSFCSSKGDLLVGINNHLFYIHHKQYLPKYYLRKQVCMKFLPI---QNEDSIEYDENRLKA-LDKNDVKRLKNAHAAFTFPQYFDILSPEEEEAMLKEKQVREKAYGLLEIRDNELCQIRDGTLIAHNKPKATKK------TRNKAFKEYMKIYYNKEKPKLPEEESIKEAVIRTLNQELKDYEGIEAEEEKYRAETPPVGFFP--ELAQKYQELPSLSTDHACLPSVINGYLPNSVLLKILFPPPKAQEEEKDKKPYQPPKLTRKQL 917          
BLAST of WD repeat-containing protein 97 isoform X2 vs. TrEMBL
Match: A0A267EEE5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015780g2 PE=4 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 4.279e-109
Identity = 262/961 (27.26%), Postives = 470/961 (48.91%), Query Frame = 2
Query:  125 IKMSEVLNFYLQKYGLIEKQTENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFVRRINHINPIEQ-AVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPR--LSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQ-------YIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDAN--------KCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLEN--QSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDD-SLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDIAALSNVTPL--EVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDIXXXXXXXXXXXXXXXXXXXXDRLHILEDDIRKIQQGNHDKPKRKYEHFIEAPSKSDIFNHYFSQIVKYSKITLPGEVE--DTKFKSNLQPLVPDKYKKSDK----EGFFPSRETISKIMAP-ENLRKGGYIPNSAVLQSLWPPKVLSE--------KADIWRPTMLSDLDIKQLELLKTTVIENEEE 2893
            + MS V+   L+++ L+++  +   I+     + RW +LR  + SVSD I K+D  ++ +SHGI   R ++H  PI    +     +  LTLDG  +R +DS GR  D +A    P    RL YA+   +++ WT     L  L+  F +   + +A  E P+ ++LYN ++ E++S    ++  W FR+ N+HL+PR  L   +     F ++ ++E T  + QR F A D  V V+ L  G     +  LH   ISA+ FFNP+KLL TG +DGS+K W     ++H   VFVGH   V+ L F+P G    + S   D+++RVW LEL D+V+ + L+  +         + +     +F+T     +  W    +     SL APV   + I A+        + LV C+++ +  +  ++  I++ + +     L  + P+V +  +  +  +  L   + D  +  +   S P  L+  +           L +Y+          +K+L+ +G   G +  +         + +D H    V+ + ++P   ++ ++G+DN I++W V+PF  E L+ ++ FFC   P  +  + + L   F D   A Y  V Y++E ++R DHSP DDH++ ++  +AC +++LF + S   +  +++W+  N LL+ +++H       F S  GD+L GIG  +  I H +YLPK+  ++  +M+FE  A      PL  E+NE ++ ++    DR +L   +    ++++ D    +EE +    +  ++     +   E ++R ++ G+  KPKR+        +K + FN +   +  +  +  P +    D   KS L+P    + K++ +     GFFPS++   +  A    + +GG +PNS + + LWP + L E         A  WRP  L+   ++QL+ L+    E+E E
Sbjct:    1 LAMSHVVEDLLERHSLLDRPKKPRMINGESAVEYRWRVLRNCVKSVSDDIMKEDALNLFVSHGIVPGRSLSHAQPITDFLLLPQLPNPLLTLDGAFLRFYDSEGRLADVVA---PPKPIARLAYASHVGQFVGWTEGGRTLINLSGEFAV---LTEATTEAPLTQVLYNANKEEVLSFEPGQITSWVFRFGNRHLLPRRRLQAGLPADRGF-SLVALEDTAAKRQRAFCAMDRSVHVLLLQQGQCAAVHRDLHSDAISAVHFFNPMKLLCTGAKDGSVKAWVADTFRVHC--VFVGHNGAVNALHFYPTGP--MLLSASEDRSVRVWHLELRDQVDEVRLDSAADPDAETPLRLAAQFGAAAFYTSGARSVRAWRVQEIYTHRASLCAPV---LRIQASPPRPGQPPRVLVTCQDSSVHVVSPATGAILS-SALAGGSGLAGEAPQVAAAAYSTDPKRHRLYCAMSDGSLAEWDPDSRPARLLRSWPSPGPGCECRCLALYE---YAAGGGASKSLLVAGRADGSLCTYGE---QGPDYAVDGHGNKGVLELEANPSQDQVVSAGLDNIIRVWRVFPFVREALAPLMQFFCAHTPVCMSALRSLLLVGFQDAQSATYSVVTYDLEDKSRQDHSPEDDHLDKLTGAAACPKLRLFATVS--QDGTLRVWSSANQLLKAVQLHARPQGVAFCSDTGDLLLGIGASLYGIEHRRYLPKMQTRRMAMMHFEPAAP----EPLSGEMNERLL-AELPFPDRQRLLACRPAHSFDAFADPDPLEEEPDDVEERLAREAAFGTIASRERELRMLRDGDI-KPKRRPA--ATPATKEEAFNKFLLLVADHPVLPPPPKEANLDAAVKSALEPPQLPRPKQAYRPDICPGFFPSQDAAVRPQAGLAPIPRGGCVPNSVLAKLLWPQEALLEHEKTATQASARGWRPPDLNVEQLRQLQGLRQRGSEDEAE 930          

HSP 2 Score: 130.954 bits (328), Expect = 1.490e-26
Identity = 111/436 (25.46%), Postives = 187/436 (42.89%), Query Frame = 2
Query: 3338 LPRFISRFETDSWFNRICPPPHNDEKCLMSLPTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEINKAMEKAILELASLEKEA----QLSLLKSCLHLMASLEGISDRSLVTICLSRFFDADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDLCKIVSDWLDKWFQSMTQFAAECREIIGKEIHLIGTRHGILSNSTVTCLESVKNVFHCHILSPADLVLLYPHEKNPKSILN---YINCLNYFRFKKLLKEHSIISDRK-------------------TETEVGPKKTIVSLPKLNPEKQFLVRLGESHALGMEEKTKKDFLTLNTMSY-RSNISDFTQHPSMQPFHHYQVALGGGFVPFMHLRLKPCLVNPFPRDEDFIEWEKANPKSLFG--SYNKAFIPQFS 4558
            LP ++++F  + WF+   P P        SLP PL   +F   LL  L      E    +  A+  L + E++ +    +  +   + +LEL  L  +     Q   ++  L L+   +G  D+ L+T  L  +F+ D   + F+   L  LG +D    +EREL  + ++SV   ++R   L + +SDWL++W  +      +  E + +   L G           T   S K            + + +    +P  + +   Y+  +NYF   +L ++ + +  +K                    E E   K TI+ LP L P++  L+RLGESH   ++   ++DF      +   +  +D +Q  + QP   YQ  + GGF P MHL +KP  +NPFP   D ++WE A    L       + FIP  S
Sbjct: 1134 LPDYVAQFADEDWFDAAFPEPRR-----RSLPDPLTPATFAGRLLRLLPGAGWPERSA-VCRAVQQLQTLESLGR----QCQQEARRIVLELLELPPDCGVAEQRDFVRHGLTLLT--QGGPDKPLLTELLLWYFEGDELTQSFVMEALNFLGRKDEHHCLERELDQWDVWSVTEPEKRRPHLRRAISDWLERWLANFRAAVRQTAERLARGEQLQGR-----VPQAATAAASGKP-----------MTVTFETAPDPSRLADSGTYMEAVNYFCETQLSQQLARLRSKKRSSMRAGRPAAARAAGTGEAEAEPARKNTILVLPTL-PQRTSLMRLGESHG-DVQPARRRDFGAGGVGTLVAAAATDSSQPAACQPGRAYQQVMRGGFAPLMHLPMKPVRLNPFPSLLDDLDWEAATQPVLLTLKCSGRMFIPALS 1539          
BLAST of WD repeat-containing protein 97 isoform X2 vs. TrEMBL
Match: A0A267DA28 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015780g4 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.317e-108
Identity = 260/958 (27.14%), Postives = 469/958 (48.96%), Query Frame = 2
Query:  125 IKMSEVLNFYLQKYGLIEKQTENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFVRRINHINPIEQ-AVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPR--LSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQ-------YIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDAN-----KCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLEN--QSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDD-SLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDIAALSNVTPL--EVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDIXXXXXXXXXXXXXXXXXXXXDRLHILEDDIRKIQQGNHDKPKRKYEHFIEAPSKSDIFNHYFSQIVKYSKITLPGEVE--DTKFKSNLQ-PLVP---DKYKKSDKEGFFPSRETISKIMAP-ENLRKGGYIPNSAVLQSLWPPKVLSE--------KADIWRPTMLSDLDIKQLELLKTTVIENEEE 2893
