Protocadherin 1

Overview
NameProtocadherin 1
Smed IDSMED30033095
Length (bp)3428
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin 1 (SMED30033095) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin 1 (SMED30033095) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin 1 (SMED30033095) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin 1 (SMED30033095) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033095

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30033095SMESG000042589.1 dd_Smed_v4_11633_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30033095SMESG000042589.1 SmedASXL_015952SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30033095SMESG000042589.1 dd_Smed_v4_11633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033095SMESG000042589.1 dd_Smed_v4_11633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30033095SMESG000042589.1 dd_Smed_v4_11633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30033095SMESG000042589.1 dd_Smed_v6_11633_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30033095SMESG000080290.1 SMESG000042589.1 OX_Smed_1.0.21991ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin 1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 322.398 bits (825), Expect = 1.274e-92
Identity = 240/808 (29.70%), Postives = 387/808 (47.90%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQI---LSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHG-KPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            + +K+ EE P N  IGS+              +   F  V    ++     ++ ++  TG I T    IDR+ + E     C        CI++ + ++  L+ N    L +      IE+ DIND++P F S  + + I E   I S  P+P+A D D+    +  Y      EA   F ++  +D   K  PQL V   LDRE    + LT+   D G PP+  S  + + +LD NDNAP  E+ S    + E++ + H +I+++A D D G N  I + F + P V   +   R+D+ +G+IT+   +D + + +L      +  +D G  PK  S+ A + + V D+ND  P I I  I L + Q     I E++     VA V V D D G N  V C + G +  F L          + +Y + T   LD EK   Y + I   DSG+P  ++   L V+V+DVNDN+P F +S  E+   EN  PG ++  I  +D D        +      + + LF + P       E+ ++++   TS DRE+  + E ++  +D           SL  ++TV+V++ D NDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++  + D    F +   TGT+ +    DRE+ S + F++KA D G P R +   V + V D NDN P    P+  +H +  + Q+     + +V A D+D     ++ YSI GG+PYGLFQI S+ G I+  K+ +      + L++KV+D   P R     +H+ V E+
Sbjct:   60 VVYKVPEEQPPNTLIGSL-------------AADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRE-----CQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQ----IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTL---RFSVLAKDRGTNPK--SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG-DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISP-------ETGEIQVK--TSLDREQRESYELKVVAADRGSP-------SLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 815          
BLAST of Protocadherin 1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 321.627 bits (823), Expect = 1.793e-91
Identity = 241/808 (29.83%), Postives = 383/808 (47.40%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQI---LSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHG-KPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            + +K+ EE P N  IGS+              +   F  V    ++     ++ ++  TG I T    IDR+ + E     C        CI++ + ++  L+ N    L +      IE+ DIND++P F S  + + I E   I S  P+P+A D D+    +  Y      EA   F ++  +D   K  PQL V   LDRE    + LT+   D G PP+  S  + + +LD NDNAP  E+ S    + E++ + H +I+++A D D G N  I + F + P V   +   R+D+ +G+IT+   +D + + +L      +  +D G  PK  S+ A + + V D+ND  P I I  I L + Q     I E++     VA V V D D G N  V C + G +  F L          + +Y + T   LD EK   Y + I   DSG+P  ++   L V+V+DVNDN+P F +S  E+   EN  PG ++  I  +D D        +      + + LF + P  G          I   TS DRE+  + E ++  +D           SL  ++TV+V++ D NDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++  + D    F +   TGT+ +    DRE+ S + F++KA D G P R +   V + V D NDN P    P+  +H +  + Q+     + +V A D+D     ++ YSI GG+PYGLFQI S+ G I+  K+ +      + L++KV+D   P R     +H+ V E+
Sbjct:   60 VVYKVPEEQPPNTLIGSL-------------AADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRE-----CQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQ----IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTL---RFSVLAKDRGTNPK--SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG-DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETG---------EIQVKTSLDREQRESYELKVVAADRGSP-------SLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 815          
BLAST of Protocadherin 1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 286.189 bits (731), Expect = 3.415e-80
Identity = 230/813 (28.29%), Postives = 372/813 (45.76%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVN--FHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII-EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            MD   ++    LL   +  +++     + L + I EE P N+ IG+I +      +    G++ +  +  VS+       + ++ STG I T    IDR+ +C           + +EC  +L+ V+   D  +         + I + D ND++P F S  + I+I E   I+S  P+P A DPD+    +  Y        F ++  +   G+  PQL V+  LDRE+   + + +   D G P K+ +  + + + D NDN P+  E    + I E+  V   +I++ A D D G N  I +             F ++  +G+IT+ R +D +       I  +  +   G      + AT+TI V DVND  P I +  + S       + E    N  +A + V D D  +NG+V C  I  E  F L+ + Y+N     +Y + T   LD E    +   I  SDSG P       + VK+ D NDN P F +  IEL +SEN   G  LTTI+ TD  E   +N    Y +  +    F L+     G L ++++       FDRE+     F +T  D     +            VIV + D NDN+P F+   ++F ++E  P+   VG++  TD D G+N  ++  I     +  ++F LD  +G + +    DRE+ S + F VKA D G P R S A V + V D+NDN P  I P          + +   +++ +V A+D D     ++ Y+I  G+  GLF+ID   G I+  +KP PTD   + L++ ++D  +P
Sbjct:    1 MDLRDFY----LLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD-APLVKVSSSTGEIFTTSNRIDREKLCAGASYA-----EENECFFELEVVILPNDFFRL------IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETA----IHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEREVPFHLKAV-YDN-----QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATD--EDSGKNADIVYQLGPNA-SFFDLD--RKTGVLTASRV-------FDREEQERFIFTVTARDNGTPPLQSQA-------AVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI----LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 286.574 bits (732), Expect = 1.584e-79
Identity = 230/813 (28.29%), Postives = 372/813 (45.76%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVN--FHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII-EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            MD   ++    LL   +  +++     + L + I EE P N+ IG+I +      +    G++ +  +  VS+       + ++ STG I T    IDR+ +C           + +EC  +L+ V+   D  +         + I + D ND++P F S  + I+I E   I+S  P+P A DPD+    +  Y        F ++  +   G+  PQL V+  LDRE+   + + +   D G P K+ +  + + + D NDN P+  E    + I E+  V   +I++ A D D G N  I +             F ++  +G+IT+ R +D +       I  +  +   G      + AT+TI V DVND  P I +  + S       + E    N  +A + V D D  +NG+V C  I  E  F L+ + Y+N     +Y + T   LD E    +   I  SDSG P       + VK+ D NDN P F +  IEL +SEN   G  LTTI+ TD  E   +N    Y +  +    F L+     G L ++++       FDRE+     F +T  D     +            VIV + D NDN+P F+   ++F ++E  P+   VG++  TD D G+N  ++  I     +  ++F LD  +G + +    DRE+ S + F VKA D G P R S A V + V D+NDN P  I P          + +   +++ +V A+D D     ++ Y+I  G+  GLF+ID   G I+  +KP PTD   + L++ ++D  +P
Sbjct:    1 MDLRDFY----LLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDA-PLVKVSSSTGEIFTTSNRIDREKLCAGASYA-----EENECFFELEVVILPNDFFRL------IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETA----IHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEREVPFHLKAV-YDN-----QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATD--EDSGKNADIVYQLGPNA-SFFDLD--RKTGVLTASRV-------FDREEQERFIFTVTARDNGTPPLQSQA-------AVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI----LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 286.189 bits (731), Expect = 2.003e-79
Identity = 230/813 (28.29%), Postives = 372/813 (45.76%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVN--FHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII-EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            MD   ++    LL   +  +++     + L + I EE P N+ IG+I +      +    G++ +  +  VS+       + ++ STG I T    IDR+ +C           + +EC  +L+ V+   D  +         + I + D ND++P F S  + I+I E   I+S  P+P A DPD+    +  Y        F ++  +   G+  PQL V+  LDRE+   + + +   D G P K+ +  + + + D NDN P+  E    + I E+  V   +I++ A D D G N  I +             F ++  +G+IT+ R +D +       I  +  +   G      + AT+TI V DVND  P I +  + S       + E    N  +A + V D D  +NG+V C  I  E  F L+ + Y+N     +Y + T   LD E    +   I  SDSG P       + VK+ D NDN P F +  IEL +SEN   G  LTTI+ TD  E   +N    Y +  +    F L+     G L ++++       FDRE+     F +T  D     +            VIV + D NDN+P F+   ++F ++E  P+   VG++  TD D G+N  ++  I     +  ++F LD  +G + +    DRE+ S + F VKA D G P R S A V + V D+NDN P  I P          + +   +++ +V A+D D     ++ Y+I  G+  GLF+ID   G I+  +KP PTD   + L++ ++D  +P
Sbjct:    1 MDLRDFY----LLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDA-PLVKVSSSTGEIFTTSNRIDREKLCAGASYA-----EENECFFELEVVILPNDFFRL------IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETA----IHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEREVPFHLKAV-YDN-----QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATD--EDSGKNADIVYQLGPNA-SFFDLD--RKTGVLTASRV-------FDREEQERFIFTVTARDNGTPPLQSQA-------AVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI----LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 186.808 bits (473), Expect = 1.882e-47
Identity = 173/611 (28.31%), Postives = 289/611 (47.30%), Query Frame = 2
Query:  656 QLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPIS-IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI--QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            ++R+   +DRE + +H L V A +   P  + S  V++ +LD  DN+PI E+ S    I+ED  +   ++ + A+D D+GEN  I + L E N +N +    I+  SGVI  A  +D    ++L  I L +   D G PK+  STA + I V+DVND  PV      F+       ILEN+    ++A V   D D G NG+V   +        L  I+Y+        ++  + ++D  K S    +IR  D   P  ++   L + VID+ND++PT   ++  + L EN   G  +    V  +DE    NG   Y++   G + F ++  E  G +++ KL        DRE  +    ++T  D           SL++S+T+ V +KD NDNAP F K +Y  TI+EE P+   +  L+A D D+  + KI+Y+I++   +V +   +      L+   ++ R+   +   ++ A DQG      + NV +   D+N        P   +H  S  I   S     ++ + A D+D     +I YSI   D    F+ID + G IS +      D  ++ +++  +D+  P  +    I V +++
Sbjct:  221 EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLL---AINAKSGVIQTAAPLDR---ETLSLIRLDVIASDKGTPKR-ESTAMVEITVVDVNDNAPV------FASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL-TIDYST------GEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVG--RVYAIDEDSGPNGIIKYSM--EGSEDFIID--EDSGLIKTTKL-------LDRETTARYSLKVTARDMG-------TPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNVFID--DVNSA------PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDD 776          

HSP 2 Score: 164.466 bits (415), Expect = 1.455e-40
Identity = 184/712 (25.84%), Postives = 329/712 (46.21%), Query Frame = 2
Query:  242 FIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSIN-RYYFHEASRFFRIECTQD-NTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENL-QSNQLVAYVNV-HDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVT-KVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKV-IDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQ-NSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSAS-IQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNV 2350
             + IN  +G I    P+DR+++                 +I+L  +     +  TP  +    V I + D+ND++P F SD   + I E  TI +      A D D   F  N + ++  AS       T D +TG++     ++ R+D +  S     + A D   P  + ++ + I ++D ND+AP +I     I+++E+  +   + R+ A D+D+G N +I + ++          F ID+ SG+I   + +D ++     +  L +T +D G P  L+++ T+ +++ D+ND  P       F ++     I E + + +Q++    V +D D  +  +++      E D  + +I   ++ DQ     V+ ++K    ++   R+ I  +D G      Q   +V V ID  +++P F      +++ E+ P G  + T+   D D  D  N R  Y+I  S  + FR++P  G   + S           DRE  +T    +T SD            L++S+ + V + D NDN+P F+ + Y  TI+E+ P       + A D D G NG + Y +++ SS      F LD  +GTL   SK+DRE+ ++    + ARD+G P   + + + + +SD+NDN P F   + + +    S + S+  T++    A D DE     I++ I GG    LF I+ + 
Sbjct:  317 LLAINAKSGVIQTAAPLDRETLS----------------LIRLDVIAS---DKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED---FGTNGKVHYSMASSSGIGGLTIDYSTGEVT----LRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME------GSEDFIIDEDSGLIKTTKLLDRETTA---RYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPT------FDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE------EADREVFSIL--DIGDQGAILSVSGELK---RQDHKVRVEISATDQG----GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD--NARIVYSIDSS--QFFRIDPSSGDISVSS---------DLDREDRATFSVIVTASD-------HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIV----ARDADEGDNADISFRIFGGADAKLFDIEEDA 946          

