Endoglin antigen

Overview
NameEndoglin antigen
Smed IDSMED30033096
Length (bp)1774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endoglin antigen (SMED30033096) t-SNE clustered cells

Violin plots show distribution of expression levels for Endoglin antigen (SMED30033096) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endoglin antigen (SMED30033096) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endoglin antigen (SMED30033096) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033096

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033096SMESG000024633.1 SmedASXL_002680SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033096SMESG000024633.1 SmedASXL_003408SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033096SMESG000024633.1 SmedASXL_004565SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033096SMESG000024633.1 dd_Smed_v6_28574_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A4E0RJA6 (ZP domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_000016 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.492e-27
Identity = 56/172 (32.56%), Postives = 78/172 (45.35%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSIS---NADMMHMCSGFTADIREFCDEENYFCYSKKAIC-----SRENSFSLQN------------------------RFCMCNSNQISIYQNVLSYYECFDVI-KNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHG 417
            CF YES +   +    +   IGC CPDG+  +    +    ++CSG   D+   CD+++  C SK+AIC         SFS                           R C C +  +++YQ+ L Y ECF  +   +A C +C   GG CYD N DG+ DGC CP H S G
Sbjct:  151 CFLYESFELSDVEKRFNPSRIGCVCPDGKIPVGMQFDGWTKNICSGKLVDMGFECDQKHAVCRSKRAICDSVSTQTSRSFSPHKVPANFLWPNIVDYSSMANGEQGPKRICQCQNTMVAVYQSTLGYTECFPQLGPKAAQCHSCIASGGLCYDLNNDGVGDGCVCPPHKSLG 322          

HSP 2 Score: 68.1662 bits (165), Expect = 1.492e-27
Identity = 78/339 (23.01%), Postives = 136/339 (40.12%), Query Frame = 3
Query:  462 QARVDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSV---VGINIQQL---------------------SAELRNHCLL-KVERN------------------------QEFCI--QIFEPEQFSLCSIYQ-------SHLKNKKVIYVANLQVIFN-DQRSSNKDLQFPIKCITDDXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYA--RAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTN 1295
            Q  ++CS+  LSVCY PH   PYE+L     + ++V   V  N + +                     S + R+ C L K+E N                        ++ C+   +++ +Q     IY+       S+++N  V Y A L+++ N  +R+ NKD Q P+KCI+       +  +    +   S   + F  VN+    + +  +   I+L   ++ S   Y     E+C     S  + S  S + V  IYKGCP  +      F N     + V S  F AF +     +   C  ++C+    C       +S +A++  H+ +T+
Sbjct:  337 QVSLNCSDGHLSVCYRPHSAPPYEHLATDLTEGKAVAQLVPTNAENMAVFHEYMNEEKNATSSDTDARSLQFRDPCQLNKMESNLARLSNQMDGFTGPHSTGLDQSIQEQHCVHFDVWQMKQTCGVRIYRLNVSSFISYVENA-VQYEALLEIMVNRTRRTPNKDFQIPLKCISPPPKRMPTLDYHLRKTVKQS-ADLEFRVVNKENREIYATQIGTTIRLDALLLDSSGQYKVLTVEKCQYGNRSTSHTSDASHKMVPFIYKGCPLTNAKVQIPFTNGQYPSDHVQSAPFPAFREGTLFSLFFKCVFQLCVDPQQCFQASPSCDSGHAQDSDHVTATD 673          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A5K4F052 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.650e-25
Identity = 55/169 (32.54%), Postives = 77/169 (45.56%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNA---DMMHMCSGFTADIREFCDEENYFCYSKKAIC---------------SRENSFSLQN-------------RFCMCNSNQISIYQNVLSYYECFDVIKNSA-LCANCEKMGGKCYDENQDGIPDGCKCPDHLS 411
            CF YE  +++      + + +GC CPD + SIS      + +MC G   DI   CD+E+ FC S  ++C               S +++   +N             R C C    + +YQ  L Y ECF ++   A  C  C   GG+CYD N DGI DGC CP  LS
Sbjct:  147 CFKYELFERVITDQRVNPNGVGCVCPDHKVSISTRTSDPLKYMCDGNLVDIGSECDDESLFCRSINSVCKPLQEELLLSTNQLHSFKSNLWSENFPSGDHLRRSQIIRTCQCKPGYLPVYQINLKYNECFKILPMKAKYCQKCVDTGGQCYDLNDDGIGDGCDCPPSLS 315          