            + MS V+   L+++ L+++  +   I+     + RW +LR  + SVSD I K+D  ++ +SHGI   R ++H  PI    +     +  LTLDG  +R +DS GR  D +A    P    RL YA+   +++ WT     L  L+  F +   + +A  E P+ ++LYN ++ E++S    ++  W FR+ N+HL+PR  L   +     F ++ ++E T  + QR F A D  V V+ L  G     +  LH   ISA+ FFNP+KLL TG +DGS+K W     ++H   VFVGH   V+ L F+P G    + S   D+++RVW LEL D+V+ + L+  +         + +     +F+T     +  W    +     SL APV ++    +      + LV C+++ +  +  ++  I++ + +     L  + P+V ++ +  +  +  L   + D  +  +   S P  L+  +           L +Y+          +K+L+ +G   G +  +         + +D H    V+ + ++P   ++ ++G+DN I++W V+PF  E L+ ++ FFC   P  +  + + L   F D   A Y  V Y++E ++R DHSP DDH++ ++  +AC +++LF + S   +  +++W+  N LL+ +++H       F S  GD+L GIG  +  I H +YLPK+  ++  +M+FE  A      PL  E++  ++ ++    DR +L   +    ++++ D    +EE +    +  ++     +   E ++R ++ G+  KPKR+        +K + FN + S +  +  +  P +    D   KS L+ P +P     Y+     GFFPS++   +  A    + +GG +PNS + + LWP + L E         A  WRP  L+   ++QL+ L+    E+E E
Sbjct:    1 LAMSHVVEDLLERHSLLDRPKKPRMINGESAVEYRWRVLRNCVKSVSDDIMKEDALNLFVSHGIVPGRSLSHAQPITDFLLLPQLPNPLLTLDGAFLRFYDSEGRLADVVA---PPKPIARLAYASHVGQFVGWTEGGRTLINLSGEFAV---LTEATTEAPLTQVLYNGNKEEVLSFEPGQITSWVFRFGNRHLLPRRRLQAGLPADRGF-SLVALEDTAAKRQRAFCAMDRSVHVLLLQQGQCAAVHRDLHSDAISAVHFFNPMKLLCTGAKDGSVKAWVADTFRVHC--VFVGHNGAVNALHFYPTGP--MLLSASEDRSVRVWHLELRDQVDEVRLDSAADPDAETPLRLAAQFGAAAFYTSGARSVRAWRVQEIYTHRASLCAPVLRIQASPSRPGQPPRVLVTCQDSSVHVVSPATGAILS-SALAGGSVLAGEAPQVAASAYSTDPKRHRLYCAMSDGSLAEWDPDSRPARLLRSWPSPGPGCECRCLALYE---YAAGGGASKSLLVAGRADGSLCTYGE---QGPDYAVDGHGNKGVLELEANPSQDQVVSAGLDNIIRVWRVFPFVREALAPLMQFFCAHTPVCMSALRSLLLVGFQDAQSATYSVVTYDLEDKSRQDHSPEDDHLDKLTGAAACPKLRLFATVS--QDGTLRVWSSANQLLKAVQLHARPQGVAFCSDTGDLLLGIGASLYGIEHRRYLPKMQTRRMAMMHFEPAAP----EPLSGEMDARLL-AELPFPDRQRLLACRPAHSFDAFADPDPLEEEPDDVEERLAREAAFGTIASRERELRMLRDGDI-KPKRRPA--ATPATKEEAFNKFLSLVADHPVLPPPPKEANLDAAVKSALEPPQLPRPKQAYRPDICPGFFPSQDAAVRPQAGLAPIPRGGCVPNSVLAKLLWPQEALLEHEKTATQASARGWRPPDLNVEQLRQLQGLRQRGSEDEAE 930          

HSP 2 Score: 126.716 bits (317), Expect = 2.885e-25
Identity = 111/437 (25.40%), Postives = 187/437 (42.79%), Query Frame = 2
Query: 3347 FISRFETDSWFNRICPPPHNDEKCLMSLPTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEINKAMEKAILELASLEKEA----QLSLLKSCLHLMASLEGISDRSLVTICLSRFFDADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDLCKIVSDWLDKWFQSMTQFAAECREIIGKEIHLIGTRHGILSNSTVTCLESVKNVFHCHILSPADLVLLYPHEKNPKSILN---YINCLNYFRFKKLLKEHSIISDRK-------------------TETEVGPKKTIVSLPKLNPEKQFLVRLGESHALGMEEKTKKDFLT-----LNTMSYRSNISDFTQHPSMQPFHHYQVALGGGFVPFMHLRLKPCLVNPFPRDEDFIEWEKANPKSLFG--SYNKAFIPQFS 4558
            ++++F  + WF+   P P        SLP PL   +F   LL  L      E    L  A+  L + E++ +    +  +   + +LEL  L  +     Q   ++  L L+   +G  D+ L+T  L  +F+ D   + F+   L  LG +D    +EREL  + ++SV    +R   L + +SDWL++W  +      +  E + +   L G           T   S K            + + +    +P  + +   Y+  +NYF   +L ++ + +  +K                    E E   K TI+ LP L P++  L+RLGESH   ++   ++DF       ++T+   +  +D +Q  + QP   YQ  + GGF P MHL +KP  +NPFP   D ++WE A    L       + FIP  S
Sbjct: 1135 YVAQFADEDWFDAAFPEPRR-----RSLPDPLTPATFAGRLLRLLPGAGWPERSA-LCRAVQQLQTLESLGR----QCQQEARRIVLELLELPPDCGVAEQRDFVRHGLTLLT--QGGPDKPLLTELLLWYFEGDELTQSFVMEALNFLGRKDEHHCLERELDQWDVWSVTEPDKRRPHLRRAISDWLERWLANFRAAVRQTAERLARGEQLQGR-----VPQAATAAASGKP-----------MTVTFETAPDPSRLADSGTYMEAVNYFCETQLSQQLARLRSKKRSSMRAGRPAAARAAGTGEAEAEPARKNTILVLPTL-PQRTSLMRLGESHG-DVQPARRRDFGAGVGGGVSTL-VAAAATDSSQPAACQPGRAYQQVMRGGFAPLMHLPMKPVRLNPFPSLLDDLDWEAATQPVLLTLKCSGRMFIPALS 1540          
BLAST of WD repeat-containing protein 97 isoform X2 vs. TrEMBL
Match: A0A267DQJ6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031224g1 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.502e-108
Identity = 259/956 (27.09%), Postives = 470/956 (49.16%), Query Frame = 2
Query:  131 MSEVLNFYLQKYGLIEKQTENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFVRRINHINPIEQ-AVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPR--LSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQ-------YIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDAN-----KCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLEN--QSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDD-SLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDIAALSNVTPL--EVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDIXXXXXXXXXXXXXXXXXXXXDRLHILEDDIRKIQQGNHDKPKRKYEHFIEAPSKSDIFNHYFSQIVKYSKITLPGEVE--DTKFKSNLQPLVPDKYKKSDK----EGFFPSRETISKIMAP-ENLRKGGYIPNSAVLQSLWPPKVLSE--------KADIWRPTMLSDLDIKQLELLKTTVIENEEE 2893
            MS V+   L+++ L+++  +   I+     + RW +LR  + SVSD I K+D  ++ +SHGI   R ++H  PI    +     +  LTLDG  +R +DS GR  D +A    P    RL YA+   +++ WT     L  L+  F +   + +A+ E P+ ++LYN ++ E++S    ++  W FR+ N+HL+PR  L   +     F ++ ++E T  + QR F A D  V V+ L  G     +  LH   ISA+ FFNP+KLL TG +DGS+K W     ++H   VFVGH   V+ L F+P G    + S   D+++RVW LEL D+V+ + L+  +         + +     +F+T     +  W    +     SL APV ++    +      + LV C+++ +  +  ++  I++ + +     L  + P+V ++ +  +  +  L   + D  +  +   S P  L+  +           L +Y+          +K+L+ +G   G +  +         + +D H    V+ + ++P   ++ ++G+DN I++W V+PF  E L+ ++ FFC   P  +  + + L   F D   A Y  V Y++E ++R DHSP DDH++ ++  +AC +++LF + S   +  +++W+  N LL+ +++H       F S  GD+L GIG  +  I H +YLPK+  ++  +M+FE  A      PL  E++  ++ ++    DR +L   +    ++++ D    +EE +    +  ++     +   E ++R ++ G+  KPKR+        +K + FN + S +  +  +  P +    D   KS L+P    + K++ +     GFFPS++   +  A    + +GG +PNS + + LWP + L E         A  WRP  L+   ++QL+ L+    E+E E