HSP 3 Score: 148.288 bits (373), Expect = 1.297e-35
Identity = 172/675 (25.48%), Postives = 290/675 (42.96%), Query Frame = 2
Query:  191 GSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGR----KLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGT-----LTTKSKIDRE-KISIFEFKVKARDQGHPGRY-SIANVVVKVSDINDNDPKF 2179
            G+    H+   ++  +  + I+ STG +TLR  ID               +     +I+ K   Q   +   PLT       I + DINDH+PT  + + +I + E   I        A D DS    I +Y   E S  F I+   +++G I    +    LDRE  + + L V A D G P    S  + + + D NDNAP  ++    ++I E+      II ++A D D  E++ I++ ++E + +   +   I     +++++ ++         ++ + I+  D G    L     + + + DVN           F+  P   +I E+      V  +   D D G N ++          +S+++ ++  + D     I     LD E  + + +I+  SD   P      ++ V + D+NDNSP F  S     +SE+ P GT  + + V+ +D     NG  DY ++ES      +LFRL+   G        LR+ S    DRE+ + I   +   D    S+S           + + + D NDNAP F +  Y+  I E  P    VG + A D D+GDN  IS++I  F       F ++ +        + T+++ D E K + F F+++A      G+  S   V + VSD+NDN P  
Sbjct:  405 GTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-------------NSPITAVIRAKDGAQPALSSTVPLT-------INVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM-EGSEDFIID---EDSGLI----KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEAD-REVFSILDIGDQGAILSVSGELKRQD----HKVRVEISATDQGG---LQGRCVVNVFIDDVNSA-------PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV---------YSIDSSQFFRI-DPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGT--SFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSG-------TLRVSS--KLDREQFAVIVLPIFARDRGTPSLSAASE-------ITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI--FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASS----GQLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 4 Score: 114.005 bits (284), Expect = 4.210e-25
Identity = 146/538 (27.14%), Postives = 240/538 (44.61%), Query Frame = 2
Query:  404 TPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR-FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIK--EDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVK----DQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDRE-KISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNL----FVGLLQATDEDQGDNGKISYKIDD 1981
            TP       + + + DIND++PTF  DK   N++ +E +     +      D+ +     Y   EA R  F I    D  G I   L V   L R++  + ++ + A+D G       +NV I   D+ ++AP      P S+K  E + + + +I ++A+D D G+N  I + +      +    FRID  SG I+++  +D +   +     +I+T  DH  P  L+++  + +I+ D+ND  P       F+       I E++        V+  DAD G NG V        D F  E+    +++    D+    +    KLD E+ ++  L I   D G P  +A  E+ + + DVNDN+PTF +   +L ++EN P G+ + TI   D DE D  +  F      +  KLF +E        ++  +RI +   FD E K +   FEL  S             LSS+  V +H+ D NDN P       +F I   +  N+     +G + A D DQ  N  + Y +++
Sbjct:  558 TPSLNTSTTIAVVLKDINDNAPTF--DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQ-GAI---LSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYFND-HPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI------DSSQFFRIDPSSGDISVSSDLDREDRATF---SVIVTASDHASPP-LNTSTQIEVILDDINDNSP------QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIV--------DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF-RIFGGADAKLFDIE----EDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ----------LSSTVPVRIHVSDVNDNKPALK----DFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEE 1039          
BLAST of Protocadherin 1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 164.466 bits (415), Expect = 1.739e-40
Identity = 195/763 (25.56%), Postives = 326/763 (42.73%), Query Frame = 2
Query:  254 NQSTGRITLRRPIDRDSMCEKMKL---CCVELHQSSECIIQLKAVVQLLD------NHKTPLTQKDCNVLIE------ITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVI--SIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKIST----IEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYF-LLIKVTDNDHPSRSAQITIHVKV 2473
            N + G I  R  I +     K++L     +   Q+ +  + L  +  +LD      +H   L +KD  ++IE      I DIND++P + S +  I+IS   T      L  A DPD  +    RY   +      +      TG+I     V + +D    SE +  V A D G P  +  + V+  +LD     P  E+ L  + I EDT +   ++++ A +   G ++ I + L     QN   H  +D MSG + + +  D++  +S  Q  +I T          +ST+ ++I + DVND  P+   +   L  R+  +PE        + +  V+  D D G  G+V   ++     FS+  +      + F  K + + +        + L++   D G         + + VID +  +P F RS+ E+  +E+  PG  + ++             +  Y+I  SG +       E  GK       IY     D +   T    I+  L   ++N+               V++ I+D NDN P FS +  E +I E+   +    ++QA+D+D+  NG++ Y I   SS   +S  +D  TG L+T S +D E    ++ +VKA D G P R S   + + V D+NDN P+F       +T+     S   T++ KV A D D     QI Y I  G  Y  F ID  +G + + K+    +  S+  + I   D   P RS+  +  + V
Sbjct:  353 NSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQ--IHISLNRTQGGSRTL-TAKDPDLGQNGWIRYSVLDT----ELVSIDKETGRIF----VPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL-----QNQDEHLTVDTMSGTVCIQKTFDFEKQKSY-QTTVIAT-----NANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPE--------EPLLVVSASDMDSGTFGEVSYHILSESSSFSINPV----TGEVFAQKPLARGR--------FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMS---------KVKYSIY-SGDQDHNFSIDEDTGK-------IYVTRYLDADVHDTVLLNIQATLPSGESNQTQ-------------VVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI--ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF---EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY--FGIDEKLGNV-YTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISV 1035          

HSP 2 Score: 160.614 bits (405), Expect = 2.634e-39
Identity = 199/799 (24.91%), Postives = 342/799 (42.80%), Query Frame = 2
Query:  104 FKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSG-----HPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYF-LLIKVTDNDHPSRSAQITIHVKV 2473
            F + E +     IG I      G  E  + +   +  V  + Q   F+ +++ +G I+    +D +    K  +  V++ +S E I                      ++L+E+ D ND++P+F    V + ISE   + +   LP   D D  KF ++R+   + +    F++   + N  ++   L V  +LDRE   +++L + A D G P K G +   I I+D NDNAP+  +     S+  +  +  H+I ++A D D GEN  IS+ +K+ +  ++ N F I Q SGVIT    +   S       ++I+   DHG P  LSS+A +TI VL      P + II L     A   ++EN     +VA V++           K  LIG       +  +  +V     Y ++    LD E  S + L       G     HP+       ++ + D+NDN+P +  S+I + L+  +  G+   T    DL     +NG   Y++ ++  +L  ++   G         RI+   + D    S I+F +   D    ++S   +       V+  + D     P F K  ++  I E+ P    +  + A +   G++ +I Y +     +     T+D  +GT+  +   D EK   ++  V A +       S+  + +++ D+NDN P F YP   + TV    +  E  L+  V+A D D     +++Y I        F I+   G + FA+KP    AR  F L++   D    S      IH+ V
Sbjct:   29 FTVPESAQIGTRIGWIS-----GKRE--ESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRS-KFDIVAVKVEESGETI----------------------DILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNE-QLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSN-FAISQ-SGVITTTASLLPASTH-----DVIVVASDHGSPS-LSSSAVVTITVLGSTLSSPPLDIIWLVESNSAH--LMENSTLGSIVARVSIAQQYR----DTKLRLIG-SSALCPQQTDQAHV-----YLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQ-------LLTIGDINDNAPQWHSSQIHISLNRTQ-GGSRTLTAKDPDLG----QNGWIRYSVLDT--ELVSIDKETG---------RIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQ-------VVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ----NQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSL--ISIRLKDVNDNWPIF-YPNEYHLTVREGPKPEEPLLV--VSASDMDSGTFGEVSYHILSES--SSFSINPVTGEV-FAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITV 731          

HSP 3 Score: 129.028 bits (323), Expect = 1.090e-29
Identity = 147/575 (25.57%), Postives = 245/575 (42.61%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH-FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAP-IFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVS 2152
            I + D+ND+ P F+ ++  + + E    + P  +  A D DS  F    Y+    S  F I      TG++  Q      L R       L V A D G      S N+ I ++D++   P   +    I   ED L    I  + A  K           +K      D +H F ID+ +G I + R +D D   ++     ++ +Q    P   S+   + I + D ND  P       FS       I E+L+ ++    V   D D   NG+V+  +I      S+E        DQF  ++ T   LD E    Y+L ++ +D G P +++   L + V+DVNDN+P F +S   +E+ EN PP T++  +   D D    ENG+  Y I+ +G + F ++   G          +Y+  S DRE IS ++  +   D             SS+++  + + D NDN P   S T     +    P +  +G + A D D+G NG + Y+     + +Q+S  +  + G +  + +++          V   DQG P +  + +V V++S
Sbjct:  629 IRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPV---TGEVFAQ----KPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK-----------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTV-----LLNIQ-ATLPSGESNQTQVVIFIEDHNDNPP------QFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIE-------IDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSL--ENGQIVYRIT-NGSEYFGIDEKLG---------NVYTKRSIDREVISHVDISIVAEDKG-------VPPRSSTASARISVLDVNDNPPSCLSIT--PIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYR-----AQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRIS 1137          

HSP 4 Score: 125.176 bits (313), Expect = 1.943e-28
Identity = 146/618 (23.62%), Postives = 260/618 (42.07%), Query Frame = 2
Query:  659 LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVIS-IIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVN-DNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISE-SGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSD---TNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTL----TTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVV--KVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVE 2476
            +R    LDRE +  + L VI + +G    T    V +R+ + NDN P      P  + E+  V  ++  + AKD D      + +FL   +      HF IDQ +G I L   +D+   + LP+  L I   D        +   LTI V D+ND  P  S  +   +  PA           Q  A +  HD D    G +          +SL     +  +   E   +    L    E  Y + +  +D+G P  +    + V + +    + P F ++    E+ EN   G  +  +       + +E+  F Y I +    K+F ++             R++     DRE+ +T EF++ + +   T++K                V + D NDN P+F+   Y  ++ +       +G + A+D+D G+NG++SY+I   S +  N  TL+ +TG++       +++D    + ++  V+ARD GHP R ++  V V  K+S  + + P F+ P  E H +     +S  T++ K+ A +      + + YS++  +  G   ID   G ++              + + V+D +   RSA + + + VE
Sbjct: 1882 IRTNLELDREILERYSLKVIGTGSGQQIGT---RVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDNLAP--LRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDF---EVLPEHTLTIKATD----GSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPA------TFSPGQPFAKIEAHDLD--ARGALT---------YSLGQGSSSIFRVAPESGALFMKVLPPAGER-YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNL-------SGEESREFHYRIQDPEASKIFSIDKFG----------RLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCH----------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRI--LSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLE---DTSVGTVLQKIRASNRLGMRNDGLLYSLK--EHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGN--GRSAVVPLKIVVE 2433          

HSP 5 Score: 109.383 bits (272), Expect = 1.178e-23
Identity = 125/447 (27.96%), Postives = 207/447 (46.31%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVP-VISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKV----IDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDL 1573
            I++ TG+I + R +D D            +H +   ++ ++A +   ++++T        V+I I D ND+ P F S  V I+I E   +  P  +  A D D  K    RY    +     IE  Q  TG    QL   S LD E    ++L V A+D G+PP++ ++ + I +LD NDNAP  E+    + + E++     + ++ A+DKD+ EN  I +      + N   +F ID+  G +   R ID + I     +++ I  +D G P + SSTA+  I VLDVND  P  +SI  +    PA   +      +  +  +   D D GLNG V   L   +   SL  ++ N         +  + +L+   E   RL +  SD G P+++    + V++     D+    P F +    +E+ ++ P G  LTT+N T +
Sbjct:  784 IDEDTGKIYVTRYLDAD------------VHDT--VLLNIQATLPSGESNQT-------QVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQ-FTG----QLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVY-----RITNGSEYFGIDEKLGNVYTKRSIDREVIS---HVDISIVAEDKGVPPR-SSTASARISVLDVNDNPPSCLSITPIVV--PAGSPL------STAIGTIVAMDPDKGLNGSV---LYRAQLQSSLFVVKSNG-------DVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEP-FQKY---IEIPKSCPTGCRLTTLNATGV 1173          