HSP 2 Score: 65.0846 bits (157), Expect = 1.650e-25
Identity = 69/315 (21.90%), Postives = 121/315 (38.41%), Query Frame = 3
Query:  471 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVV------------GINIQQLSAE---------LRNHCLLKVERN-------------------------QEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQ-RSSNKDLQFPIKCIT--------DDXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYAR--AEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVC 1244
            V+C+N +LSVCY PH + PY NL      ++SVV             + I  LS+E          +N C+LK E +                         + FC+ I    +  LC I    L +  V Y   L+V+ N   R+ ++D   P+KCI+        +    +     + + +   +  +I    +NEN + + S  +  R++L   + +    Y    AE C+ +  S  +    S     +I   C        A+F ++      + ++ F AF       +   C  ++C   +DC+   C
Sbjct:  335 VNCTNGYLSVCYYPHTYGPYSNLFDDLMNHRSVVRLASDNYLTDTLPLQISGLSSEANRTYHYSNFQNLCILKSENDTIDIGNTFVTESISHDNYHLHGAQTKRFCLNIDVWRKNGLCGIRLYKLSHDTVQYEGILEVLVNTSIRTPSRDKIIPLKCISRTPNRPMNEINDGNLQTIGTMNLANTPTHPQISLRILNENNKEIPSTFVGSRVRLDALLFNPSGSYKHIAAEYCYGNNRSLHSDYFSSDTSTLLIDHRCLHKKPLLTAKFSSIGLLNGHLQTEIFQAFRLGNMTLVFFTCVFRICQLSTDCEQTRC 649          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A5K4F1C8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.945e-25
Identity = 55/169 (32.54%), Postives = 77/169 (45.56%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNA---DMMHMCSGFTADIREFCDEENYFCYSKKAIC---------------SRENSFSLQN-------------RFCMCNSNQISIYQNVLSYYECFDVIKNSA-LCANCEKMGGKCYDENQDGIPDGCKCPDHLS 411
            CF YE  +++      + + +GC CPD + SIS      + +MC G   DI   CD+E+ FC S  ++C               S +++   +N             R C C    + +YQ  L Y ECF ++   A  C  C   GG+CYD N DGI DGC CP  LS
Sbjct:  159 CFKYELFERVITDQRVNPNGVGCVCPDHKVSISTRTSDPLKYMCDGNLVDIGSECDDESLFCRSINSVCKPLQEELLLSTNQLHSFKSNLWSENFPSGDHLRRSQIIRTCQCKPGYLPVYQINLKYNECFKILPMKAKYCQKCVDTGGQCYDLNDDGIGDGCDCPPSLS 327          