Sbjct:    1 MSHVVEDLLERHSLLDRPKKPRMINGESAVEYRWRVLRNCVKSVSDDIMKEDALNLFVSHGIVPGRSLSHAQPITDFLLLPQLPNPLLTLDGAFLRFYDSEGRLADVVA---PPKPIARLAYASHVGQFVGWTEGGRTLINLSGEFAV---LTEAITEAPLTQVLYNGNKEEVLSFEPGQITSWVFRFGNRHLLPRRRLQAGLPADRGF-SLVALEDTAAKRQRAFCAMDRSVHVLLLQQGQCAAVHRDLHSDAISAVHFFNPMKLLCTGAKDGSVKAWVADTFRVHC--VFVGHNGAVNALHFYPTGP--MLLSASEDRSVRVWHLELRDQVDEVRLDSAADPDAETPLRLAAQFGAAAFYTSGARSVRAWRVQEIYTHRASLCAPVLRIQASPSRPGQPPRVLVTCQDSSVHVVSPATGAILS-SALAGGSVLAGEAPQVAASAYSTDPKRHRLYCAMSDGSLAEWDPDSRPARLLRSWPSPGPGCECRCLALYE---YAAGGGASKSLLVAGRADGSLCTYGE---QGPDYAVDGHGNKGVLELEANPSQDQVVSAGLDNIIRVWRVFPFVREALAPLMQFFCAHTPVCMSALRSLLLVGFQDAQSATYSVVTYDLEDKSRQDHSPEDDHLDKLTGAAACPKLRLFATVS--QDGTLRVWSSANQLLKAVQLHARPQGVAFCSDTGDLLLGIGASLYGIEHRRYLPKMQTRRMAMMHFEPAAP----EPLSGEMDARLL-AELPFPDRQRLLACRPAHSFDAFADPDPLEEEPDDVEERLAREAAFGTIASRERELRMLRDGDI-KPKRRPA--ATPATKEEAFNKFLSLVADHPVLPPPPKEANLDAAVKSALEPPQLPRPKQAYRPDICPGFFPSQDAAVRPQAGLAPIPRGGCVPNSVLAKLLWPQEALLEHEKTATQASARGWRPPDLNVEQLRQLQGLRQRGSEDEAE 928          

HSP 2 Score: 127.102 bits (318), Expect = 2.180e-25
Identity = 111/436 (25.46%), Postives = 184/436 (42.20%), Query Frame = 2
Query: 3347 FISRFETDSWFNRICPPPHNDEKCLMSLPTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEINKAMEKAILELASLEKEA----QLSLLKSCLHLMASLEGISDRSLVTICLSRFFDADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDLCKIVSDWLDKWFQSMTQFAAECREIIGKEIHLIGTRHGILSNSTVTCLESVKNVFHCHILSPADLVLLYPHEKNPKSILN---YINCLNYFRFKKLLKEHSIISDRK-------------------TETEVGPKKTIVSLPKLNPEKQFLVRLGESHALGMEEKTKKDFLTLNTMSYR----SNISDFTQHPSMQPFHHYQVALGGGFVPFMHLRLKPCLVNPFPRDEDFIEWEKANPKSLFG--SYNKAFIPQFS 4558
            ++++F  + WF+   P P        SLP PL   +F   LL  L      E    L  A+  L + E++ +    +  +   + +LEL  L  +     Q   ++  L L+   +G  D+ L+T  L  +F+ D   + F+   L  LG +D    +EREL  + ++SV    +R   L + +SDWL++W  +      +  E + +   L G           T   S K            + + +    +P  + +   Y+  +NYF   +L ++ + +  +K                    E E   K TI+ LP L P++  L+RLGESH   ++   ++DF T           +  +D +Q  + QP   YQ  + GGF P MHL +KP  +NPFP   D ++WE A    L       + FIP  S
Sbjct: 1133 YVAQFADEDWFDAAFPEPRR-----RSLPDPLTPATFAGRLLRLLPGAGWPERSA-LCRAVQQLQTLESLGR----QCQQEARRIVLELLELPPDCGVAEQRDFVRHGLTLLT--QGGPDKPLLTELLLWYFEGDELTQSFVMEALNFLGRKDEHHCLERELDQWDVWSVTEPDKRRPHLRRAISDWLERWLANFRAAVRQTAERLARGEQLQGR-----VPQAATAAASGKP-----------MTVTFETAPDPSRLADSGTYMEAVNYFCETQLSQQLARLRSKKRSSMRAGRPAAARAAGTGEAEAEPARKNTILVLPTL-PQRTSLMRLGESHG-DVQPARRRDFGTGVGGGVSTLVAAAATDSSQPAACQPGRAYQQVMRGGFAPLMHLPMKPVRLNPFPSLLDDLDWEAATQPVLLTLKCSGRMFIPALS 1538          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Cavefish
Match: ENSAMXT00000041113.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:381466:384940:1 gene:ENSAMXG00000034183.1 transcript:ENSAMXT00000041113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 7.004e-19
Identity = 48/173 (27.75%), Postives = 88/173 (50.87%), Query Frame = 2
Query: 1607 LIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIE---MHFPVY 2116
            L+  G + G I V  +   N + + + AH   +V C+ + P  + + T+G D S+ +W V+P A + +S  +S FC   P  +  +++ L         A +  V Y++ +  R DH P  DH   ++ +  C R+ +F+SCS   ++ ++IW  +N L+R  +   +H  VY
Sbjct:    8 LVILGHRSGGISVMQMHSGN-VQYRVSAHNGQDVHCIRAYPDTNCILTAGEDRSVLVWRVFPHAQDCVSLQVSVFCAHTPVCVAMLDSLLTICLQQPQSATFSLVQYDLNTHTRTDHPPHHDHSSTITGLCVCPRLCVFVSCS--QDSTVRIWDEENRLVRSAQCVCVHVCVY 177          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Cavefish
Match: ENSAMXT00000040926.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:381466:384940:1 gene:ENSAMXG00000034183.1 transcript:ENSAMXT00000040926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.947e-10
Identity = 34/128 (26.56%), Postives = 62/128 (48.44%), Query Frame = 2
Query: 1607 LIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVS 1990
            L+  G + G I V  +   N + + + AH   +V C+ + P  + + T+G D S+ +W V+P A + +S  +S FC   P  +  +++ L         A +  V Y++ +  R DH P  DH   ++
Sbjct:    8 LVILGHRSGGISVMQMHSGN-VQYRVSAHNGQDVHCIRAYPDTNCILTAGEDRSVLVWRVFPHAQDCVSLQVSVFCAHTPVCVAMLDSLLTICLQQPQSATFSLVQYDLNTHTRTDHPPHHDHSSTIT 134          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Cavefish
Match: ENSAMXT00000032472.1 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 51.6026 bits (122), Expect = 2.009e-6
Identity = 44/166 (26.51%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  644 IISSHRNR-LLIWQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ +++W+  R    + +P+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++    GH+  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDE--GHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Cavefish
Match: ENSAMXT00000007662.2 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 52.373 bits (124), Expect = 2.166e-6
Identity = 44/166 (26.51%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  644 IISSHRNR-LLIWQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ +++W+  R    + +P+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++    GH+  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDE--GHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Cavefish
Match: ENSAMXT00000047239.1 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 52.373 bits (124), Expect = 2.235e-6
Identity = 44/166 (26.51%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  644 IISSHRNR-LLIWQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ +++W+  R    + +P+ ++           IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++    GH+  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDE--GHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 4.695e-8