HSP 6 Score: 87.0409 bits (214), Expect = 7.653e-17
Identity = 152/698 (21.78%), Postives = 289/698 (41.40%), Query Frame = 2
Query:  125 PANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENT-QILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPM--AHDPDSSKFSINRYYFHEASRFFRIECTQDNT-GKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILD-ENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLP-QIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTA--QQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTL-TTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVS--DINDNDPKFI 2182
            P N+ +GS   T   G+ ++   + + +  VS+++ Q  +   I+Q TG I L  P+D + + E                + +KA     D           N+ I ++DIND++PTF        +S A T     P     AHD D+ + ++       +S  FR+         K++P    +          + +TV A+D GVP  + S+ V + I + E  + P  E+      + E++ +   I  +  +     E+    + +++P        F ID+  G + +A  ID +   +   Q+E+     D+             +IVLD ND +PV + +  +        + +++   Q +  +   D D G NG+V   ++   D   L  +  N      +       +LD    + +++++   D GHP + A  + ++ +K+   + ++P F     E+ + E+   GT+L  I  ++       N    Y++ E           +G+  ++     +   T  D E    I   L+VSD N +S             + + ++  ++ AP+F+K+ Y   I    P    VG +QA DED G +G + Y I    SD Q++  ++ +TG +   K  + R  ++I +  V A     P + S   V +++   D+  + PK +
Sbjct: 1936 PENLRVGSYVATV--GAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHT--------------LTIKATDGSFDTF--------TNLTIFVSDINDNAPTFSKPLYQTTVSPA-TFSPGQPFAKIEAHDLDA-RGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGER----------YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGE-----ESREFHYRIQDPEASK---IFSIDKF-GRLFVAGPIDREQRATHEFQVEI-----DNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYL------SLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGND---LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASN--RLGMRNDGLLYSLKEH----------QGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVV---------PLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI----SDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSS--PTKQSKTTVYLEIGPFDVQPSLPKLL 2547          

HSP 7 Score: 73.559 bits (179), Expect = 1.045e-12
Identity = 71/271 (26.20%), Postives = 117/271 (43.17%), Query Frame = 2
Query:  812 LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISES 1624
            L+  ++ E   +   I  I  K +++   +   +F+  P+ Q      ++D+ SG I+    +DY+       +   + V++ G+      T  + + V D ND  P       F+ Q  + EI E  Q     A   V D D G    V   +I   +  ++  +    V +Q +  +V   +LD E    Y L+I   D G P +  Q    +++ID NDN+P F RSR    +S N   G+ L T+  TD D    EN R  Y I ++
Sbjct:   26 LTKFTVPESAQIGTRIGWISGKREESAAPK---YFVVFPDEQTS-KFLKVDERSGEISTIAHLDYEKRSKFDIVA--VKVEESGE------TIDILVEVDDENDNAPS------FADQVVKLEISEFAQLGTSFALPTVTDGD-GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDAD--IGENSRISYDIKKT 275          

HSP 8 Score: 67.781 bits (164), Expect = 5.561e-11
Identity = 131/556 (23.56%), Postives = 221/556 (39.75%), Query Frame = 2
Query:  935 QNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKI--STIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQAT--DEDQGDNGKISY-KIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRY-SIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVL 2584
            Q +   F I+  +G I++   +D ++ Q   +  LII + D G     + + T+ + V D ND  P      L +  P+  EI E+ +   ++      D D G NG+           FS E +E ++       +    V         +++ +R  D G P    ++ L     ++++ +P           +E + P   L    ++ +DE     G+F          + +L+P          +  I S  S D E +  + +E +  + +     + GT       + V V + + NDN P F  ++         P+NL VG   AT   +D  +   + Y  + D S      F +D  TGT+   + +D E +      +KA D    G + +  N+ + VSDINDN P F  P  +     A+   S      K+ A D D  G   +TYS+  G    +F++    G + F K   P   R Y + +  TDN  PS S  + + V + E+      P  K G E  +       E   NSK+ L
Sbjct: 1667 QGNAPKFSINSTTGSISVL-PLDREASQ---EHLLIIILTDGGS---RNDSCTVRVTVADQNDNKP-----QLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGK-----------FSFELLEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNL-----EISNRNPQ----------TEAKAPLEFLKQTYLSTIDE-GLPRGQF----------IAKLQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSK-----PRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD----GSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATF--SPGQPFAKIEAHDLDARGA--LTYSLGQGSS-SIFRVAPESGAL-FMKVLPPAGER-YLVTVTATDNGVPSFSTSVPVSVIIGEAE-----PTDKPGFEKAEFR----FEVMENSKIGL 2148          

HSP 9 Score: 67.781 bits (164), Expect = 5.949e-11
Identity = 120/497 (24.14%), Postives = 208/497 (41.85%), Query Frame = 2
Query:  578 NRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP--ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQF--EYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGR--KLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEE--KPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTK 2044
            +R+ F   +  F I  T  +   ++P       LDRE   EH L +I +D G   +  S  V + + D+NDN P ++  +P  + I E + V   + R  A D D G+N   SF L    +++      +   +G + L R      + SL   ++ + V DHG P  L     L I   + N +    + ++ F +Q     I E L   Q +A             +++ +L G        +I   N+   F  + + V +  L+ ++E L R  ++   +G  +Q   + + V+V ++NDN P+F  S+    + EN   G+ + T+   D+D       R+      SG+    F ++   G          I+     D E +   E  LT+  T+         S  + + + + + D NDNAP FSK  Y+ T++     P   F   ++A D D    G ++Y +   SS +   F +   +G L  K
Sbjct: 1662 SRFRFQGNAPKFSINSTTGSI-SVLP-------LDREASQEHLLIIILTDGG--SRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFEL----LEDSSGSLDLVPETGDLVLRR------LSSLQSWKIKLRVVDHGVPG-LYVEKNLEI--SNRNPQTEAKAPLE-FLKQTYLSTIDEGLPRGQFIA-------------KLQPELAGLT-----YSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGTR-VDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPL--RYFLVSDSSGQTPTHFNIDQFTG---------TIHLTAPLDFEVLP--EHTLTIKATD--------GSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAK-IEAHDLDA--RGALTYSLGQGSSSI---FRVAPESGALFMK 2087          
BLAST of Protocadherin 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 157.532 bits (397), Expect = 1.689e-38
Identity = 173/649 (26.66%), Postives = 307/649 (47.30%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSIN-RYYFHEASRFFRIECTQD-NTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENL-QSNQLVAYVNV-HDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVT-KVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKV-IDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQ-NSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSAS-IQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNV 2350
            V I + D+ND++P F SD   + I E  TI +      A D D   F  N + ++  AS       T D +TG++     ++ R+D +  S     + A D   P  + ++ + I ++D ND+AP +I     I+++E+  +   + R+ A D+D+G N +I + ++          F ID+ SG+I   + +D ++     +  L +T +D G P  L+++ T+ +++ D+ND  P       F ++     I E + + +Q++    V +D D  +  +++      E D  + +I   ++ DQ     V+ ++K    ++   R+ I  +D G      Q   +V V ID  +++P F      +++ E+ P G  + T+   D D  D  N R  Y+I  S  + FR++P  G   + S           DRE  +T    +T SD            L++S+ + V + D NDN+P F+ + Y  TI+E+ P       + A D D G NG + Y +++ SS      F LD  +GTL   SK+DRE+ ++    + ARD+G P   + + + + +SD+NDN P F   + + +    S + S+  T++    A D DE     I++ I GG    LF I+ + 
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED---FGTNGKVHYSMASSSGIGGLTIDYSTGEVT----LRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME------GSEDFIIDEDSGLIKTTKLLDRETTA---RYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPT------FDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE------EADREVFSIL--DIGDQGAILSVSGELK---RQDHKVRVEISATDQG----GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD--NARIVYSIDSS--QFFRIDPSSGDISVSS---------DLDREDRATFSVIVTASD-------HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIV----ARDADEGDNADISFRIFGGADAKLFDIEEDA 587          

HSP 2 Score: 147.902 bits (372), Expect = 1.611e-35
Identity = 172/675 (25.48%), Postives = 290/675 (42.96%), Query Frame = 2
Query:  191 GSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGR----KLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGT-----LTTKSKIDRE-KISIFEFKVKARDQGHPGRY-SIANVVVKVSDINDNDPKF 2179
            G+    H+   ++  +  + I+ STG +TLR  ID               +     +I+ K   Q   +   PLT       I + DINDH+PT  + + +I + E   I        A D DS    I +Y   E S  F I+   +++G I    +    LDRE  + + L V A D G P    S  + + + D NDNAP  ++    ++I E+      II ++A D D  E++ I++ ++E + +   +   I     +++++ ++         ++ + I+  D G    L     + + + DVN           F+  P   +I E+      V  +   D D G N ++          +S+++ ++  + D     I     LD E  + + +I+  SD   P      ++ V + D+NDNSP F  S     +SE+ P GT  + + V+ +D     NG  DY ++ES      +LFRL+   G        LR+ S    DRE+ + I   +   D    S+S           + + + D NDNAP F +  Y+  I E  P    VG + A D D+GDN  IS++I  F       F ++ +        + T+++ D E K + F F+++A      G+  S   V + VSD+NDN P  
Sbjct:   46 GTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-------------NSPITAVIRAKDGAQPALSSTVPLT-------INVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM-EGSEDFIID---EDSGLI----KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEAD-REVFSILDIGDQGAILSVSGELKRQD----HKVRVEISATDQGG---LQGRCVVNVFIDDVNSA-------PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV---------YSIDSSQFFRI-DPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGT--SFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSG-------TLRVSS--KLDREQFAVIVLPIFARDRGTPSLSAASE-------ITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI--FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASS----GQLSSTVPVRIHVSDVNDNKPAL 641          

HSP 3 Score: 114.005 bits (284), Expect = 4.599e-25
Identity = 146/538 (27.14%), Postives = 240/538 (44.61%), Query Frame = 2
Query:  404 TPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR-FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIK--EDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVK----DQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDRE-KISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNL----FVGLLQATDEDQGDNGKISYKIDD 1981
            TP       + + + DIND++PTF  DK   N++ +E +     +      D+ +     Y   EA R  F I    D  G I   L V   L R++  + ++ + A+D G       +NV I   D+ ++AP      P S+K  E + + + +I ++A+D D G+N  I + +      +    FRID  SG I+++  +D +   +     +I+T  DH  P  L+++  + +I+ D+ND  P       F+       I E++        V+  DAD G NG V        D F  E+    +++    D+    +    KLD E+ ++  L I   D G P  +A  E+ + + DVNDN+PTF +   +L ++EN P G+ + TI   D DE D  +  F      +  KLF +E        ++  +RI +   FD E K +   FEL  S             LSS+  V +H+ D NDN P       +F I   +  N+     +G + A D DQ  N  + Y +++
Sbjct:  199 TPSLNTSTTIAVVLKDINDNAPTF--DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQ-GAI---LSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYFND-HPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI------DSSQFFRIDPSSGDISVSSDLDREDRATF---SVIVTASDHASPP-LNTSTQIEVILDDINDNSP------QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIV--------DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF-RIFGGADAKLFDIE----EDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ----------LSSTVPVRIHVSDVNDNKPALK----DFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEE 680          

HSP 4 Score: 90.5077 bits (223), Expect = 5.886e-18
Identity = 88/302 (29.14%), Postives = 138/302 (45.70%), Query Frame = 2
Query:  374 AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS-----RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRID---QMSGVI-TLAR-QIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVIS-IIDLFSRQPARPEILENLQSNQLVAYVNVHDADH 1243
            +V+    +H +P       + + + DIND+SP F S      ISE   + +      A D D     I  Y+ +E+S     + FR++ T          LRV S+LDRE+ +   L + A D G P  + +  + + + D NDNAP  EQLS  + I E++ V   +  I A+D D G+N  ISF +       D   F I+   + +GV+  L R + DY++  +    EL           QLSST  + I V DVND  P +   + L +R        +N+Q  + + ++   D D 
Sbjct:  392 SVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGT-------LRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG---GADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFEL------QASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNR-------FDNVQMARQIGFIPAFDPDQ 670          
BLAST of Protocadherin 1 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 150.214 bits (378), Expect = 3.977e-36
Identity = 206/760 (27.11%), Postives = 335/760 (44.08%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHE-ASRFFRIECTQDNTGKIIPQLRVKSRLDRE--EISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP-ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDN--SPTFGRSRIELELSENEPPGTLLTTINVTDL-DETDKENGRFDY-TISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGK---ISYKIDDFSSDVQNSFTLDFNTGTLTTKS--KIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQ 2491
            IN +TG ITL   + +        +  ++L      + ++ A+  +   + T +  K   ++I+ ++ N HSP F S   ++ ++E   I +      A+D D+      RY  H+ A     +    + +G+I     + S+L +E  E+ + QL V A DAG P K+    + +RI D N+++P  +++S  + I E+      I ++ A D D G N  I F L   N Q   +   ID  +G++ L + +D +  Q +    +I +  D G P ++S T  LTI V DVND  P   +      Q +R  I E+L     V+ +   D D G N ++K  L   +  F +++          EY       LD  K   + L I  +D G P  +    L V+++D+  N  +  F     E  + EN   GT +  I   +  DE   +    +Y  I   G   F    ++ +G + +  L        DRE  S   + +TV   + K+             V + I DRND+ P+  K  Y  ++ E  P N+ +  ++ATD D  DN     + +KI+    D Q+ F +D  +G +TT    ++DREK S  E  V   D G P   S   V+V V D NDN P F    I +++V +         + ++ A+D DE    ++TY+I  GD    F ID+N  G   A +    D  SY L ++ TD+  P +    T  V    S  Q
Sbjct:  539 INANTGEITLVE-VPKKGNSWPATVWAIDLGLP---LSRMSALNLMFYKNGTKIPAKPKPIIIQESE-NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDL-SKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLG--NNQEKSSVISIDAKTGIVKLLKSLDRED-QDVHTFAIIAS--DEGFPMRVSVT-NLTISVEDVNDNPPKCVV------QHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYP------LDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFS---IDQKGTVRTTHL-------LDRETKSA--YWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIE--RGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQ-AIHHYSVRSKFAGK----LCRIFAVDADEGENARLTYNITEGD--ARFSIDNN--GNIIASEAIHGD-ESYALTVQATDHGTPGQQFAATRVVLTANSAGQ 1250          