HSP 2 Score: 65.0846 bits (157), Expect = 1.945e-25
Identity = 69/315 (21.90%), Postives = 121/315 (38.41%), Query Frame = 3
Query:  471 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVV------------GINIQQLSAE---------LRNHCLLKVERN-------------------------QEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQ-RSSNKDLQFPIKCIT--------DDXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYAR--AEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVC 1244
            V+C+N +LSVCY PH + PY NL      ++SVV             + I  LS+E          +N C+LK E +                         + FC+ I    +  LC I    L +  V Y   L+V+ N   R+ ++D   P+KCI+        +    +     + + +   +  +I    +NEN + + S  +  R++L   + +    Y    AE C+ +  S  +    S     +I   C        A+F ++      + ++ F AF       +   C  ++C   +DC+   C
Sbjct:  347 VNCTNGYLSVCYYPHTYGPYSNLFDDLMNHRSVVRLASDNYLTDTLPLQISGLSSEANRTYHYSNFQNLCILKSENDTIDIGNTFVTESISHDNYHLHGAQTKRFCLNIDVWRKNGLCGIRLYKLSHDTVQYEGILEVLVNTSIRTPSRDKIIPLKCISRTPNRPMNEINDGNLQTIGTMNLANTPTHPQISLRILNENNKEIPSTFVGSRVRLDALLFNPSGSYKHIAAEYCYGNNRSLHSDYFSSDTSTLLIDHRCLHKKPLLTAKFSSIGLLNGHLQTEIFQAFRLGNMTLVFFTCVFRICQLSTDCEQTRC 661          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A183MJ20 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS16045 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.010e-24
Identity = 57/169 (33.73%), Postives = 75/169 (44.38%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNAD---MMHMCSGFTADIREFCDEENYFCYSKKAICSR-ENSFSLQN---------------------------RFCMCNSNQISIYQNVLSYYECFDVIKNSAL-CANCEKMGGKCYDENQDGIPDGCKCPDHLS 411
            CF YE  +++T     + + +GC CPD + SIS      + +MC G   DI   CD+E+ FC S  +IC   +    L N                           R C C    + +YQ  L Y ECF ++   A  C  C   GG+CYD N DGI DGC CP  LS
Sbjct:  142 CFKYELFERVTTEERVNPNGVGCVCPDHKVSISTRTSDPLKYMCDGNLVDIGSECDDESLFCRSINSICKPLQEELLLSNNQLHSIKSNLWSENFPSGDHLRRSQIIRTCQCKPGYLPVYQINLKYNECFKILPMKAKHCQKCVDTGGQCYDLNDDGIGDGCDCPPSLS 310          

HSP 2 Score: 59.6918 bits (143), Expect = 1.010e-24
Identity = 73/331 (22.05%), Postives = 129/331 (38.97%), Query Frame = 3
Query:  471 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSV------------VGINIQQLSAE---------LRNHCLLKVERN-------------------------QEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQ-RSSNKDLQFPIKCIT--------DDXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQ 1298
            V+C+N +LSVCY PH + PY +L       +SV            + + I  LS+E          +N C LK E +                         + FC+ +    +  LC I    L +  V Y   L+V+ N   R+ ++D   PIKCI+             +     + +     +  +I    +NE  + + SA +   I+L   ++ S+++ A AE C+ +  S  +    S     +I   C        A+F ++      + ++ F AF       +   C  ++C   +DC+   C   +N+  +K HL   N+
Sbjct:  343 VNCTNGYLSVCYYPHTYGPYSSLFDDLINYRSVARLASDNYMIDTLPLQISGLSSETNRTYHYSNFQNLCTLKSENDTTDTANTFVTESISHDNFHLHGSQTKRFCLNVDVWRKNGLCGIRLYKLSHDTVQYEGILEVLVNTSIRTPSRDKIIPIKCISRIPNRPMNKISVGNPQTFGTMNLVNTPAHPQISLRILNERNKEILSAFVGSHIRLD-ALLRSYKHIA-AEYCYGNNRSLHSDYFSSDIGTLLIDHRCLHKKPLLTAKFSSIGLLNGHLQTELFQAFRLGNMTLVFFTCVFRICQLPTDCEQTKC--KTNDGIQKIHLTEINE 669          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A094ZH37 (Uncharacterized protein OS=Schistosoma haematobium OX=6185 GN=MS3_01966 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.311e-23
Identity = 55/165 (33.33%), Postives = 76/165 (46.06%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNA---DMMHMCSGFTADIREFCDEENYFCYSKKAIC---------------SRENSFSLQN-------------RFCMCNSNQISIYQNVLSYYECFDVIKNSAL-CANCEKMGGKCYDENQDGIPDGCKCP 399
            CF YE  +++T     + + +GC CPD + SIS      + +MC G   DI   CD+E+ FC S  +IC               S +++   +N             R C C    + +YQ  L Y ECF ++   A  C  C   GG+CYD N DGI DGC CP
Sbjct:   86 CFKYELFERVTTEKRVNPNGVGCVCPDQKVSISTRTSDPLKYMCDGNLVDIGSECDDESLFCRSINSICKPLQEELLLSTNQLHSIKSNLWSENFPSGDHLRRSQIIRTCQCKPGYLPVYQINLKYNECFKILPMKAKHCQKCVDTGGQCYDLNDDGIGDGCDCP 250          