Identity = 48/166 (28.92%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  644 IISSHRNRLLI-WQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ LI W+  R    + IP+ S++          IS   QFA   S + T R              + +L+TG+ T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++    GHT  VSC+ F P  +   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKTLIMWKLTRDETNYGIPQRSLHGHGHFVSDVVISSDGQFALSGSWDGTLR--------------LWDLTTGTTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQED--GHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005742.1 (pep scaffold:Pmarinus_7.0:GL478452:1315:31647:1 gene:ENSPMAG00000005164.1 transcript:ENSPMAT00000005742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.841e-6
Identity = 34/114 (29.82%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  809 DTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPL--KLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYC 1144
            D  V +    +G + G + + HD ++   TF +     LL+T  +D SIK+W + +         +GH+  V C  F P   +  + SC  D TL+VWS++L  E   +D+  C
Sbjct:  184 DHTVKLWNAQSGRLLGPHRA-HDGEVQHCTFAHAFHKPLLATCSQDSSIKLWEWKEQGK--GSALLGHSGPVRCCCFSPDDQR--LVSCSVDCTLKVWSVKLRQEERSVDVREC 292          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Sea Lamprey
Match: wdr37 (WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-030131-8101])

HSP 1 Score: 50.447 bits (119), Expect = 3.094e-6
Identity = 25/81 (30.86%), Postives = 43/81 (53.09%), Query Frame = 2
Query:  863 MSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLE 1105
            ++ HD++++  +     +L+ T  RD + ++W F D  IH   VF GHT  V+   F    S   + S   D+T++VW L+
Sbjct:  327 LTGHDQELTHCSTHPAQRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVF---ASSENVVSGSDDRTVKVWDLK 404          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Sea Lamprey
Match: wdr37 (WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-030131-8101])

HSP 1 Score: 50.0618 bits (118), Expect = 3.355e-6
Identity = 25/81 (30.86%), Postives = 43/81 (53.09%), Query Frame = 2
Query:  863 MSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLE 1105
            ++ HD++++  +     +L+ T  RD + ++W F D  IH   VF GHT  V+   F    S   + S   D+T++VW L+
Sbjct:  330 LTGHDQELTHCSTHPAQRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVF---ASSENVVSGSDDRTVKVWDLK 407          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 49.6766 bits (117), Expect = 3.497e-6
Identity = 26/76 (34.21%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  875 DRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            D  I ++ F    K L+TG  D  I++W   + KI   M+  GH   +  L +FP G +  + S  GD+T+R+W L
Sbjct:  443 DLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKI--VMILQGHEQDIYSLDYFPSGDK--LVSGSGDRTVRIWDL 514          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Yeast
Match: COP1 (Alpha subunit of COPI vesicle coatomer complex; complex surrounds transport vesicles in the early secretory pathway [Source:SGD;Acc:S000002304])

HSP 1 Score: 48.9062 bits (115), Expect = 6.455e-6
Identity = 30/89 (33.71%), Postives = 43/89 (48.31%), Query Frame = 2
Query:  872 HDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLE 1138
            H R ++  +F   L L+ +G  D  +K+W  + +K        GHT+ V  + F P   Q  I S G DKTLRVW L+    V+    E
Sbjct:  208 HTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHP--HQNLIISVGEDKTLRVWDLDKRTPVKQFKRE 294          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Nematostella
Match: EDO49220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHF9])

HSP 1 Score: 230.72 bits (587), Expect = 3.083e-64
Identity = 185/690 (26.81%), Postives = 311/690 (45.07%), Query Frame = 2
Query:  170 LIEKQTENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKL---------SHGIEFVRRINHINPIEQAVFIPSIDSYLTL--DGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRLSINIS-HKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDDSLVLLTVYKPLS----ITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHS 2191
            +IE++T+    ++  K    W L+R       D ++K    D+K+          HG+  +R I     IE  V+     +Y+ +  +G  V L   +G  + F  Y   P+    + YA  + +++ W  DE  + +   +F ++ +         I   ++N+  NEII+     +  W FRY  K L+ R  I     K    +   +E T    QR F A D  +    L  G+    Y  LH R+I+A+ FFNPLK L T  RDGSIKVW   D   ++K++F+GH   V+ LA +P GS   I S   D T+RVWSL+++DEV  +                             H N  +  L+ L  P  +MV I        C +  +  +   S   +T  ++    +       +         +LL  L+ +  IL  +T +NP  ++  ++ E        +    L     +  DK  N      G  +  ++    +    +     AH E EVV M+++P   ++ ++GMDNSIK+W ++PFA E L+ +++F+C   P +L   ++ L    H+   A Y  VV+    + R+DH+  +DH + ++ +++C +M+LF SC  G +  ++IW   N LLR I ++       F S +GD+L GIG  +  I ++
Sbjct:    1 MIEEKTKPHYPESFGKVSSHWKLIR-------DSVKKGPAEDLKVVDKKQPRNVGHGVHPLRNIPSEEGIETVVYNSFNGNYVCISPEG-EVTLCLPSGYKEGFNKYLSQPIC--GVVYAAKTRQFVGWGKDE-NIKVFQQNFKVISVTSTV---SQIHCGIFNDSTNEIITGGTGNITCWSFRYGAKFLLQRKVITEQIPKSCIISHMCLEDTPSRTQRSFAAYDNNIIAHTLLDGTCVAHYKDLHSREITAVLFFNPLKYLITAARDGSIKVW---DDTGNVKIIFIGHLKAVNTLAIYPFGSY--IMSGSSDNTIRVWSLDMSDEVNRI-----------------------------HTNQPNSSLV-LQVP-GRMVCI--------CSDATVRLISPGSGACVTTLLVPGMQT-------IADVTCAAADNLLFALLVNGAILKASTLTNPCKIMEEWKKEDTGGEDFPSTCNCLCLYEYVVEDKLENDAW---GGLVSNLQSRQSSYDRTLLLGGCAHRE-EVVAMVANPTVDQVISAGMDNSIKVWRLFPFAEEALAPLMTFYCQETPRHLSVAHHRLCVALHEPATASYNIVVFKTTQKDRFDHNNDNDHTDEITGVASCPKMRLFASC--GLDGSLRIWDEANNLLRVITLNATPTSLSFCSQKGDLLVGIGNHLHKIEYA 619          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Nematostella