HSP 2 Score: 136.346 bits (342), Expect = 6.559e-32
Identity = 193/786 (24.55%), Postives = 323/786 (41.09%), Query Frame = 2
Query:  245 IVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSS-----KFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQ---IDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVK-DQFEY-------KIVTKVKLDCEKESLYRLIIRCSDSG-----HPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG--RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQ---ATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDP---KFIYPTIENHTVSASIQ-SSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDY 2509
            + +++ +G IT+   + +  M EK+++  V+L        ++ A+     +  TP+      + + I D+N+HSP F      + ISE E          A+D D       KFS+      E S    I+     TG +    ++   LDRE+   H   +IASD G P +    N+ I + D NDN P  + Q S   I ED      +  + A D+D G+N  + F L    V      FRID  SG I +      +DY      P   L I V DHG P  LS++  L + ++D+      I   D+         + EN +    V  +   +              G E     EN+EY  +  D + +        + T   LD E +S Y + +   DS       P++     + ++++D ND+ P   +      ++EN P   ++  +  TD D+ D +         E G  +  FR++       L S  +    +   DREK S  E  +++ D     +            VIV++ D NDN+P F++  + +++     ++ F G L    A D D+G+N +++Y I +  +     F++D N G +     I  ++   +   V+A D G PG+   A  VV  ++     P   K   P I        I  S  + + + V  L+  +A  +++ +SI  GDP  +F +  + G +  AKK +        L I VTD      S  I     ++ SRQ    P +
Sbjct:  658 LTVDEQSGEITVASDLSK-LMKEKLEVLDVQL--------KVSAI-----DAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNN--QEKSSVISIDA---KTGIV----KLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVP-----FRIDHHSGCIFIHAPEYPLDY---HKTPFFNLSIEVADHGDPI-LSTSCHLHVELVDIAHNHLAIEFDDV----AKEASVYENSEIGTEVIMIEAKET-------------GDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRID-------LTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNV-------IVIVNVLDENDNSPTFTQAIHHYSV-----RSKFAGKLCRIFAVDADEGENARLTYNITEGDA----RFSID-NNGNIIASEAIHGDES--YALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWDHSTVI-----IQVSRQISQRPKF 1363          

HSP 3 Score: 114.39 bits (285), Expect = 3.545e-25
Identity = 151/592 (25.51%), Postives = 256/592 (43.24%), Query Frame = 2
Query:  659 LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE----QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPV----ISIID-------LFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKC---DLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRK--LFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKS---KIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLI-MKVNALDYDEAGKNQ------ITYSIEGGDPYGLFQID 2341
            LRV ++++R E   +   VIAS  G+  K    +V I ILD ND+AP+      + +PI I +   V   +++++A D+D GEN  I + F  E  ++ + N       +G ITL       +  S P     I   D G P  LS  + L ++      ++P     I I +       +FS  P   E+ E+     +VA +  +D D G NG ++    D+ G   +    + +   +    +   + K KL+       +L +   D+G P +++ + + +++ DVN++SP F      L +SENE PG  +  +   D D  +  NG+  +++  +  K  +  ++   G  KL         L S DRE      F +  SD         +    S + + + ++D NDN P          I E+ P   FV  + A DED G N K+ + ++  S  V   F +D ++G +   +    +D  K   F   ++  D G P   +  ++ V++ DI  N     +  IE   V+      EN+ I  +V  ++  E G  Q      + Y I GGD +  F ID
Sbjct:  445 LRVSAKINRSE-RVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDV---LVKVDATDQDEGENGKIVYKFTSELPLEINAN-------TGEITLVEVPKKGN--SWPATVWAI---DLGLP--LSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLD---VQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGN--NGKIKFSLGNNQEKSSVISIDAKTGIVKL---------LKSLDREDQDVHTFAIIASDEG-------FPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLN--SEKV--PFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHN-----HLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSID 988          

HSP 4 Score: 108.227 bits (269), Expect = 2.616e-23
Identity = 142/538 (26.39%), Postives = 240/538 (44.61%), Query Frame = 2
Query:  677 LDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYED---DFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFR----LEPVEGRGKLESAKLRIYSLTSFDRE-KISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEF-TITEEKPQNLFVGLLQATDEDQGD-NGKISYKIDDFS-----SDVQNS-----FTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQS 2227
            LD E +    LTV+ASD     K     +++ ++D+NDNAP  E+ +  + + E   + + +    A   D  +NE I ++LK  +V + +N   ++  +G++TLA+ +D++++ +L   +L +  +D G P  L + A + I V+D ND  P       F ++    ++ EN +S + V  V   D D    G V  +L    +   D  +     N+  D     ++    +D EK   Y L +   D G P   ++  L + V D ND++PTF    +   + E E  G  L   +V+DLD   K    F   I   G K F+    LE +  + KLE  K   Y LT   ++ K  T +  LT+                        I+  + +AP     + +  T+  E P+ + +G L+A+DED+ D NG + + + + S     + VQ S     F +D NTG + +   I +    +  F V   D       +++ V V V+ I DND       + +H VS  I+S
Sbjct: 3074 LDSEILGFFNLTVVASDGEFEDKA---TILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVN---LNAQTGILTLAKPLDFETLSAL---KLTVVAKDSGVPP-LETEAQVEISVMDENDNAP------KFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGD-----VLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLD-GPKNGAPFTVEIQGDGAKSFKVNEKLELLTAK-KLEYRKKDKYLLTVIAKDVKGKTTDCPLTI-----------------------FIRQTSRHAPTMKPMKIQINTLQNELPEGI-IGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWSDHSITQ---GLHTFNVTVTDSKF---NTVSYVEVHVTSI-DND-------VIDHAVSIRIRS 3548          

HSP 5 Score: 107.071 bits (266), Expect = 6.626e-23
Identity = 200/835 (23.95%), Postives = 337/835 (40.36%), Query Frame = 2
Query:   65 AIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFI--VINQSTGRITLRRPIDRDSMCE-KMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHH------IIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQV---KCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVK----LDCEKES---LYRLIIRCSDSGHPKQTAQQELIVKVID-VNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGR----GKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIE------GGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            +++V    N    F + E++     IG +QQ      ME  +   + F  V  + +  SF+   + +STG+I ++  +DR+   + KM +        ++    + A+                 V ++I D+ND++P F  D     ISE   + +   +  A D D S     R+   E + +F +    +N+G     L V S+LDRE+I  ++L   A+D G       +   I + D ND+ P  E       KE+  +D H      I+    KD D   N +  FF+ +    N+   F ID  + ++    +I    +++  Q +L +T  D      +  T+T   I L  + +  +        R P         ++N+ V       A++   G V   +  L+G    F L + + N     F   IV KVK    +D EK      +RL I+            +ELI  VI+ +NDN P      +++ + EN P         +T +   D +     + + +    LF+++ + G       L+S  L  ++LT       S  EFE                     +T++V + D+NDNAP F K+ Y   + E +     +   +A+  DQ  N  I Y +    SDV +   L+  TG LT    +D E +S  +  V A+D G P   + A V + V D NDN PKF     E +       S     ++ V ALD D      ++Y +E         P   F I+SN G +  ++       + Y L +   D   P   ++  + + VE+
Sbjct: 2602 SVKVPRFSNSHYLFSVMEDADVGNVIGRVQQ------ME-TEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTI-------RADAAGGVHAIT---------------TVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDL---NENSG----WLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQFE-------KEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPK---GNEEGVFWIDSNNDLLLKRPEI----VENKMQYQLKVTAFD-----GVFETSTKVKINLKSSKDSDI--------RCP---------EANKTVIL-----AENSKKGTVVLGESSLLGPNVTFKLSDNDGNVFVVNFRNGIV-KVKESDQIDYEKNQQLEFHRLTIQ------DNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQY-ITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVV----ASDGEFE-------------------DKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLK--PSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF---EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSN-GDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVED 3318          

HSP 6 Score: 93.2041 bits (230), Expect = 1.056e-18
Identity = 118/464 (25.43%), Postives = 203/464 (43.75%), Query Frame = 2
Query:  959 IDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLI-GYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSN 2347
            ID+ +G I ++R ++Y   +   QI L+  V+D    +  S   TLT+ V+D+ND+ P   ++  +S       I E+ +    V  V+  D D   N  ++  L+ G E  F   +             I    KL+ +      L I+ +DS +P   A   + V +   +   P F  S     + E+   G ++  +      ET+ +  RF  TI     +     P      +E +  +I   +S DRE+ +  ++++T+        +     + + +TV V I D NDNAP F      FTI+E+      V +  A D D   +G+I + +     +    F L+ N+G LT  S++DREKI  ++   +A D+G  G  +     + VSD+ND+ P+F     E    +  +     + I+  +  D D +  N   + I  G+  G+F IDSN
Sbjct: 2452 IDRKTGRIHVSRVLNYHRDKRY-QIPLV--VEDATGRRAFS---TLTLSVIDINDKPPFF-VLPFYSTS-----ISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQFFSVHPRQGT--------ITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQM---ETEIDEIRF--TIVPGSEESDSFLPF----SVERSTGKIIVKSSLDRERKN--QWKMTI-------RADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL----VEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQF-----EKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSN 2864          

HSP 7 Score: 92.8189 bits (229), Expect = 1.271e-18
Identity = 191/790 (24.18%), Postives = 327/790 (41.39%), Query Frame = 2
Query:  200 VNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLD----NHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAH----DPDSSKFSINRYYFHEASR--FFRIECTQDNTGKIIPQLRVKSRLDREEISE----HQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDT---GENELISFFLKEPNV-----QNDMNHFRIDQMSGVITL--ARQIDYDSIQSLPQIELIITVQDHGK-PKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFS-LENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDF---NTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE--NTLIMKVNALDYDEAGKNQITYSIE-GGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVK 2470
            + F  V EN     +  +N+++G +T+   +DR                  E I   K + +  D    N   P T       I ++D+ND  P F  ++  I++        P   P+ H    D D S  ++++++  + +    F I+   D              L R EI E    +QL V A D GV   +  + + ++   ++D          I   E    +  +I  E   K T   GE+ L+      PNV      ND N F ++  +G++ +  + QIDY+  Q L    L  T+QD+ +  K+L     +T+++ ++ND  P   II+   +      +  +  + Q +  +   DAD     ++K  ++   DDF  L  I+  N        +VT VK LD E    + L +  SD     +     ++V VID NDN+PTF +S   +++ E+E  G  L     +  D+    N   +Y +  S    F +      G L  AK         D E +S ++  +   D+           L + + V + + D NDNAP F K +Y   + E       V  ++A D D    G +SY+++  S    ++  L F   + G +     ID EKI  +  KV A+D G P   S A + + V D ND+ P F     ++  ++A +Q  E     ++K +  D D   KN   +++E  GD    F+++  +  ++ AKK +      Y L +   D    +    +TI ++
Sbjct: 2747 IRFSLVEEN----PYFDLNENSGWLTVASQLDR------------------EKIDHYKLIARATDEGGFNTDLPFT-------IVVSDVNDSPPQFEKEEFNIDLH------LPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLL------------LKRPEIVENKMQYQLKVTAFD-GVFETSTKVKINLKSSKDSD----------IRCPE---ANKTVILAENSKKGTVVLGESSLLG-----PNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRL--TIQDNSEVCKEL-----ITVVIENLNDNRP--KIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFD---EIKFRMV---DDFGGLFQIDDIN-------GVVTVVKPLDSEILGFFNLTVVASDGEFEDKAT---ILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ----NETIEYYLKPSDVTSF-VNLNAQTGILTLAK-------PLDFETLSALKLTVVAKDSG-------VPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF-----DDCNMTALVQEGEAIGHRLLKFSVSDLD-GPKNGAPFTVEIQGDGAKSFKVNEKLELLT-AKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIR 3419          