HSP 2 Score: 55.8398 bits (133), Expect = 5.311e-23
Identity = 70/331 (21.15%), Postives = 130/331 (39.27%), Query Frame = 3
Query:  471 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSV------------VGINIQQLSAE---------LRNHCLLKVERN-------------------------QEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQ-RSSNKDLQFPIKCIT--------DDXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQ 1298
            V+C+N +LSVCY PH + PY +L      ++SV            + + +  LS+E          +N C LK E +                         + FC+ +    +  LC I    L +  V Y   L+V+ N   R+ ++D   PIKCI+             +     + + +   +  +I    +NE  + + SA +   I+L   ++ S+++ A AE C+ +  S  +    S     +I   C        A+F ++      + ++ F AF       +   C  ++C   +DC+   C   +++  +K H    N+
Sbjct:  254 VNCTNGYLSVCYYPHTYGPYSSLFDDLINHRSVARLASDNYMIDTLPLQMSGLSSETNRTYHYSNFQNLCTLKSENDTTDTENTFVTESISHDNYHLHGAQTKRFCLNVDVWRKNGLCGIRLYKLSHDTVQYEGILEVLVNTSIRTPSRDKIIPIKCISRIPNRPMNKISDGNPQTFGTMNLANTPTHPQISLRILNERNKEILSAFVGSHIRLD-ALLRSYKHIA-AEYCYGNNRSLHSDYFSSDIGTLLIDHRCLHKKPLLTAKFSSIGLLNGHLQTELFQAFRLGNMTLVFFTCVFRICQLPTDCEQTKC--KTDDGVQKIHPTEINE 580          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000024633.1 (SMESG000024633.1)

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 432/433 (99.77%), Postives = 432/433 (99.77%), Query Frame = 3
Query:  471 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQRSSNKDLQFPIKCITDDXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQWRFVEXXXXXXXXXXXXXXXXXXIQLMTCNHLICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKANHIKFKSRDLVNTQKQXXXXXXXXXXXXXXXXXXHLKSFVSFKTIGTQNCVPIKCYPLVDFNCQNVHQHISLESQPMSSANIETFSEIYEC 1769
            VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQRSSNKDLQFPIKCITDDFSLSNSQR STSSSTLLSFVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQWRFVEKRTKLLLQRNNKNKNKNRIQLMTCNHLICLSLNQTLLLALLLGSLIIALISLLIIYASSKANHIKFKSRDLVNTQKQSLSFPSSPSGCASCSGSSHLKSFVSFKTIGTQNCVPIKCYPLVDFNCQNVHQHISLESQPMSSANIETFSEIYEC
Sbjct:  150 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQRSSNKDLQFPIKCITDDFSLSNSQRSSTSSSTLLSFVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQWRFVEKRTKLLLQRNNKNKNKNRIQLMTCNHLICLSLNQTLLLALLLGSLIIALISLLIIYASSKANHIKFKSRDLVNTQKQSLSFPSSPSGCASCSGSSHLKSFVSFKTIGTQNCVPIKCYPLVDFNCQNVHQHISLESQPMSSANIETFSEIYEC 582          