Match: EDO39199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS9])

HSP 1 Score: 62.7734 bits (151), Expect = 1.481e-9
Identity = 102/482 (21.16%), Postives = 187/482 (38.80%), Query Frame = 2
Query:  875 DRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITK------TVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDD----SLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMIS--------DPLNSR--LYTSGMDNSIKLWYVY-----PFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRD----RAHYPC-VVYNIESRARYD-HSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQI 2227
            D   +   F++P     TG ++G+I+ WS               TSL S    +P  +Q  +     D   + + L+  +++  + L          I+    F  S + + +W+ N        L++ + +   + +     +    ++        R+I+       T +    +LNT   +++   H   +  L +L+   E+L + + +NP      ++ E  D    S+ LL     L+   D      L+F+G   G I + D   F     E+ AH + +V+ + S        D + SR  L + G D  I++W V         + P S+I       LP  L    N L     D      R    C   Y  +    +  HS  + H   ++ IS+C  + LF + S      ++IW   N L+R++     +    F + +GD+L G    IS +  + YLP  ++ K +
Sbjct:  543 DFPFTTCVFYHPASYFITGDKNGTIRAWS---------------TSLDS----YPLVTQFLVRIWNFDTFTQTYRLQTGEDIVDMSL----------ISSDQLFYYSRHNLKVWNLNQFHSLFTMLSSRIKRCFRVTSPGYPAR----IVVEAVDEGIRLISPVHGYELTTMLPITTLNTT--EIVGFAHDRRKEKLYVLLSSREVLVFESDNNPCCAHQLWRAECPDEGVCSIALLNSEFALT-EEDLDLECGLLFAGHYNGQISLLD--GFGVSMKEVQAH-QGQVIFLGSSHGLSTSRDTIGSRDHLLSCGTDYVIRVWQVRHVNQRAIDIVPKSRIKLL---QLPRQLEMTGNTLCMAMEDHKVVMCRTDLDCGSAYGKKKNFEFMMHSKDEGHTAAINGISSCPLLGLFATSSEDMS--VRIWDMDNHLIRELNFDDTLCGVCFLNPRGDLLVGFQSHISLVTLTDYLPAPYLLKMM 980          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Nematostella
Match: EDO32893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS6])

HSP 1 Score: 53.1434 bits (126), Expect = 8.853e-7
Identity = 54/219 (24.66%), Postives = 97/219 (44.29%), Query Frame = 2
Query:  485 LQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELL---YNEDRNEIISSHRNRLL-IWQFRYANKHLIPR-LSINISHKEQFATIFSIERTQRENQRLFLA--NDTGVTVVELSTGSVTGSYM------SLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            + +A  ++ ++A   +  +L + N     +E +D  ++EG  K +L      D  +I++  ++  + +W     +    PR L++   H    + +       R +QR  ++   D  + V E +  +   S M        HD+ I+++      KL+ TG +D + KVW  AD    L  V  GH   V C  F P      IA+  GD T+++WSL
Sbjct:  369 MSFAGKTNDHLAVVTNSNQLRLYN-----LETLDCRMVEGHSKMILCLDVCADGTKIVTGSKDHTVRVWDVSDCSN---PRCLAVGNGHTHAVSGV----AWSRTSQRFVISCSQDLTIKVWEATKKAAEESSMFVKMTVKAHDKDINSVAVSPNDKLVVTGSQDKTAKVWRIADGI--LMGVARGHKRGVWCAQFSP--FDKCIATASGDSTIKIWSL 571          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Medaka
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:101162055])

HSP 1 Score: 52.7582 bits (125), Expect = 7.119e-7
Identity = 47/166 (28.31%), Postives = 80/166 (48.19%), Query Frame = 2
Query:  644 IISSHRNR-LLIWQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ +++W+  R    + IP+ S+           IS   QFA              L  A D  + + +L+TG  T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++    GHT  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVISSDGQFA--------------LSGAWDGTLRLWDLTTGLTTRQFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDE--GHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Medaka
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:101162055])

HSP 1 Score: 53.9138 bits (128), Expect = 7.253e-7
Identity = 47/166 (28.31%), Postives = 80/166 (48.19%), Query Frame = 2
Query:  644 IISSHRNR-LLIWQF-RYANKHLIPRLSIN----------ISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            I+S+ R++ +++W+  R    + IP+ S+           IS   QFA              L  A D  + + +L+TG  T  ++  H + + ++ F    + + +G RD +IK+W +    K  ++    GHT  VSC+ F P  S   I SCG DK ++VW+L
Sbjct:   31 ILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVISSDGQFA--------------LSGAWDGTLRLWDLTTGLTTRQFVG-HTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQ--DEGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNL 179          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 51.6026 bits (122), Expect = 6.803e-6
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  803 ANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFAD-SKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWS 1099
            ++D+ V V E++TG V  + +  H+  +  L F N   L+ T  +D SI VW  A  + I L+ V VGH + V+ + F        I S  GD+T++VWS
Sbjct:  282 SSDSTVRVWEVTTGEVLNTLIH-HNEAVLHLRFAN--GLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDF----DDKYIVSASGDRTIKVWS 374          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 50.8322 bits (120), Expect = 9.528e-6
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  803 ANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFAD-SKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWS 1099
            ++D+ V V E++TG V  + +  H+  +  L F N   L+ T  +D SI VW  A  + I L+ V VGH + V+ + F        I S  GD+T++VWS
Sbjct:  317 SSDSTVRVWEVTTGEVLNTLIH-HNEAVLHLRFAN--GLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDF----DDKYIVSASGDRTIKVWS 409          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Planmine SMEST
Match: SMESG000010382.1 (SMESG000010382.1)

HSP 1 Score: 2976.04 bits (7714), Expect = 0.000e+0
Identity = 1466/1482 (98.92%), Postives = 1476/1482 (99.60%), Query Frame = 2