HSP 8 Score: 92.0485 bits (227), Expect = 2.200e-18
Identity = 150/589 (25.47%), Postives = 246/589 (41.77%), Query Frame = 2
Query:  392 DNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSK------------FSINRYYFHEASRFFRIECTQDNTGKIIPQ-LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYV-NVHDADH-GLN-GQVKC-DLIGYEDDFSLENIEYNNVKD--QFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL------FRLEPV-----EGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIF-SKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDRE 2062
            D +K P  +   +V I I D NDH P       + +++E    +SP  + +     +              F I R    +   FFRI+ T   +G I    +R   RLDRE+ SEH+L V   D G P    ++ VI+ +LDENDN+P   Q +   S++  +     + RI A D D GEN  +++ + E + +     F ID    +I        ++I       L +   DHG P Q    AT  ++  +   + P  S       + + PEI     S +   YV  + DAD  GL  G+++  D  G E  +S+ + + ++V D  Q   +++   K++  K    RL I  +D    +      +I++V       P F  S  + ++SE    GT +                   YT+  SG  L      F L  V     E + ++E +   +  +   D E    I   + V   N K          S +T  V+I D NDN+P F   T + F + E    +  +  + A D+D+G+NG ++Y I   S + ++ F +D  +G +     +D E
Sbjct: 1019 DLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAE----NSPANVVIVKVEATDADDVDNDAAAPLMFKIER---GDPQSFFRIDLT---SGYITTSGIR---RLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVR--SKFAGKLCRIFAVDADEGENARLTYNITEGDAR-----FSIDNNGNIIA------SEAIHGDESYALTVQATDHGTPGQ-QFAATRVVLTANSAGQKPRKS-------KNSPPEI-----SGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDG---QAWDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQI-------------------YTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMK----------SFATFSVNINDENDNSPYFVGHTAFAF-VDESDTVDDVLATVTAFDKDRGENGIVTYSI--VSGNEESLFKIDAKSGEVRLAKPLDPE 1533          

HSP 9 Score: 90.8929 bits (224), Expect = 5.029e-18
Identity = 134/587 (22.83%), Postives = 256/587 (43.61%), Query Frame = 2
Query:  764 IIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLK--EPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLE-NIEYNNV-------KDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISE-SGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITE-EKP-QNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGD-PYGLFQIDSNVGGISFAKKPKPTDARS---YFLLIKVTDNDHPSRSAQITIHVKV 2473
            +IR LD        ++++PI           + R+    ++  +  LI + L+  + ++ N    F I   +G++ ++ +I+    + +   ++I ++  HG  ++L+    ++I +LD ND  PV      FS +  R   +   +   ++  V+  D D G NG++   +  +  +  LE N     +       K       V  + L      +  L +    +G       + +I++  + N +SP F      +E++E+ P GT++  +   D  E    NG   Y I + +G     L   E  G++  A      L+   +EK+  ++ +L VS  +           SS  T+ + IKD N+++P F +  Y   I+E EKP +++F   + A D D G+NGKI + + + + +  +  ++D  TG +     +DRE   +  F + A D+G P R S+ N+ + V D+NDN PK +   +++              +  + A D D    +++ + +     P   F+ID + G I       P D      + L I+V D+  P  S    +HV++
Sbjct:  379 LIRFLDNEKLTLKTDEMAPIG--------RILYRMNVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVSAKINRS--ERVYNFKVIASL--HGINEKLAE-KDVSIEILDSNDHAPV------FSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKI---VYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESE-NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQAND--EDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVAS----DLSKLMKEKLEVLDVQLKVSAID-----AGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIF--KVTANDFDGGNNGKIKFSLGN-NQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCV---VQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVP---FRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVEL 922          

HSP 10 Score: 86.2705 bits (212), Expect = 1.397e-16
Identity = 104/431 (24.13%), Postives = 187/431 (43.39%), Query Frame = 2
Query:  425 CNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH--EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPIS-IKEDTLVDHHIIRIEAKDKDTGENELISFFLK---EPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISES-------------GRKLFRLEPVEG 1660
              +L+ + D ND++PTF      + + E+E+I   + L         +     YY    + + F  +      TG     L +   LD E +S  +LTV+A D+GVPP      V I ++DENDNAP  E+   +  +KE++     ++ ++A D D+     +S+ L+   E      +  F I+  +G + +++ IDY+ I+   +  L +  +D G+P  L S A L I V D ND  P     ++ +       + E       +   +V D D   NG        +  +   +  +   V ++ E  ++T  KL+  K+  Y L +   D     +T    L + +   + ++PT    +I++   +NE P  ++  +  +D DE D +NG   + + E                 LFR++P  G
Sbjct: 3097 ATILVTVIDQNDNAPTFEKSTYSMKVMESESIG--YELAHFRASGGDQNETIEYYLKPSDVTSFVNLNA---QTGI----LTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINS-NGDVLISQSIDYEKIK---KYNLKVIAKDGGRPP-LRSEALLEIHVEDENDHAPTFDDCNMTAL------VQEGEAIGHRLLKFSVSDLDGPKNGA------PFTVEIQGDGAKSFKVNEKLE--LLTAKKLEYRKKDKYLLTVIAKDV--KGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEED-QNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTG 3496          

HSP 11 Score: 85.5001 bits (210), Expect = 2.337e-16
Identity = 130/573 (22.69%), Postives = 232/573 (40.49%), Query Frame = 2
Query:  827 IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKP-------QNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSI--ANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYF-LLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKT 2515
            + E   V   I  ++A  +  G   L+       +V  + +  R++  SG + +   +DY++ +   +I  ++ VQ       + S AT ++ + D ND  P       F    A   + E+   + ++A V   D D G NG V   ++   ++ SL  I+  + + +    +  +++     ES+ R  IR  DS       +  L ++  +    +  F R   +  L ++  PGT +  +N          +G   Y + E     F +  + G   L +       LT     K  ++E    V  T  +              VI  I   N ++PIF +  Y  TI E  P       ++L   ++ A DED G NG + Y++   S   +  F++D  +G + T+   D EK+  + F V+A D G P R S+  + +VV V D ND  P+F   +++   +S  + ++    +    A D D  G   + Y I+  D    F +DS  G +        +D    F L + VTD    +        +  E S+ ++   +Y T
Sbjct: 1372 VSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAME-DKIRVEPSSGNVIVMEPLDYEAAR---RIRAVVQVQQ----ANMKSFATFSVNINDENDNSP------YFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEE-SLFKIDAKSGEVRLAKPLDPELQ---HVESILR--IRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNAL-------HHGTVSYKL-EPNCTFFEVHTLSGAVHLATW------LTKLKHRK--SVECTAIVESTEGQQDIAK---------VIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRM--LSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLD---ISMILPTANGVSVGGQTAQDMDSVG--SLRYFIK--DQSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDGKQSASYVMKISTISTENSKFKFTRNEYHT 1890          

HSP 12 Score: 75.0998 bits (183), Expect = 3.297e-13
Identity = 150/650 (23.08%), Postives = 262/650 (40.31%), Query Frame = 2
Query:  635 NTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEF-ELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQN----LFVGLLQATDEDQGDNGKISYK-IDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQ---ITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWS 2554
            +TGKII    VKS LDRE  ++ ++T+ A  AG      ++ V   I D NDNAP         +I ED  V   +    A D+D   +  I F L E N      +F +++ SG +T+A Q+D + I      +LI    D G     ++    TI+V DVND  P       F ++    ++  +L S   + + ++ D D   N  V    I   ++  +  I+ NN        ++ K     E +  Y+L +   D      T  +  +    D +   P   ++ I   L+EN   GT++       L E+        + +S++   +F +          +  +++      D EK   +EF  LT+ D +                + V I++ NDN P   +   + +I E  P +     ++  + A D    D  +I ++ +DDF       F +D   G +T    +D E +  F   V A D     +   A ++V V D NDN P F     E  T S  +  SE+   +      +  +G +Q   I Y ++  D      +++  G ++ AK        +  L +   D+  P    +  + + V +       P ++  K  G+++++S S
Sbjct: 2662 STGKII----VKSSLDRERKNQWKMTIRADAAGGVHAITTVTV--DIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEEN-----PYFDLNENSGWLTVASQLDREKID---HYKLIARATDEGG---FNTDLPFTIVVSDVNDSPP------QFEKEEFNIDL--HLPSTSPILHFSIKDDDLSPN-NVSQFFIPKGNEEGVFWIDSNN-------DLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVI---LAENSKKGTVV-------LGESSLLGPNVTFKLSDNDGNVFVV-------NFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSE----------VCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAED---ADFDEIKFRMVDDFG----GLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDK---ATILVTVIDQNDNAPTF-----EKSTYSMKVMESES---IGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNA--PKFEKEKYVGKVKENSKS 3231          

HSP 13 Score: 62.7734 bits (151), Expect = 1.991e-9
Identity = 101/456 (22.15%), Postives = 189/456 (41.45%), Query Frame = 2
Query:  332 VELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKF-SINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ--LSPISIKEDTLVDHHIIRIEAKDKDTGENE-LISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDH--GKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDET---DKENGRFDYTISESGRKLFRLEPVEGRGKL 1672
            + L +    II+L  VVQ   + K P+  +   V++ I +IND +P F      I I  ++ I +    P   D D     +I+     E   +F+I   +   GK +P +        EE  E    +IA D G   +     V IR++D+    P+  Q   + +  KE T     ++++ AK     +++ LI +      + +  + F +D ++G + L      ++++ L +      V+     +PK ++      I+   +    PV   +   +  P    I + L + +          ++ L+G    ++     D ++                    +LD EK   Y L +  + SG  + +++ E IV + DVND  P F RS +  ++S++   G  +T ++ TD+D T   D+E+ +  Y I +    LF + P  G   L
Sbjct: 1940 IALDREKSAIIRL--VVQAKSHEKNPVMARAL-VVVGIENINDETPIFMGTPYDITIGHSD-IGTVVLEPKVIDNDEGDVVTISSENMPE---YFKIVGGKVVLGKKLPSIE-------EEDLEFNFKLIAKDNGSVHRVEE-PVKIRVVDKA--RPVFSQNVYTAVISKESTKKSTVLVKVMAKSSLQSKSKGLIGY-----RILDKKSPFSVDFLTGEVRL------NNLKMLAETNYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDENDTIEYSLSGSKDIEIHPETGDVTITG------------------QLDYEKTQKYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSL 2348          

HSP 14 Score: 58.151 bits (139), Expect = 5.365e-8
Identity = 155/698 (22.21%), Postives = 275/698 (39.40%), Query Frame = 2
Query:  353 ECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR--FFRIECTQDNTGKIIPQLRVKSRLDRE-EISEHQLTVIASDAGVPPKTGSINVIIRILDEN-DNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQ-------LVAYVNVHDADHGLNGQVKCDLIGYEDD--FSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQE--LIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEK---PQNLFVGLLQATDEDQGDNGKISYKIDDFS-SDVQNSFTLDFNTGTLTTKS-KIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPT 2386
            E   +++AVVQ+   +         N    I D ND+SP F        + E++T+D       A D D  +  I  Y     +    F+I+           ++R+   LD E +  E  L + A D+        +++ IR  +E  + A    ++   ++ + T     ++ + A    T     +S+ L EPN       F +  +SG + LA  +    ++    +E    V+     + +   A +   ++  N   P+      F RQ  R  I EN+ +         L   V+  D D G NG V   ++  +D+  FS+         DQ+   I T++  D EK   Y   ++  D G P + +     ++V VID ND  P F  + +++ +      G  +      D+D      G   Y I +     F ++   G   ++ +   I  +T           F+L V  T+ K  +     +S+ ST     K        F++ +Y  ++ E     P ++ + +    D           K+D FS  +   +F +   TG +++    +DREK +I    V+A+        + A VVV + +IND  P F+  T  + T+     S   T++++   +D DE   + +T S E    Y  F+I   VGG     K  P+
Sbjct: 1431 EAARRIRAVVQVQQANMKSFATFSVN----INDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG-------EVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHHGT-----VSYKL-EPNC----TFFEVHTLSGAVHLATWLT--KLKHRKSVECTAIVESTEGQQDI---AKVIAKIIRTNQHSPI------FRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSV---------DQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSV----GSLRYFIKDQSVP-FSVDSKTGDVLVKDSN-GISDMTKL---------FDLEVFVTDGKQSASYVMKISTISTENSKFK--------FTRNEYHTSLIENTTLPPGSIILSVATIGD-----------KLDHFSIVNPHEAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFM-GTPYDITIG---HSDIGTVVLEPKVIDNDEG--DVVTISSENMPEY--FKI---VGGKVVLGKKLPS 2042          

HSP 15 Score: 55.4546 bits (132), Expect = 2.796e-7
Identity = 38/120 (31.67%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 2114 GRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            GR + + + + V DIND  P F+ P    ++ S S  + E   +M V+A D DE   + I YS+  G     F +    G I+ AKK +     +  L IK TD+ +P   A  T+ V +
Sbjct: 2484 GRRAFSTLTLSVIDINDKPPFFVLPF---YSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNI 2598          