HSP 2 Score: 316.235 bits (809), Expect = 0.000e+0
Identity = 148/148 (100.00%), Postives = 148/148 (100.00%), Query Frame = 1
Query:   28 MTLFYNQSNDLIGCACPDGRKSISNADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVIKNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV 471
            MTLFYNQSNDLIGCACPDGRKSISNADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVIKNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV
Sbjct:    1 MTLFYNQSNDLIGCACPDGRKSISNADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVIKNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV 148          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000024633.1 (SMESG000024633.1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 432/433 (99.77%), Postives = 432/433 (99.77%), Query Frame = 3
Query:  471 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQRSSNKDLQFPIKCITDDXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQWRFVEXXXXXXXXXXXXXXXXXXIQLMTCNHLICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKANHIKFKSRDLVNTQKQXXXXXXXXXXXXXXXXXXHLKSFVSFKTIGTQNCVPIKCYPLVDFNCQNVHQHISLESQPMSSANIETFSEIYEC 1769
            VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQRSSNKDLQFPIKCITDDFSLSNSQR STSSSTLLSFVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQWRFVEKRTKLLLQRNNKNKNKNRIQLMTCNHLICLSLNQTLLLALLLGSLIIALISLLIIYASSKANHIKFKSRDLVNTQKQSLSFPSSPSGCASCSGSSHLKSFVSFKTIGTQNCVPIKCYPLVDFNCQNVHQHISLESQPMSSANIETFSEIYEC
Sbjct:  245 VDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQRSSNKDLQFPIKCITDDFSLSNSQRSSTSSSTLLSFVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCYGNSNNAREKSHLISTNQWRFVEKRTKLLLQRNNKNKNKNRIQLMTCNHLICLSLNQTLLLALLLGSLIIALISLLIIYASSKANHIKFKSRDLVNTQKQSLSFPSSPSGCASCSGSSHLKSFVSFKTIGTQNCVPIKCYPLVDFNCQNVHQHISLESQPMSSANIETFSEIYEC 677          

HSP 2 Score: 333.183 bits (853), Expect = 0.000e+0
Identity = 157/157 (100.00%), Postives = 157/157 (100.00%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVIKNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV 471
            CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVIKNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV
Sbjct:   87 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVIKNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV 243          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000039228.1 (SMESG000039228.1)

HSP 1 Score: 108.612 bits (270), Expect = 5.706e-46
Identity = 63/159 (39.62%), Postives = 87/159 (54.72%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNADMMH-MCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVI-KNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV 471
            CF Y+  DK T +    N  +GCACP  R  IS  D+ H +C+    DI ++CD+    C SKKAIC+ E S + Q + C+C    I +YQ+ L Y+ECF ++ +NS LC+ C    G CYD N D + DGC CP   S     I  ++    C I H+
Sbjct:  158 CFFYKDYDKKTAYIRADNSYVGCACPMKRFPIS--DIKHEICNNNLVDIGDYCDDNKDICRSKKAICA-EKSMNNQIKICVCPKGYIKLYQSNLHYHECFPILNENSPLCSLCAASKGTCYDINDDDVGDGCICPSMYSTAETQIEFKHQNQFCTISHL 313          

HSP 2 Score: 95.9005 bits (237), Expect = 5.706e-46
Identity = 78/272 (28.68%), Postives = 127/272 (46.69%), Query Frame = 3
Query:  474 DCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLK-VERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQ-RSSNKDLQFPIKCITDDXXXXXXXXXXXXXXXXXXXVKIF-----FNF----VNENGEIVQSATLNERIKLQLQIISSHQYYA--RAEEC-FMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFS-QVQPDFIEIHCTVKVCLKMSDCKSVVC 1244
            +C NN L VCY PH   PY+ L        +++ + I     +  + C L  VE   +FCI I   EQ   C I    + ++K+ Y   L+V+ N   ++ +KD+QFP+ CIT +   +     +++ S       I      FN     ++ N   ++S      IKL L +I +   Y     E+C F + S+     + S + V +I KGCP + +GF A F++ I     + SD F AF      + + I C +KVC+  ++C  + C
Sbjct:  316 NCKNNILKVCYKPHSQPPYDYLKDDLINKNAIIRL-IGGSDFKANSECFLNFVEDENQFCINIDLLEQIRECGIRSYKIAHRKLQYEFILEVLSNKSFKTPSKDMQFPLSCITKEPESAIKTYQTSTKSNQDIKNSIRKQKDKFNLGLQVLDNNNNEIESVEEGSIIKLDLSLIDTKGKYKAISVEQCYFSNYSTIDYADSLSDKSVLLIKKGCPNVREGFMANFRSRIMPGIHIQSDGFHAFKLTTDSNILFIDCFIKVCINEANCWQIDC 586          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000020512.1 (SMESG000020512.1)