Query:  131 MSEVLNFYLQKYGLIEKQTENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRLSINISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILHYTTKSNPMVLVTRFQYESDDSLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDIAALSNVTPLEVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDIXXXXXXXXXXXXXXXXXXXXDRLHILEDDIRKIQQGNHDKPKRKYEHFIEAPSKSDIFNHYFSQIVKYSKITLPGEVEDTKFKSNLQPLVPDKYKKSDKEGFFPSRETISKIMAPENLRKGGYIPNSAVLQSLWPPKVLSEKADIWRPTMLSDLDIKQLELLKTTVIENEEEETKYFDWDSDKDSERTVASPEQIEVLSEDLSEDLMSKYGSIFEEKQSIKEEINEEELDTKPVENESPIEIKKRPVTTKVSKESLKLPIIARKPATMPEIKRVRFISSADDIAEEVKSPKVSMEIPKDNSNESSFFMTQIPTESDKKSVLPRFISRFETDSWFNRICPPPHNDEKCLMSLPTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEINKAMEKAILELASLEKEAQLSLLKSCLHLMASLEGISDRSLVTICLSRFFDADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDLCKIVSDWLDKWFQSMTQFAAECREIIGKEIHLIGTRHGILSNSTVTCLESVKNVFHCHILSPADLVLLYPHEKNPKSILNYINCLNYFRFKKLLKEHSIISDRKTETEVGPKKTIVSLPKLNPEKQFLVRLGESHALGMEEKTKKDFLTLNTMSYRSNISDFTQHPSMQPFHHYQVALGGGFVPFMHLRLKPCLVNPFPRDEDFIEWEKANPKSLFGSYNKAFIPQFSLPPEPF 4576
            MSEVLNFYLQKYGLIEK+TENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFV+RINHINPIEQAVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRLSINISH+EQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSY+SLHDR ISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLL+LIQDNEILHYTTKSNPMVLVTRFQYESDDSLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHD+ADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDN+IKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFED+ AL NVTPLEVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDILTEKEELELNTTKKFKKNNLDRLH LEDDIRKIQQGNHDKPKRKYEHFIEAPSKSDIFNHYFSQIVKYSKITLPGEVEDTKFKSNLQPLVPDKYKKSDKEGFFPSRETISKIMAPENLRKGGYIPNSAVLQSLWPPKVLSEKADIWRPTMLSDLDIKQLELLKTTVIENEEEETKYFDWDSDKDSERTVASPEQIEVLSEDLSEDLMSKYGSIFEEKQSIKEEINEEELDTKPVENESPIEIKKRPVTTKVSKESLKLPIIARKPATMPEIKRVRFISSADDIAEEVKSPKVSMEIPKDNSNESSFFMTQIPTESDKKSVLPRFISRFETD+WFNRICPPPHNDEKCLMSLPTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEINKAMEKAILELASLEKEAQLSLLKSCLHLMASLEGISDRSLVTICLSRFFDADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDL KIVSDWLDKWFQSMTQFAAECREIIGKE+HLIGTRHGILSNSTVTCLESVKNVFHCHILSPADLVLLYPHEKNPKSILNYINCLNYFRFKKLLKEHSIISDRKTETEVGPKKTIVSLPKLNPEKQFLVR GESHALGMEEKTKKDFLTLNTMSYRSNISDFTQHPSMQPFHHYQVALGGGFVPFMHLRLKPCLVNPFPRDEDFIEWEKANPKSLFGSYNKAFIPQFSLPPEPF
Sbjct:    1 MSEVLNFYLQKYGLIEKETENIKIDANEKAKERWNLLRRSICSVSDIIEKQDLNDIKLSHGIEFVKRINHINPIEQAVFIPSIDSYLTLDGCAVRLFDSNGRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVELIDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRLSINISHEEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYLSLHDRPISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTSFFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFYLESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLVLIQDNEILHYTTKSNPMVLVTRFQYESDDSLVLLTVYKPLSITTDKSPNKNLIFSGSKLGWIRVHDLADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNTIKLWYVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYNIESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNVLLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQILMYFEDMEALPNVTPLEVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDILTEKEELELNTTKKFKKNNLDRLHRLEDDIRKIQQGNHDKPKRKYEHFIEAPSKSDIFNHYFSQIVKYSKITLPGEVEDTKFKSNLQPLVPDKYKKSDKEGFFPSRETISKIMAPENLRKGGYIPNSAVLQSLWPPKVLSEKADIWRPTMLSDLDIKQLELLKTTVIENEEEETKYFDWDSDKDSERTVASPEQIEVLSEDLSEDLMSKYGSIFEEKQSIKEEINEEELDTKPVENESPIEIKKRPVTTKVSKESLKLPIIARKPATMPEIKRVRFISSADDIAEEVKSPKVSMEIPKDNSNESSFFMTQIPTESDKKSVLPRFISRFETDAWFNRICPPPHNDEKCLMSLPTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEINKAMEKAILELASLEKEAQLSLLKSCLHLMASLEGISDRSLVTICLSRFFDADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDLYKIVSDWLDKWFQSMTQFAAECREIIGKEMHLIGTRHGILSNSTVTCLESVKNVFHCHILSPADLVLLYPHEKNPKSILNYINCLNYFRFKKLLKEHSIISDRKTETEVGPKKTIVSLPKLNPEKQFLVRFGESHALGMEEKTKKDFLTLNTMSYRSNISDFTQHPSMQPFHHYQVALGGGFVPFMHLRLKPCLVNPFPRDEDFIEWEKANPKSLFGSYNKAFIPQFSLPPEPF 1482          
BLAST of WD repeat-containing protein 97 isoform X2 vs. Planmine SMEST
Match: SMESG000076568.1 (SMESG000076568.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.030e-9
Identity = 52/182 (28.57%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  599 EGPIKELLYNE-DRNEIISSHRNR-LLIWQ-------FRYANKHLIPRLS----INISHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDRQISALTFFNPLKLLSTGCRDGSIKVW-SFADSKIHLKMVFVGHTSLVSCLAFFPGGSQATIASCGGDKTLRVWSL 1102
            +GPI ++  N    N +IS+ R++ L+IW+       F YA + L         + +S   QFA   S + T R              + +L++G  T  ++  H + + ++ F    + + +G RDG+IK+W +    K  ++    GHT  VSC+ F P     +I SCG DK ++VW+L
Sbjct:   15 DGPITQIATNPIYPNTLISASRDKSLIIWELNRDENSFGYAKRALKGHNGFVSDVVMSSDGQFALSGSWDGTLR--------------LWDLTSGQTTRRFVG-HTKDVLSVAFSADNRQIVSGSRDGTIKLWNTLGVCKYTIQED--GHTDWVSCVRFSPTSENPSIVSCGWDKVVKVWNL 179          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR971.286e-3922.16WD repeat domain 97 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR973.406e-3922.65WD repeat domain 97 [Source:HGNC Symbol;Acc:HGNC:2... [more]
COPA3.144e-631.43coatomer protein complex subunit alpha [Source:HGN... [more]
COPA4.578e-632.65coatomer protein complex subunit alpha [Source:HGN... [more]
COPA4.773e-631.43coatomer protein complex subunit alpha [Source:HGN... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rack14.662e-826.09gene:FBgn0020618 transcript:FBtr0079565[more]
Rack14.662e-826.09gene:FBgn0020618 transcript:FBtr0331238[more]
Rack14.662e-826.09gene:FBgn0020618 transcript:FBtr0345448[more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-174h16.54.749e-3125.00si:ch73-174h16.5 [Source:ZFIN;Acc:ZDB-GENE-160728-... [more]
ciao12.337e-629.55cytosolic iron-sulfur assembly component 1 [Source... [more]