HSP 16 Score: 53.9138 bits (128), Expect = 9.973e-7
Identity = 85/364 (23.35%), Postives = 144/364 (39.56%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQND-MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSL-ENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELEL 1519
            + + DIND  P F       +ISE+        +  A D D +            S+FF +   Q         + V  +L+ +      LT+ A+D+  PP   +  V + I  E+   P       + S+ ED  V + I R++  + +  E   I F +   + ++D    F +++ +G I +   +D +      Q ++ I     G    + +  T+T+ + DVND  P       F     R  I E+      V   +  D D   +G+++  L+     F L EN  +  V  Q          LD EK   Y+LI R +D G         ++V   DVND+ P F +    ++L
Sbjct: 2493 LSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHPRQGT-------ITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDE---IRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKN---QWKMTIRADAAGG---VHAITTVTVDIGDVNDNAPA------FHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQ----------LDREKIDHYKLIARATDEGGFNTDLPFTIVVS--DVNDSPPQFEKEEFNIDL 2822          
BLAST of Protocadherin 1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 147.902 bits (372), Expect = 1.677e-35
Identity = 198/722 (27.42%), Postives = 302/722 (41.83%), Query Frame = 2
Query:  200 VNFHFVSE-NTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ--LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELII-TVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYE-DDFSLEN--IEYNNVK------------DQFEYKIVTKVKLDCEKESLYRLII--RCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSF-DREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAP-IFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHP-GRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLI-----MKVNALDYDEA 2278
            V++  V E N +      I++ TG I      DR+ +   M +  VE    S         V  L     P  + +  V I I D+ND++P+F   K +  + E+E          AHD D  K S  RY+   A         + ++G I     VK  LD E   ++ L +IASD        + NV I I D NDNAP  EQ   +   I+ED  +   +  + A D D  E      +  E    +++  FRI + SG I L + +D D    +P    ++  + D G    L   A + + V D+ND  P+             PE        +L  Y+  +      +G    D+   + DD + EN  IEY  V+            DQ   KI     LD E  S    II  R +D G P +     + +KV D+NDN+P F ++R E  + E  P G  + + +  D DE  K+N  F Y +SE     F +   +   +     LR+     + D  +       + VSD              + + V V + DRND+AP I   T++   + E+ P+   +G   ATD D GD  +  ++I+   SD +  FT+D   GTL     +DRE I+++   ++A D  +  GR  +A   V + D+NDN P       E +TV       ENT +      ++ A D D A
Sbjct: 1255 VHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKI--DMYILTVEASDRS---------VSALPGANGP-NKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIF----VKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV--FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGN--GLVGYADVQVNVRDINDNSPIF------------PE--------RLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQLSEES-DYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD----------AEAAVHVALVDRNDHAPHIHGATEHR--VREDVPRGTSIGRYTATDRDAGDTAR--FRINR-QSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVA---VYLQDVNDNGP-------EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTA 1903          

HSP 2 Score: 135.191 bits (339), Expect = 1.355e-31
Identity = 165/627 (26.32%), Postives = 278/627 (44.34%), Query Frame = 2
Query:  761 VIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKD----KDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQI-ELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDC----EKESLYRLIIRCSDSGHPKQTAQQELI-VKVIDVNDNSPTF-GRSRIELELSENEPPGTLLTTINVTDLDETD------KENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFD-REKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQ--------YEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKI--DREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYG--------LFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP---SRSAQITIHV--KVEESRQQYYNPDYKTG 2518
             I+ IL +       +Q   +++ ED LVD+ ++ ++A+     +D      I++ L+    +++   FRID  +G+I L R +D+D   +LP++ +L +T ++  +     S   LTI + DVND VP       F+R     ++ E++  NQ +  V   D D G N ++          +S++N   +N       +I  KV+LD     E+  +YR  +   D G P   +   +I ++  + ND S  F   S+    ++E+   GT +  I   D D  +       +NGR     S     LF ++   G  KL       + +++ D  E  + I   + V D +        ++ +S +T+++ I+D N+N P F             E T   + P  + V   +ATD+D   NG I Y +    S+ + +F +D  TG LT    +  DRE     +  VKA D+G           V+V DINDN P+F  P+ E    S S   +  T ++ V A D D A   +ITYS+E     G         F++ +   G     KP P   + +   +   DN  P     SAQ+T++V  K +++ +   +PD K G
Sbjct:  517 AILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDD-PALPKLHKLKVTAREDNR----ESHVDLTIRIDDVNDNVPT------FTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRIT---------YSVDN---HNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGR-----STQKMNLFSIDEHTGLVKLR------HGVSAADLAEAENPINLTVIVQD-DGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKV---EATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYE---TSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPG 1102          

HSP 3 Score: 115.546 bits (288), Expect = 1.619e-25
Identity = 166/649 (25.58%), Postives = 274/649 (42.22%), Query Frame = 2
Query:  677 LDREEISEHQLTVIASDAGVPPKTGSINV-IIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAK----------DKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTAT--------LTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENE---PPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLT-----SFDRE---KISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKP---QNLFVGLLQATDEDQ--GDNGKISYKI-DDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEF--KVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE--NTLIMKVNALDYDEAGKNQI-TYSIEGGDPYGLFQIDSNVG----GISFAKKP----KPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            LD E+++ + LT+ A+D  +  +  S    ++ + D ND  P     L   +I E+   + H+ +   K          D D  +NE+    + E N + +  HFRID+++G I    + D + I        I+TV+   +       A         + I++ DVND  P       F  Q     + E+      V  +  HD D   N  ++  LIG         I +    D     I  K  LD E    Y L++  SD  H    A   + + + DVNDN+P F + +    + E +   P   +L  ++ TD D+ +K           S R ++RLE   G+G  E  ++  YS T     + DR+    + +  F +   D +   + G          V V+++D NDN+PIF +  + +     +P     ++   +QA D D    +N  I Y I  +   + ++ F +D NTG +     +DRE  S  EF  +V+A D+G P R   ANV +KV+D+NDN P F     E      S++ +      +M  +A D DE  K+ + TY +     Y     D +      G+   K+P      T    + L I+V+D  H + +A   +HV +
Sbjct: 1170 LDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGE-ETKHFRIDELTGEIFPNEKFDREKIDMY-----ILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPS------FEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGG----RIPFGVRTDS--GTIFVKEPLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIP--KVLFNVHATDADQDEK-----------SSRIVYRLE---GQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYAD-------VQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF-----EKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVAL 1762          

HSP 4 Score: 108.997 bits (271), Expect = 1.683e-23
Identity = 181/708 (25.56%), Postives = 287/708 (40.54%), Query Frame = 2
Query:  434 LIEITDINDHSPTFFSDKVVINISEA----ETIDSPHPLPM----AHDPDSSKFSINRYYF------HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVP-------PKTGSINVIIRILDENDNAPIIEQLSPIS-IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQP-ARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKE-----SLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPP----GTLLTTINVTDLDETDKENGRFDYTISE----SGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDED-QGDNGKISYKI---DDFSSDVQNSFTLDFNTGTLTTKSKIDREKIS---IFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDN 2428
            ++E+ D+ND  P F  D     I E     E ++  +  P+    A D DS       +Y        E ++ FRI+   + TG+I P      + DRE+I  + LTV ASD  V        P   ++ V I I D NDNAP  E+   I  +KE     H +I I+A D D   N  + + L           F +   SG I +   +D+++     Q  L++   D     + ++T  + I + DVND  P       F +Q  A   I E++   +++  V+  DAD       K   I Y     LE    + V    +Y    ++    +++       +  +++  D          ++ V V D+NDNSP F   R+   + EN  P    G     +   D D+   EN   +Y I      +G  +FR++   G         +I+++ S DRE  S  EF + V   +R        S    + V + + D NDNAP F KT+YE ++ E  P    V    A D D +  +   +Y++    D+     +  +   + G L  K  +D E ++    F   ++  D  H      A V V + D ND+ P  I+   E H V   +     T I +  A D D     +   + +  DP   F ID + G +  A      D   Y L+I+  DN
Sbjct: 1198 VVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRID---ELTGEIFP----NEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLI--GAGGGRIPFGVRTDSGTIFVKEPLDFEASD---QYHLVLIASD----GRHNATTNVYIHIEDVNDNAP------QFEQQKYATTVIEEDVDIPKVLFNVHATDADQ----DEKSSRIVYR----LEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF-PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG---------KIFAMRSLDREISSEREFIIEVRANDRG-----VPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAE---AAVHVALVDRNDHAPH-IHGATE-HRVREDV--PRGTSIGRYTATDRDAGDTARFRINRQ-SDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDN 1849          

HSP 5 Score: 87.8113 bits (216), Expect = 3.793e-17
Identity = 144/563 (25.58%), Postives = 237/563 (42.10%), Query Frame = 2
Query:  602 SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQI-ELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHG--------LNGQV--KCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSG----HPKQT--AQQELIVKVIDVNDNSPTFGR-------SRIELELSENEPPGTLLTTINVTDLDETDKENG----RFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKID-DFSSDVQNSFTLDF------NTGTLTTKSKIDREKISIFEFKVKARDQGHP-GRYSIANVVVKVSDINDNDPKF 2179
            +++FRI    D +  II   R+    D      H+L V A +     +   +++ IRI D NDN P   + L    ++ED  ++  I+++ A DKDTG+N  I++ +       D ++F I+  +G I+   ++D D +     +    +T +DHG+P  LSS+A + I   + NDE  V      ++       + E+ Q    V  +   DAD           NG+   K +L   ++   L  + +           V+   L  E E+   L +   D G    +P +T  +   L++ + DVN+N P F         ++I     + +PP    T + V   D+    NG       YT SES RK F ++        ++  L       FDRE  +    ++TV  T+R           S     V + D NDN+P F +  YE +++  +     V  + A D D   N +I+Y ++ D ++  ++   LDF       +G +T    I   K   F F V A D G P    S A V + V D     PK+
Sbjct:  582 TKWFRI----DPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN---RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV-------DNHNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYT-----AFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHG----------VSAADL-AEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP----TIVKVEATDDDSSANGDIVYSLYYTQSES-RKAFVID-------RQTGVLTPSPHVVFDRE--TRPREDVTVKATDRGDRPLIGFCQFS-----VEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW 1093          

HSP 6 Score: 82.0333 bits (201), Expect = 2.436e-15
Identity = 81/350 (23.14%), Postives = 155/350 (44.29%), Query Frame = 2
Query: 1373 EKESLYRLIIRCSDSGHPKQTAQQ--ELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLD-------ETDKENGRFDYTIS----ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTI-EFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKIS----IFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSI-----EGGDPYGLFQIDSNVG 2353
            E+   YR+  +  D      T  Q  E+ +  I  ++  P F +   E+ +SE+      L   +V D+        E  +  G   Y++     E   K FR++P  G        + +  L  FD   +  + + ++T  + NR+S             + + I D NDN P F++  Y   + E+ P N  +  + A D+D GDN +I+Y +D+      ++F+++ N G ++ K ++D ++++    ++ F V ARD G P   S ++ ++ +   N ND   ++     +T   +  +   T ++++ A D D   ++++TYS             LF ID + G
Sbjct:  489 ERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDN-----LVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTG-------IIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVD----------LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN------HNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLS-SSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTG 805          

HSP 7 Score: 77.411 bits (189), Expect = 5.919e-14
Identity = 148/661 (22.39%), Postives = 270/661 (40.85%), Query Frame = 2
Query:  707 LTVIASDAG----VPPKTGS--INVIIRILDENDNAPIIEQLSPIS----IKEDTLVDH--HIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEI--LENLQSNQLVAYVNVHDADHGLNGQVKCDL-----IGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQ-TAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRK---LFRLEPVEGRGKLESAKLRIYS-------------LTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLF--------VGLLQATDEDQ-GDNGKISYKI-DDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQ---GHPGRYSI----ANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE----NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVK-VEESRQQYYNPDYKT 2515
            LTVI  D G     P KT +    ++I I D N+N P     +  S    I E T       I+++EA D D+  N  I + L     ++    F ID+ +GV+T +  + +D  ++ P+ ++ +   D G  + L      ++ V+D+ND  P       F R      +   E + ++ +  +   +DA H  N ++   L      G E    L+  E  N +   E  ++  + +  +K   +   +   D+G P+   +  ++ + V+D    +P +       + S +  PG     I V +  E +K   R     S   R    +++L    G G    +K R ++             +   D E+++     LT +D   +  S          T +V ++D ND  P F+   +  TI EE   N          +  ++A D D  G   ++ Y+I  + + +    F +D  TG +    K DREKI ++   V+A D+     PG          V + ++D+NDN P F     E       ++ SE    + + +K + LD     +  +  +  G  P+G+ + DS   G  F K+P   +A   + L+ +  +   + +  + IH++ V ++  Q+    Y T
Sbjct:  827 LTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES-RKAFVIDRQTGVLTPSPHVVFDR-ETRPREDVTVKATDRGD-RPLIGFCQFSVEVVDINDNSP------QFERPSYETSVSRFEAVGTSVITVFAFDNDAAH--NAEITYSLEIDTTAGEEHQNDLDFFELVNRRSG-EITLIKPIPMKTQK---FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW-------QTSPDCKPG-----ITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTK--------TFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSF-----EEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGV-RTDS---GTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYAT 1443          