HSP 1 Score: 104.375 bits (259), Expect = 3.188e-45
Identity = 58/160 (36.25%), Postives = 85/160 (53.12%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDG-RKSISN-ADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVI-KNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQIKHV 471
            CF Y++ D  ++ +    + IGCAC      SI+N      +C    +DI EFCD + YFC SK A C   N  +  +R C C S+++ +YQ+ L Y+ECF  + K    C +C  + G CYD N D I DGC CP  LS   +++  Q +  +C+   V
Sbjct:  136 CFKYDNGDNTSVSFKYKTEFIGCACSRNYATSITNYKKFSDLCRTTLSDIGEFCDNKQYFCQSKYAECRTINEENSSHRLCHCASDKVPVYQSHLHYFECFPKLSKTHPNCLSCHNLNGHCYDMNNDDIGDGCICPSRLSSETSNLDFQSNLQLCKTNTV 295          

HSP 2 Score: 97.4413 bits (241), Expect = 3.188e-45
Identity = 77/264 (29.17%), Postives = 121/264 (45.83%), Query Frame = 3
Query:  477 CSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQ-RSSNKDLQFPIKCITD----DXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYY--ARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCY 1247
            CSN +LS+CY PH   PYE+L+     N S V  N+   + +  N  L K+    ++CI+I   +    C +    LK  K++Y A L+V  +   +  +KDL  P+ CI+D    +    +    S       + + +    +++  + V S      IK  L ++ S   +   R EEC+    S      +S    KII KGCP  S GF+A F+  +     + SD F  F       I   C +KVC+ + DC++V CY
Sbjct:  299 CSNGYLSICYQPHTEPPYEHLSHDLESNISTV--NLVNRNDDKCN--LQKIASYNKYCIRIDLLDFSYNCGVQMHKLKFGKLLYQATLEVRLDRNIKQPSKDLVIPVSCISDHFQREIKNQSENLSSVIKIPEANILNLGLQVLDKFNKEVFSLVEGSEIKFDLSLVDSQGKFRGMRVEECYTSNHSTVIHEKKSNYGDKIISKGCPIFSNGFFAPFKTFVSPGIHLQSDLFQVFRHGNLHSIFYKCFIKVCVDVKDCENVKCY 558          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000020512.1 (SMESG000020512.1)

HSP 1 Score: 103.605 bits (257), Expect = 4.861e-45
Identity = 57/156 (36.54%), Postives = 84/156 (53.85%), Query Frame = 1
Query:    1 CFAYESQDKMTLFYNQSNDLIGCACPDG-RKSISN-ADMMHMCSGFTADIREFCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFDVI-KNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQAICQ 459
            CF Y++ D  ++ +    + IGCAC      SI+N      +C    +DI EFCD + YFC SK A C   N  +  +R C C S+++ +YQ+ L Y+ECF  + K    C +C  + G CYD N D I DGC CP  LS   +++  Q +  +C+
Sbjct:  136 CFKYDNGDNTSVSFKYKTEFIGCACSRNYATSITNYKKFSDLCRTTLSDIGEFCDNKQYFCQSKYAECRTINEENSSHRLCHCASDKVPVYQSHLHYFECFPKLSKTHPNCLSCHNLNGHCYDMNNDDIGDGCICPSRLSSETSNLDFQSNLQLCK 291          