rack14.333e-627.27receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000024226.14.537e-1122.16WD repeat-containing protein 97-like [Source:NCBI ... [more]
rack11.383e-627.71receptor for activated C kinase 1 [Source:NCBI gen... [more]
rack13.347e-627.71receptor for activated C kinase 1 [Source:NCBI gen... [more]
rack13.758e-627.71receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm353392.803e-3922.71predicted gene, 35339 [Source:MGI Symbol;Acc:MGI:5... [more]
Wdr372.193e-627.61WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:192... [more]
Copa3.235e-632.65coatomer protein complex subunit alpha [Source:MGI... [more]
Copa3.437e-632.65coatomer protein complex subunit alpha [Source:MGI... [more]
Rack19.838e-626.67receptor for activated C kinase 1 [Source:MGI Symb... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6NE52|WDR97_HUMAN1.636e-3822.65WD repeat-containing protein 97 OS=Homo sapiens OX... [more]
sp|O18640|GBLP_DROME4.673e-726.09Guanine nucleotide-binding protein subunit beta-li... [more]
sp|Q2UGU1|LIS1_ASPOR5.268e-641.33Nuclear distribution protein nudF OS=Aspergillus o... [more]
sp|B8N9H4|LIS1_ASPFN5.268e-641.33Nuclear distribution protein nudF OS=Aspergillus f... [more]
sp|C4R6H3|LIS1_KOMPG7.834e-633.87Nuclear distribution protein PAC1 OS=Komagataella ... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QRV32.822e-12827.17Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A2C9JIJ01.173e-11129.38WD_REPEATS_REGION domain-containing protein OS=Bio... [more]
A0A267EEE54.279e-10927.26Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DA281.317e-10827.14Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DQJ61.502e-10827.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000041113.17.004e-1927.75pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000040926.12.947e-1026.56pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032472.12.009e-626.51receptor of activated protein C kinase 1 [Source:N... [more]
ENSAMXT00000007662.22.166e-626.51receptor of activated protein C kinase 1 [Source:N... [more]
ENSAMXT00000047239.12.235e-626.51receptor of activated protein C kinase 1 [Source:N... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002506.14.695e-828.92pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
ENSPMAT00000005742.12.841e-629.82pep scaffold:Pmarinus_7.0:GL478452:1315:31647:1 ge... [more]
wdr373.094e-630.86WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
wdr373.355e-630.86WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TUP13.497e-634.21General repressor of transcription; forms complex ... [more]
COP16.455e-633.71Alpha subunit of COPI vesicle coatomer complex; co... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO492203.083e-6426.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391991.481e-921.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328938.853e-724.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rack17.119e-728.31receptor for activated C kinase 1 [Source:NCBI gen... [more]
rack17.253e-728.31receptor for activated C kinase 1 [Source:NCBI gen... [more]
fbxw11a6.803e-635.00F-box and WD repeat domain containing 11 [Source:N... [more]
fbxw11a9.528e-635.00F-box and WD repeat domain containing 11 [Source:N... [more]
back to top
BLAST of WD repeat-containing protein 97 isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000010382.10.000e+098.92SMESG000010382.1[more]
SMESG000076568.11.030e-928.57SMESG000076568.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033098 ID=SMED30033098|Name=WD repeat-containing protein 97 isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=4584bp
AAATGCATTTCTAAACTCTTTCAATTTGCTCTTTTTATGTTTTTAATTAA
CTTAATTTATAAAATATTTTACACTAAGGATATAAAATAAATACTTAAAC
TATATTAATTATTTAAAATATCAAATTAAAATGTCAGAAGTATTAAATTT
TTATTTACAAAAATATGGTTTAATTGAAAAGCAAACAGAAAACATAAAAA
TTGATGCAAATGAAAAAGCCAAAGAAAGATGGAATTTGTTGCGTAGAAGT
ATTTGTAGTGTTTCGGATATTATTGAAAAACAAGATTTAAATGATATAAA
ATTATCCCATGGAATTGAATTTGTGAGGAGAATAAATCACATAAATCCAA
TTGAACAAGCTGTGTTTATTCCTTCAATCGATTCCTATCTGACTCTTGAT
GGCTGTGCAGTTAGACTATTCGATTCAAATGGTCGCTGTAAAGATTTCAT
GGCATATGGAGGGATTCCAGTGAAATTCAGACGACTGCAATATGCAAATT
GTAGTGATAGATATATCGCTTGGACCCCAGATGAAACTGAATTGGCTATG
TTGAATTCATCATTTGATATAGTCGAACTCATTGACCAAGCACTTATTGA
GGGGCCCATCAAAGAACTGTTGTACAATGAAGACAGAAATGAAATAATAT
CCTCACATCGCAATCGGTTGCTAATCTGGCAATTTAGATACGCTAATAAA
CATCTTATTCCCCGGTTGTCTATAAATATAAGTCACAAGGAGCAATTTGC
AACGATATTTTCCATTGAAAGAACTCAACGGGAAAATCAGCGTCTATTTC
TAGCAAATGACACCGGTGTGACAGTTGTGGAGCTATCTACGGGTTCAGTC
ACGGGCAGTTACATGTCCCTTCATGACCGACAAATCAGTGCTTTGACATT
CTTCAATCCATTGAAACTCTTATCAACCGGATGTAGGGATGGCTCTATAA
AGGTTTGGTCTTTCGCCGACAGTAAAATCCATCTGAAAATGGTATTTGTT
GGCCACACGAGTTTGGTTAGTTGCTTAGCCTTCTTTCCTGGTGGTTCTCA
AGCGACTATTGCTTCTTGTGGCGGTGATAAAACCCTCAGAGTTTGGTCTT
TGGAATTGAATGACGAAGTCGAATGTTTGGATTTGGAATACTGCTCGCAA
TACATCGGATCAGACATTACGAGAACATCATTTTTTACTTTGAGCACAAA
CTTCATTGATATTTGGCATCAGAATCATTTATCTGATGATTTACTCAGCC
TTACTGCTCCGGTTTCGAAAATGGTGAATATTGATGCCAATAAATGTCTG
GTTCAATGTCGAAACAATCTTCTGTTTTATTTAGAATCTTCTAGTTCTCG
GATTATTACCAAAACGGTTATCACAAAGTTCGACAGCCTAAATACTCAAA
ATCCAAAAGTCCTTTCGACAATTCATTTGGAAAATCAAAGTCTTCTTTTA
ATATTAATACAAGATAACGAAATTCTTCATTATACCACAAAGAGTAATCC
TATGGTTCTTGTTACTCGCTTTCAGTATGAATCGGATGATTCTTTAGTAC
TCCTGACTGTCTATAAACCTTTATCTATTACCACTGATAAATCTCCAAAC
AAGAATCTTATTTTCTCCGGTTCAAAATTAGGTTGGATCAGGGTTCATGA
TATAGCTGACTTCAATAAAATTACTTTCGAAATCGATGCTCATACGGAAT
CTGAGGTTGTCTGTATGATTTCGGATCCCTTGAACAGTAGACTTTATACT
TCCGGAATGGATAATTCTATCAAGCTTTGGTATGTTTATCCTTTTGCAGT
GGAACCTTTATCTAAGATTTTATCGTTTTTCTGTGGACTTCTTCCGACGA