HSP 8 Score: 75.485 bits (184), Expect = 2.636e-13
Identity = 170/734 (23.16%), Postives = 284/734 (38.69%), Query Frame = 2
Query:  398 HKTPLTQKDCN------VLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKII---PQLRVKSRLDREEISE----HQLTVIASDAGVPPKTGSINVI-IRILDENDNAPIIEQLSPIS--IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDY-DSIQSLPQIELIITVQDHGK-----PKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQ--LVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVT---KVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIE----------FELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKT---QYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKI---DDFSSDVQNSFTL--DFNTGT----LTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTI-----ENHTVSASIQSSENTLIMKVNALDYDEAG-KNQITYSIEG---GDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTD 2425
            HK  +T ++ N      + I I D+ND+ PTF        + E   ++       A D D+   S             RI  + DN    I    ++  K RLD ++++E    ++  V A D G P    S  +I IR  + ND + +    S  +  + ED      +I+I+A+D D  E    SF  K       MN F ID+ +G++ L   +   D  ++   I L + VQD G       K  +S ATL I + DVN+  P       +S      +I+E         +  V   D D   NG +   L      ++        V D+ +  ++T    V  D E      + ++ +D G        +  V+V+D+NDNSP F R   E  +S  E  GT + T+              FD   + +    + LE     G+     L  + L +    +I+ I+          F +   D           +L SS+ V +++ D+   AP +  +   +   T+ E    N  +   +A       N  + YK+       +  ++ F     F  G     +     +D E+++ +   + A D       S    VV+V D+ND  P+F          E  T +  ++ +    I+ V A+D D  G +N++ Y I G   G+    F+ID   G I   +K        Y L ++ +D
Sbjct:  611 HKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNS-------------RITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDE-VTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIA---KIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY-----YTQSESRKAFVIDR-QTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFA------------FDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNG------IPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSR-VASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASD 1302          
BLAST of Protocadherin 1 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 261.151 bits (666), Expect = 1.282e-70
Identity = 213/699 (30.47%), Postives = 330/699 (47.21%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRF---FRIECTQDNTGKI-IPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID----YDSIQSLPQIELIITV--QDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIV-TKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQN----SFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPG-RYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI-------QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISF-AKKPKPTDARSYFLLIKVTDNDHPSRSAQ 2452
            V I++ D+ND+SP F    + I+ SE+ T  +   L  A D D  +  +   Y   A      FR+  T + +G      L     LDRE    +QL + A D G PP+ G + V + ILD NDN PI +     +S+ E  L    ++ + A D D G+N  I+++L E   Q     F ++  +GVI+   +++     +   S  Q   + TV  +DHG P+Q   T  +T+ +LD ND  P+IS    F        + EN  +  +VA V V D+D GLNG+    ++      S   + +  +++  +  IV     LD E+   Y L +   D G P +T    LI+ V DVND+ P F +S     LSE  P G+ + +I  TD D        +D  +S +  K F ++P+ G          I +    DRE   T+E  ++  D          +       + V I D ND AP FS+ +   T+ E+ P    V L+ ATD DQG NG +++ +   +  V+      F LD  TG LTT+  +DREK+S +E  V ARDQG P  + + A V + V+D+NDNDP+F YP    ++++          +  +  +++ V A D D+     I Y +E G   GLFQ+D+  G IS     P     + ++ L+ V+  D   R +Q
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ-----FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTY-VTVNLLDTNDHDPIISF-RFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIV------SGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYD-ILSGNELKWFSMDPLTG---------LIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQ-------LKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFAL---APSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQF-YPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE-GLFQLDARSGAISLRGDAPASMHWKPHYKLL-VSARDAGQRRSQ 804          

HSP 2 Score: 210.69 bits (535), Expect = 1.169e-54
Identity = 206/711 (28.97%), Postives = 306/711 (43.04%), Query Frame = 2
Query:  443 ITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQ--LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQ-------------------IELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLI-GYE-DDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSG--HPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRK-LFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVI--VHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNS--FTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIAN---VVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPS--RSAQITIHV 2467
            I D+NDH+P F       ++ E   +++      A D D        Y          IE   +    + P   L V++ LDREE   + LTV   DAG P ++  + V+I ++DENDNAP         SI E+   D  + ++ A D+D G N  +SF L      +    F ID  +G I   R  D +++  + +                   + L  TV D+G P+ L     + +IV DVND  P       F R P    I E       + +V   DAD GLNG V   L  G E   F+L         D    ++    +LD E + ++ LI+   D+   HP  ++   + + V+D NDN+P F +S  E+ + E  P GT L     +D D+    N +  ++IS   R+  F ++ + G          +Y     D E I++    +T SD           + S S+TV+  V + D NDN PIF  T     I E  P    +  + A D D G NGK+SY I      +     F ++  TG + T  +IDRE I  F   V A D+  P    ++    V V V DINDN P F+           S     +T +M+V+A D D +    +TY I  G P  LF++  N G I+F   P+      Y L +K TD    S  RS+++ I +
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEI--------IEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLS-----SQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPR-LQDKVKVKVIVTDVNDNAPE------FLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNL---------DSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHP-LSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQ--GVNSQVVFSISAGNRRDTFHIDSITG---------SLYLHKPLDYEDITSYTLNITASDCG---------TPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSG-PQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITI 1698          

HSP 3 Score: 186.422 bits (472), Expect = 3.491e-47
Identity = 214/782 (27.37%), Postives = 325/782 (41.56%), Query Frame = 2
Query:  260 STGRITLRRPIDRD-----SMCEKMKLCCVELHQSSECI-IQLKAVV-----------QLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIP----------QLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE--QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH-FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENL--QSNQLVAYVNVHDADH-GLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKIS----IFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPT---IENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTD-ARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            S G I  RR +DR+     ++    + C  E    SE    QLK              + L + K         V I I D+ND  P F S      I E   I++      A D D  +     Y   EA          ++ G+  P          QLRV   LDRE  S + L + A D G PP++    ++IRILDENDN+P+ +  Q S  S+ E+  +   ++++ A D D G N  I + +    V  D NH F I + +GV+ +A+ ++Y   + L +  L +  +D         TA LTI +LD+ND  P       F   P    ++EN    +   V  VN +DAD   LN QV+  L   + D    N    +        I     LD E++S Y L +   D+G P  T    + V+V D+NDN P F        + EN P GT + T   TD DE      RF+      G  + R         ++S    I + T+ DRE+ S     L   D++           +SS  + + + D NDN P F  T Y   + E   +  FV   +A D D G+N  + Y I   S   Q+ F ++  TG ++TK ++  +  S     +   + A DQG     S A + V +       P  ++PT   + N   + S       +I KV+A    +    +I Y+I GG      ++D N G +S  +     +    Y + I+  D D PS  +   I + V ++
Sbjct: 2079 SNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEAR--------DEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYS-ASVAENASIGAMVLQVSATDVDEGANGRIRYSI----VLGDQNHDFSISEDTGVVRVAKNLNY---ERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPT------FLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGD--------IALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLL----GEHMHRFH-------IDSETGEISTATTLDREETSVYHLTLMAQDSS------ITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI---SGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILR------PPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDA 2803          

HSP 4 Score: 177.948 bits (450), Expect = 1.527e-44
Identity = 199/731 (27.22%), Postives = 319/731 (43.64%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIR---CSD------------------SGHPKQTAQQELI-----------VKVI----DVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISES-----GRK---LFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQG--HPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKN-QITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            V + + D ND  P F     V N+SE   I        AHDPD+   S+           F +E +   TGK+I    +   LDRE  S+++L +  SD GV  +       I++ D NDN P+ E  +    I E+    + + +I A+D D G+N  +S+ +   +  ND+  F ++  +G++TL  ++DY+ +Q      LI+  QD+G+P  LS+T T+   VLD+ND  P+   +   S      E+ EN+     V  V+  D D G NG ++  +   + D     I+ N         I T+  LD E  S Y L +    C+D                  S    Q  +QE +           VKV     DVND  P F  S  E  + EN    T++  +   D DE    NG  DY + E+     G+     F L P +G       +LR+  + + DRE  S+    +T  D      S   +       +++ I D NDN+P+F   QY  ++ E       V  + ATD D+G NG+I Y I     D  + F++  +TG +     ++ E++S +   V+A D    +P     A + + + DINDN P F+        +  ++  +    ++ VNA D D    N Q+ Y ++ GD   LF+I+++ G I+  K         Y L +   D   P  +    + V+V++
Sbjct: 1809 VRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLG-SVTFLLMDGHDGKFLLEPS---TGKLI----LNDTLDRETKSKYELRIRVSD-GV--QYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVS-DWANDV--FSLNPQTGMLTLTARLDYEEVQ---HYILIVQAQDNGQPS-LSTTITVYCNVLDLNDNAPIFDPMSYSS------EVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEF-GIDSNGT-------IRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVF-ISANETAIMENVAINTVVIAVKAVDNDE--GRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDG-------QLRV--VDALDRELRSSYLLNITARDRGEPPQSTESQ-------LLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSI--VLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAG-DTAELTINILDINDNRPTFLDSPYLARVMENTVPPN-GGYVLTVNAYDADTPPLNSQVRYFLKEGDS-DLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQD 2483          

HSP 5 Score: 174.096 bits (440), Expect = 2.447e-43
Identity = 179/618 (28.96%), Postives = 274/618 (44.34%), Query Frame = 2
Query:  695 SEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLI--GYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDED-QGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYD-EAGKNQITYSIEGGDPYGLFQIDSNVGGI----SFAKK--------------PKPTDARSYFLLIKVTD-NDHPSRSAQITIHVKV 2473
            + ++L V A+D GVPP++    V+I +  EN + P     S  + + E+  V   I+ + A D DTG N ++ + +   N + D   F +D+ +G I + +Q+DYD IQ   +  L ITVQD G    LSS A LTII+ DVND  PV      F+ +     I EN      V   +  D D   N  +    +  G +  F + N        Q    I + V  D E+  +Y L I+  +     ++    L V V+ VN+  P F +     ++SE    GT +  +  TD D    E+GR  Y  +  S  K FR++   G          IY     DRE  + +   +       K+      + +  + VI+ I+D ND  P F K  Y  TI+E  P    V  ++A D+D +  N + SY I   + +++ SF +D  TG ++T S++DRE+ S +   + A D G P +   A V +++ D+NDN P F   T E      S      T IM + A D D        TY + GG       +D N G +    SF ++               KP     + L I V D ND+PS +  + I V +
Sbjct: 3193 TRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQD---FSVDERTGGIVIQQQLDYDLIQ---EYHLNITVQDLGY-HPLSSVAMLTIILTDVNDNPPV------FNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMN--------QSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMES-YANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDS--GEDGRVYYLLVGSSNDKGFRIDTNTGL---------IYVARHLDRETQNRVVLTVMA-----KNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSI--INGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTF---TPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSL 3766          

HSP 6 Score: 161.384 bits (407), Expect = 1.939e-39
Identity = 193/760 (25.39%), Postives = 325/760 (42.76%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRY-YFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVP-PKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQI-----DYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENT--LIMKVNALDYDEAGKNQ-ITYSIEGGDPYGLFQIDSNVGGISFAKKP----KPTDARS----YFLLIKVTDNDHPSRSAQITIHVKV 2473
            IN S+G I L +P+DR+              Q SE  + L A    +D    PLT     V +E+ DIND+ P F        + E     +    P A D D    +  R+    E    F I+     TG+I       + LDREE S + LT++A D+ +  P+  S+N+ I + D NDN P  +  +  +++ E       +    A D D GEN ++ + +       D ++F I+  +GV++   ++      +D +       ++I+  D G+ + LSS A LT+I L   +  P  + +       +   + E+++  +++  V+      GL G+++  + G     SL       V        V +  LD E   LY + I  +D   P   +   + + V D NDN+P   +     E+ E E P  L+  +  +D D  D  NG   Y +       F +         ES +  IY+    DRE+I    F +   D            ++ +++V++H+ D+NDN P F++  +   +TE      FV  + ++D D G N   SY    FS +    F ++  +G +T    +DRE+   +  KV A D        I    + + D NDN P+F     E+   S S    + +  L+ ++ A D D+ G N  I+YS++   P  +F ID   G + F+KK          RS    Y L +  TDN  P   ++  +++ +
Sbjct: 2436 INASSGDIALLKPLDRE--------------QQSEYTLTLVA----MDTGSPPLTGTGI-VRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDS---ETGEI----STATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTIS----GRDQHYFDINTKTGVVSTKLELKTKTKSHDDLT----YTIVISAMDQGE-QSLSSKAELTVI-LRPPELFPTFAYM-----ANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLR------VDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGD--NGNVIYRLQNDFDGTFEI--------TESGE--IYTRMRLDREEIGDYAFVVEAVDQG-------VPHMTGTASVLLHLLDKNDNPPKFTRL-FSLNVTENAEIGSFVIRVTSSDLDLGANANASYS---FSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETPI---TITIQDQNDNAPEF-----EHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQ--QPSPMFSIDPATGEV-FSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINI 3114          