HSP 2 Score: 97.8265 bits (242), Expect = 4.861e-45
Identity = 77/264 (29.17%), Postives = 121/264 (45.83%), Query Frame = 3
Query:  477 CSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAELRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIFNDQ-RSSNKDLQFPIKCITD----DXXXXXXXXXXXXXXXXXXXVKIFFNFVNENGEIVQSATLNERIKLQLQIISSHQYY--ARAEECFMDKSSEKNISTRSTEQVKIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTVKVCLKMSDCKSVVCY 1247
            CSN +LS+CY PH   PYE+L+     N S V  N+   + +  N  L K+    ++CI+I   +    C +    LK  K++Y A L+V  +   +  +KDL  P+ CI+D    +    +    S       + + +    +++  + V S      IK  L ++ S   +   R EEC+    S      +S    KII KGCP  S GF+A F+  +     + SD F  F       I   C +KVC+ + DC++V CY
Sbjct:  319 CSNGYLSICYQPHTEPPYEHLSHDLESNISTV--NLVNRNDDKCN--LQKIASYNKYCIRIDLLDFSYNCGVQMHKLKFGKLLYQATLEVRLDRNIKQPSKDLVIPVSCISDHFQREIKNQSENLSSVIKIPEANILNLGLQVLDKFNKEVFSLVEGSEIKFDLSLVDSQGKFRGMRVEECYTSNHSTVIHEKKSNYGDKIISKGCPIFSNGFFAPFKTFVSPGIHLQSDLFQVFRHGNLHSIFYKCFIKVCVDVKDCENVKCY 578          
The following BLAST results are available for this feature:
BLAST of Endoglin antigen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RJA61.492e-2732.56ZP domain-containing protein OS=Fasciola hepatica ... [more]
A0A5K4F0521.650e-2532.54Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F1C81.945e-2532.54Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183MJ201.010e-2433.73Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A094ZH375.311e-2333.33Uncharacterized protein OS=Schistosoma haematobium... [more]
back to top
BLAST of Endoglin antigen vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024633.10.000e+099.77SMESG000024633.1[more]
SMESG000024633.10.000e+099.77SMESG000024633.1[more]
SMESG000039228.15.706e-4639.62SMESG000039228.1[more]
SMESG000020512.13.188e-4536.25SMESG000020512.1[more]
SMESG000020512.14.861e-4536.54SMESG000020512.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033096 ID=SMED30033096|Name=Endoglin antigen|organism=Schmidtea mediterranea sexual|type=transcript|length=1774bp
TGTTTCGCATATGAATCTCAAGACAAAATGACATTATTTTACAATCAATC
AAACGATCTCATTGGCTGCGCATGTCCGGATGGCCGAAAATCGATATCCA
ATGCTGACATGATGCACATGTGCTCTGGTTTCACGGCCGACATCAGAGAA
TTTTGTGACGAAGAAAATTATTTTTGCTATTCAAAAAAGGCAATTTGTTC
GCGAGAAAATTCGTTTTCTCTCCAAAATCGATTTTGCATGTGCAATTCAA
ATCAAATATCGATTTATCAGAATGTGCTCAGCTACTATGAGTGCTTTGAT
GTGATCAAGAATTCTGCACTATGTGCAAACTGTGAGAAGATGGGAGGAAA
ATGCTACGATGAGAATCAAGACGGAATTCCTGATGGATGCAAATGCCCGG
ACCATTTATCTCACGGAGTTGCGGACATCATTCTCCAATATGACCAAGCT
ATATGCCAGATCAAGCACGTGTTGACTGCTCAAATAATTTCCTATCCGTG
TGTTACACTCCTCATTTCCATTCGCCGTACGAAAATCTCACGAAAAGGTT
CCATCAAAACCAATCTGTGGTAGGCATCAATATCCAGCAATTGTCAGCAG
AACTCCGTAACCATTGCCTACTGAAAGTTGAGCGAAACCAAGAATTTTGC
ATTCAAATTTTTGAGCCCGAACAATTTTCCCTTTGCTCAATTTACCAATC
ACATCTAAAAAACAAGAAAGTAATATACGTAGCAAATTTGCAAGTCATAT
TTAATGATCAAAGAAGCAGCAATAAAGACTTGCAGTTCCCTATCAAATGC
ATCACTGATGACTTTTCCCTTTCTAATTCTCAAAGATTTTCTACTTCTAG
CAGCACTCTCCTCTCATTTGTGAAAATATTTTTCAACTTTGTCAATGAAA
ACGGTGAAATAGTTCAATCAGCAACGTTAAATGAACGTATAAAGCTGCAG
TTACAAATAATATCAAGTCATCAGTATTACGCAAGGGCTGAAGAATGTTT
TATGGACAAAAGCTCTGAGAAGAACATCAGCACTCGGTCTACTGAGCAAG
TGAAAATTATTTATAAAGGGTGTCCAAAAATATCTCAAGGATTTTATGCA
AGATTTCAAAATGTGATTCCAACGAAAAATAAAGTTATCAGTGATGAGTT
TATAGCTTTCTCACAGGTCCAACCGGACTTTATCGAGATCCATTGCACTG
TCAAAGTTTGCCTCAAAATGTCTGATTGTAAATCTGTCGTTTGTTACGGA
AATTCAAACAACGCTCGAGAGAAATCGCATTTGATATCAACGAACCAGTG
GAGATTCGTTGAGAAGCGAACAAAATTGCTTCTACAAAGAAATAATAAAA
ATAAAAATAAGAATCGTATTCAATTGATGACATGCAATCACTTGATCTGC
CTTTCGTTGAATCAAACTCTTTTACTGGCTCTGTTATTAGGCAGTCTGAT
CATAGCCCTCATTTCTCTTCTTATCATTTACGCCAGTTCCAAGGCTAACC
ATATCAAATTTAAAAGTCGAGATTTGGTCAACACTCAAAAGCAATCGCTT
TCATTCCCATCCTCTCCGTCTGGTTGTGCCAGCTGTTCCGGGTCGTCTCA
CCTGAAATCATTTGTTTCATTCAAAACAATTGGCACGCAAAATTGTGTCC
CAATCAAATGTTACCCACTGGTTGATTTCAATTGTCAAAATGTCCACCAG
CACATTTCACTAGAATCTCAGCCAATGTCCAGTGCAAATATTGAAACTTT
CAGTGAAATCTATGAGTGTTGACG
back to top