ACCTAATCAACATTAACAACTATTTATTTACGGTTTTCCATGACCGAGAT
CGAGCTCATTATCCCTGTGTTGTATACAACATTGAATCTCGTGCAAGATA
TGACCATTCACCGTCTGATGATCACATCGAACCGGTGAGTTCTATCAGTG
CATGTGAGCGAATGAAACTCTTCCTTTCGTGTTCAGCTGGAACGGAGAAT
TTGATAAAGATATGGACTCATAAAAATGTCCTTTTACGACAAATCGAAAT
GCATTTCCCCGTATATTATGCTATTTTCTCGTCACTTCAAGGTGACATCT
TGACAGGAATCGGTTACCAAATCTCTTACATAAACCACTCAAAATACCTT
CCAAAACTTTTTGTCAAGAAACAAATTTTGATGTATTTCGAAGATATAGC
GGCTCTATCGAATGTAACTCCATTGGAAGTTAACGAAGAAATCATCCAAT
CAAAATTCAGCTCTGAAGATCGCGATAAATTGAATGGGATTAAATCTGTG
TTTAAGTATGAAAGTTATGTTGACATACTAACTGAGAAAGAAGAACTGGA
ATTGAATACGACTAAGAAGTTCAAGAAGAATAATCTAGATAGGTTACATA
TATTGGAAGATGACATTAGAAAGATACAGCAAGGGAACCACGATAAACCG
AAAAGGAAATATGAACATTTTATAGAAGCTCCATCGAAATCGGATATTTT
CAATCATTACTTTTCTCAAATTGTTAAATATTCTAAGATTACTCTTCCTG
GAGAGGTAGAAGACACCAAATTCAAATCCAACTTGCAGCCATTAGTTCCG
GATAAATACAAAAAATCTGACAAAGAGGGATTTTTTCCTTCGAGAGAGAC
AATCAGTAAAATCATGGCACCGGAAAATCTTAGAAAAGGCGGCTATATTC
CAAACTCAGCGGTTTTGCAATCATTGTGGCCTCCAAAGGTTCTAAGCGAG
AAAGCGGATATTTGGAGGCCAACAATGTTGTCGGATCTCGACATCAAACA
ATTGGAGTTATTGAAGACAACGGTAATTGAAAACGAGGAAGAGGAAACGA
AATATTTCGATTGGGACTCAGATAAAGACTCGGAACGAACTGTCGCATCA
CCAGAGCAAATAGAAGTTTTGTCTGAAGATCTTTCCGAAGACCTTATGAG
TAAATATGGCTCGATATTCGAAGAAAAGCAATCTATTAAGGAGGAAATAA
ATGAAGAAGAACTCGACACTAAACCAGTAGAGAATGAATCACCAATAGAA
ATAAAGAAACGCCCAGTAACTACAAAGGTATCTAAGGAGAGTTTAAAATT
GCCAATAATTGCTAGAAAACCAGCAACAATGCCGGAAATAAAGCGGGTGA
GATTCATCTCATCAGCTGATGATATTGCTGAGGAGGTCAAATCTCCAAAG
GTTTCCATGGAAATCCCGAAAGATAATTCAAATGAGTCTTCATTTTTCAT
GACTCAAATCCCAACCGAATCGGACAAGAAATCCGTTCTTCCTAGGTTTA
TCTCTCGATTCGAAACGGACTCGTGGTTCAATAGAATTTGTCCGCCACCT
CACAATGACGAGAAGTGTTTAATGAGCTTACCAACTCCTTTAAATGCCAA
CAGTTTTACGATGCATTTGTTGCATTCGCTTAAAGACGTCAAAAATTCCG
AAGAACTGGTAGAACTTGTCAATGCAATCGGTTACCTTTATTCGAATGAA
ACTATTGAGAAGAGAAACATACCAGAGATCAATAAGGCAATGGAAAAGGC
AATTTTGGAACTGGCAAGTCTGGAAAAAGAAGCCCAATTGTCATTGTTGA
AATCGTGTTTGCACTTGATGGCTTCATTGGAGGGGATTTCTGACAGGTCT
TTGGTGACGATCTGTTTGAGTCGGTTTTTCGATGCAGATCCCGAACTGAA
AGGCTTCCTCAAATCAATCCTTTACCATTTGGGATTGGAAGACAATACCG
ACTCAGTGGAACGAGAATTAATGAATTTCAAACTGTTTTCCGTGAGACCT
GGACAGGAACGAATGGAAGATTTATGCAAAATCGTTTCCGATTGGTTAGA
TAAATGGTTTCAGTCCATGACTCAATTCGCAGCTGAGTGCCGAGAAATCA
TCGGCAAAGAAATCCACCTCATCGGAACTCGACATGGAATCCTCTCCAAC
TCGACTGTGACTTGCTTGGAGAGCGTTAAAAACGTTTTCCATTGCCACAT
TTTGTCGCCGGCAGATTTGGTGTTGCTTTATCCTCACGAAAAAAATCCCA
AATCGATTTTGAACTATATTAATTGTCTAAATTATTTCCGGTTCAAAAAA
TTGCTGAAAGAACATTCCATCATTTCCGACCGGAAGACCGAAACCGAAGT
AGGACCGAAGAAAACTATTGTGTCTCTACCGAAACTAAATCCAGAGAAAC
AATTTCTCGTAAGGCTCGGAGAGTCGCATGCTTTGGGAATGGAAGAAAAA
ACCAAAAAAGACTTTTTAACTTTGAATACAATGTCCTATAGGAGTAATAT
TTCAGATTTTACCCAACATCCCTCTATGCAACCATTCCATCATTACCAGG
TGGCTCTTGGAGGAGGTTTCGTTCCGTTTATGCATTTGCGTCTGAAACCT
TGCTTGGTAAATCCTTTTCCCAGAGATGAAGATTTCATAGAATGGGAAAA
GGCTAATCCAAAATCATTATTTGGAAGCTATAACAAAGCGTTTATTCCTC
AGTTTTCATTGCCTCCAGAACCATTTTGAATGAG
back to top

protein sequence of SMED30033098-orf-1

>SMED30033098-orf-1 ID=SMED30033098-orf-1|Name=SMED30033098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1483bp
MSEVLNFYLQKYGLIEKQTENIKIDANEKAKERWNLLRRSICSVSDIIEK
QDLNDIKLSHGIEFVRRINHINPIEQAVFIPSIDSYLTLDGCAVRLFDSN
GRCKDFMAYGGIPVKFRRLQYANCSDRYIAWTPDETELAMLNSSFDIVEL
IDQALIEGPIKELLYNEDRNEIISSHRNRLLIWQFRYANKHLIPRLSINI
SHKEQFATIFSIERTQRENQRLFLANDTGVTVVELSTGSVTGSYMSLHDR
QISALTFFNPLKLLSTGCRDGSIKVWSFADSKIHLKMVFVGHTSLVSCLA
FFPGGSQATIASCGGDKTLRVWSLELNDEVECLDLEYCSQYIGSDITRTS
FFTLSTNFIDIWHQNHLSDDLLSLTAPVSKMVNIDANKCLVQCRNNLLFY
LESSSSRIITKTVITKFDSLNTQNPKVLSTIHLENQSLLLILIQDNEILH
YTTKSNPMVLVTRFQYESDDSLVLLTVYKPLSITTDKSPNKNLIFSGSKL
GWIRVHDIADFNKITFEIDAHTESEVVCMISDPLNSRLYTSGMDNSIKLW
YVYPFAVEPLSKILSFFCGLLPTNLININNYLFTVFHDRDRAHYPCVVYN
IESRARYDHSPSDDHIEPVSSISACERMKLFLSCSAGTENLIKIWTHKNV
LLRQIEMHFPVYYAIFSSLQGDILTGIGYQISYINHSKYLPKLFVKKQIL
MYFEDIAALSNVTPLEVNEEIIQSKFSSEDRDKLNGIKSVFKYESYVDIL
TEKEELELNTTKKFKKNNLDRLHILEDDIRKIQQGNHDKPKRKYEHFIEA
PSKSDIFNHYFSQIVKYSKITLPGEVEDTKFKSNLQPLVPDKYKKSDKEG
FFPSRETISKIMAPENLRKGGYIPNSAVLQSLWPPKVLSEKADIWRPTML
SDLDIKQLELLKTTVIENEEEETKYFDWDSDKDSERTVASPEQIEVLSED
LSEDLMSKYGSIFEEKQSIKEEINEEELDTKPVENESPIEIKKRPVTTKV
SKESLKLPIIARKPATMPEIKRVRFISSADDIAEEVKSPKVSMEIPKDNS
NESSFFMTQIPTESDKKSVLPRFISRFETDSWFNRICPPPHNDEKCLMSL
PTPLNANSFTMHLLHSLKDVKNSEELVELVNAIGYLYSNETIEKRNIPEI
NKAMEKAILELASLEKEAQLSLLKSCLHLMASLEGISDRSLVTICLSRFF
DADPELKGFLKSILYHLGLEDNTDSVERELMNFKLFSVRPGQERMEDLCK
IVSDWLDKWFQSMTQFAAECREIIGKEIHLIGTRHGILSNSTVTCLESVK
NVFHCHILSPADLVLLYPHEKNPKSILNYINCLNYFRFKKLLKEHSIISD
RKTETEVGPKKTIVSLPKLNPEKQFLVRLGESHALGMEEKTKKDFLTLNT
MSYRSNISDFTQHPSMQPFHHYQVALGGGFVPFMHLRLKPCLVNPFPRDE
DFIEWEKANPKSLFGSYNKAFIPQFSLPPEPF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1147..1167
NoneNo IPR availablePANTHERPTHR45532FAMILY NOT NAMEDcoord: 27..1271
NoneNo IPR availablePANTHERPTHR45532:SF1WD REPEAT-CONTAINING PROTEIN 97coord: 27..1271
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 282..323
e-value: 1.8E-7
score: 40.8
coord: 511..551
e-value: 0.043
score: 22.9
coord: 237..277
e-value: 0.0032
score: 26.7
coord: 471..507
e-value: 280.0
score: 1.5
coord: 600..646
e-value: 76.0
score: 5.1
IPR001680WD40 repeatPFAMPF00400WD40coord: 248..277
e-value: 0.11
score: 13.4
coord: 517..550
e-value: 0.2
score: 12.6
coord: 287..323
e-value: 4.6E-5
score: 24.1
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 245..286
score: 10.909
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 289..332
score: 11.11
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 119..338
e-value: 1.0E-21
score: 79.5
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 245..332
score: 17.456
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 226..649