protein sequence of SMED30033096-orf-1

>SMED30033096-orf-1 ID=SMED30033096-orf-1|Name=SMED30033096-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
CFAYESQDKMTLFYNQSNDLIGCACPDGRKSISNADMMHMCSGFTADIRE
FCDEENYFCYSKKAICSRENSFSLQNRFCMCNSNQISIYQNVLSYYECFD
VIKNSALCANCEKMGGKCYDENQDGIPDGCKCPDHLSHGVADIILQYDQA
ICQIKHVLTAQIISYPCVTLLISIRRTKISRKGSIKTNLW*
back to top

protein sequence of SMED30033096-orf-2

>SMED30033096-orf-2 ID=SMED30033096-orf-2|Name=SMED30033096-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=440bp
MPDQARVDCSNNFLSVCYTPHFHSPYENLTKRFHQNQSVVGINIQQLSAE
LRNHCLLKVERNQEFCIQIFEPEQFSLCSIYQSHLKNKKVIYVANLQVIF
NDQRSSNKDLQFPIKCITDDFSLSNSQRFSTSSSTLLSFVKIFFNFVNEN
GEIVQSATLNERIKLQLQIISSHQYYARAEECFMDKSSEKNISTRSTEQV
KIIYKGCPKISQGFYARFQNVIPTKNKVISDEFIAFSQVQPDFIEIHCTV
KVCLKMSDCKSVVCYGNSNNAREKSHLISTNQWRFVEKRTKLLLQRNNKN
KNKNRIQLMTCNHLICLSLNQTLLLALLLGSLIIALISLLIIYASSKANH
IKFKSRDLVNTQKQSLSFPSSPSGCASCSGSSHLKSFVSFKTIGTQNCVP
IKCYPLVDFNCQNVHQHISLESQPMSSANIETFSEIYEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001507ZP_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001507Zona pellucida domainPROSITEPS51034ZP_2coord: 8..271
score: 14.328
NoneNo IPR availableTMHMMTMhelixcoord: 322..344