HSP 7 Score: 147.902 bits (372), Expect = 2.453e-35
Identity = 172/714 (24.09%), Postives = 301/714 (42.16%), Query Frame = 2
Query:  404 TPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPM--AHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIP--QLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDAD-HGLNGQVKCDLIGYEDDFSLENIEYNNV-KDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTI-----ENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYS-IEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRS-AQITIHV-KVEESRQQYYNP 2503
            TP  +    + + +TD ND++P    ++++ N    E    P  + +  A D DS             +  +R++   D T +I    ++  + RLDREEI ++   V A D GVP  TG+ +V++ +LD+NDN P   +L  +++ E+  +   +IR+ + D D G N   S+   E    N    FRI+  SG IT+A  +D +      Q E I+ V          +   +TI + D ND  P       F          E  QS  LV  +   D D  G N  +   L      FS++        K    +K    V+     E++Y L +  +D+G P   ++  + + ++D ++N P F ++     L ++   G  +  ++    D+ D      DY++       F L  +   G+ +     +  +     +      +EL V  T+R     +  +      V++ +   N + P FS   Y+  + E +P    +  + ATD+D G NG + Y I     + +  F++D  TG +  + ++D + I  +   +  +D G+    S+A + + ++D+NDN P F +        EN  V         T + + +A D D      I Y+ +  G     F ++ + G IS A      + R Y L IK  + D    S A + +HV  V E   Q+  P
Sbjct: 2787 TPSLRSVTLITLNVTDANDNAPVM--EQLIYNAEVLEEESPPQLIAVVKASDRDSGD---------NGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSE----NPGEKFRIEPQSGNITVAGHLDREQ-----QDEYILKVV--ASDGAWRAETPITITIQDQNDNAPE------FEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVR---SPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHAN--DKQDLGTNEMDYSL-----MTFNLSSIFSVGRHDGWITLVKPI-----QVPPNTRYELVVRATDRGVPPQSDETR-----VVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSIS--GGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPV--------GTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQP 3442          

HSP 8 Score: 147.517 bits (371), Expect = 3.137e-35
Identity = 174/650 (26.77%), Postives = 284/650 (43.69%), Query Frame = 2
Query:  659 LRVKSRLDREE-ISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIG--YEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTIS----ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDR----EKISTIEFELT----------VSDTNRKXXXXXXXXXXXXXTVIVH--IKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKI-----DDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDN--DHPSR-SAQITIHV-KVEESRQQYYNPDY 2509
            L   + LDRE    E+++ V A   G  P+T    V + +LD+ND+ P  ++     ++ ED  + H I  + A D DT  +  ++F L    +      F ++  +G + L   +D ++     + EL I V D  +  +    A  TI V D ND  P      LF       +I EN Q    V  +   DAD G N Q+   ++     D FSL         +     +    +LD E+   Y LI++  D+G P  +    +   V+D+NDN+P F       E+ EN P  T + T++  D+D  +  NG  +Y+I+    +S   +     +  R  L+      Y+LT   R    E  S  E E T               R+      +    SSTV V   IKD ND  P+F     E  I E    N  V  ++A D D+G NG I Y +     +D        F+L+   G L     +DRE  S +   + ARD+G P + + + +++++ D NDN P F     + ++ S +  +S   ++++V+A D DE    +I YSI  GD    F I  + G +  AK         Y L ++  D   ++P+  +A++TI++  + ++R  + +  Y
Sbjct: 1774 LSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGS--VTFLL----MDGHDGKFLLEPSTGKLILNDTLDRETKS---KYELRIRVSDGVQYTE----AYATIQVSDTNDNPP------LFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSL---------NPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGN--NGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISAN-ETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVF---DPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPY 2389          

HSP 9 Score: 145.591 bits (366), Expect = 1.585e-34
Identity = 191/755 (25.30%), Postives = 326/755 (43.18%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDK---VVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF-HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLAR-QIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIE-YNNVKDQFEYKIVTKVKLDCEKE----SL-------YRLI-IRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSS--ENTLIMKVNALDYDEAGKNQITYSIEGGDPY----GLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPS 2440
            I+  +GRIT  RP+DR+              Q++  +  L +         + ++   C V I I D+ND++P F  D+     I++ E   +     L    D D+   S   Y   +  ++ FRI       G +   L ++  +  E  S   + ++A+DAG PP +  +++ + I D ND+ P+ +  S   S+ E T V+     + A D D G+N  IS+ + E N +     F    +     L R + DY          L ++ +D G+P + SS   + I V+D ND  P       F+       I EN  ++  V  +   D D G N ++   L     DF+++    +      F+ + + KV  + E      SL       Y L+    SD+G P+   + ++ V V DVNDN+P F R+   + +SE    GT +T +   D DE    NG   Y++++            G+  L+SA  ++      DRE        +   D   K        LSS++++ + + D NDNAP F+++  E ++ E  P    +   +A+D DQG N ++ + I   + + +++F +D  TG+L     +D E I+ +   + A D G P   +     V V D NDN P  I+P+     +   I+      T I+ V A D D     +++Y+I   +P       F I++  G I   ++       ++ L +  TD   PS
Sbjct:  881 IDTRSGRITTARPLDRE-------------EQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRI-------GPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDY--------YALTVSCRDAGQPSR-SSVVPVVIHVIDENDNAP------QFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADE--GLNGDVYYSLAKGNEA--------GQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALK------HPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSIS--AGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPP--IFPST---AIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPS 1577          

HSP 10 Score: 145.206 bits (365), Expect = 1.725e-34
Identity = 195/789 (24.71%), Postives = 323/789 (40.94%), Query Frame = 2
Query:  263 TGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEA-------ETIDSPHPL--PMAHDPDSSKFSINRYYFHEASR-FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE--QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPN------VQND-MNHFRIDQMSGVITLARQIDYDSIQS--LPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEIL--ENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKV-----KLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG-RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIAN----------------------VVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDN--DHP-SRSAQITIHV 2467
            TG++T RRP+DR+ M +  ++  +   Q +                 TP +     V + + D+ND+ P F+    + ++++        + ++    L    A D D    ++  Y         F+++     +G I   LR  +         ++L V A DAG   +    + I+ I+ ++    ++E  Q      +   + DH   R    +++ G  ++ S   K  +      +Q D   +FRID  SG IT AR +D +   +  L  +    +               + I ++D+ND  PV ++      + + P I   EN    Q +    V D D G+N ++   L              NN   QF    VT V      +  E  SL  + +  +D+G P  +++  L V + DVND++P F  +  E  L E     T    +  TD+D  D  NGR  Y I E    ++F + P +G          ++     DRE+       ++  D  + S S           V++H+ D NDNAP F+ + + F+I E  P + FVG L A D D G N ++S+ +   SS  Q+ FT+D   G + T    DRE +       +A  +    R S+A                       V V V+D+NDN P+F+      + V+ S  +SE T I  V   D DE     + YS+  G+  G F +DS  G +S  ++        + L++   D    HP S +A ITI V
Sbjct:  656 TGQLTTRRPLDREKMSQ-YEISVIARDQGA----------------PTPQSAT-ATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDA---RSGAI--SLRGDAPASMHWKPHYKLLVSARDAG--QRRSQQDAIVEIVLKS-KLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFAL-----DRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLT-------------NNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGD--NGRISYEIIEGNTERMFGVFP-DGY---------LFVRAPLDREERDYYALTVSCRDAGQPSRSSVV-------PVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTL---SSQTQD-FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAP---YHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVV 1374          

HSP 11 Score: 144.821 bits (364), Expect = 2.244e-34
Identity = 196/802 (24.44%), Postives = 335/802 (41.77%), Query Frame = 2
Query:   89 NKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHF-VSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLD----NHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVP-PKTGSINVIIRILDENDNAPIIEQLSP-ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHP--KQTAQQELIVKVI-DVNDNSPTF---GRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIF-SKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSS-----DVQNSFTLDFNTGTLTTKSKIDREK-ISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFI-YPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDN 2428
            N    F I E +PA+  +G +       +++   G      F +S  TQ  +   I+   G I   RP DR+++  K+        +       +     LL+    ++  P  Q    V + +TD+ND++P F      + ISE  +  +        D D        Y   + +     E  Q N      QL +  RLDRE    H L V+A DA +  P + + ++ I +LDENDNAP   Q S  +S+ E +     ++R  A D D G N  + F +   +  N  + F ID ++G + L + +DY+ I S     L IT  D G P  LS+T    ++V+D ND  P+      F       +I E +     +  V   D D GLNG+V   +   E        +  +     E  ++  ++ +D E    +RL +  +D   P  +Q + ++L+  ++ D+NDN+P F     + +  + S ++   T +  ++  D D +   NG   Y I    ++LF+L+   G          I + T   + K   + ++LT+  T+    S    S    + +         + P F  +++   ++ E +P    +G    T      + +I Y + + ++      V   F +D   G L+T +++DRE     +E +V A   G   R S   V V V D ND+ P+F+  P + N  VS  +Q      I  + A D D  G   +T+ +  G   G F ++ + G +             Y L I+V+D 
Sbjct: 1155 NSTFTFSIPENAPADTFVGKLT------AVDRDIGRNAELSFTLSSQTQDFT---IDTRNGFIKTLRPFDREALV-KVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGN-----EAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSI---SAGNRRDTFHIDSITGSLYLHKPLDYEDITSY---TLNITASDCGTPS-LSTTVLYNVLVVDDNDNPPI------FPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLP----QGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSS--SNGLVTYEIVSGPQELFKLQRNTG----------IITFTPGPQFK-QEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEP----IGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYN--VSEDLQIGHT--ISTLRAHDPDTLGS--VTFLLMDGHD-GKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG 1900          

HSP 12 Score: 142.51 bits (358), Expect = 1.143e-33
Identity = 172/697 (24.68%), Postives = 290/697 (41.61%), Query Frame = 2
Query:  395 NHKTPLTQKDCNVLIEITDINDHSPT----FFSDKVVINISEAETIDSPHPLPMA-HDPDSS---KFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISI-KEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIG-----YEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPK-QTAQQELIVKVIDVNDNSPTF---------GRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQ------NLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKV------KARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKP 2377
            +H +P       V + + D NDH P     FF D   +   +   ++      +A  D DS    + S+     +E   F R+E   D     +  +RV   LDREEI ++ LTV+A D G P +T + ++II + D ND+ P+ E+    ++  E       +  I A D+DTG N  + + +      N++  F +D ++G+I     +D +   +   +EL I+ +D G   + + T  L +I+LD NDE P       FS++     + E+     +VA +   D D G NG V   L       Y   F+L         D    ++ T+  LD EK S Y + +   D G P  Q+A   + + V DVNDN P F              +++L +      +L  ++VT  D+ D +N   +Y +   G  LF+L+   G     +  LR  +  S   +      ++L VS    +          +   +++  K             YEF + E+  Q      N  VG++Q    +   N  I Y I     D   +F +D  +G +TT   +DRE+ + +   +       +        Y    V + + D+NDN P F        T+S    ++    I      D D    ++I+YS+   +P   F+I   V G+ + ++P
Sbjct:  356 DHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHF-RLEEAAD-----LHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILS---GNELKWFSMDPLTGLIVTTGPLDREIRDT---VELSISARDGGPNPKFAYTQ-LKVIILDENDEAP------QFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFAL---------DALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERIL--LHVTASDKDDGDNALIEYRLESGGEGLFQLDARSG-----AISLRGDAPASMHWKP----HYKLLVS---ARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDI--IQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLT-NNPNQQFRIGP-VTGVLYLQRP 1006          

HSP 13 Score: 142.124 bits (357), Expect = 1.776e-33
Identity = 173/663 (26.09%), Postives = 283/663 (42.68%), Query Frame = 2
Query:  554 PDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEH-QLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELI-SFFLKEPNVQNDMNHFRIDQMSG---VITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYN--NVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPT-----FGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL--FRLEPVEGRGKLESAKLRIYSLTS-FDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITY----SIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPS-RSAQITIHVKVEE 2479
            P   KFS   Y F+E  R F ++        +  +++    LDRE + +H  L V++S    P     I V I++LD NDN+P   + S  IS  E       ++   A D D GEN +   + +   NV N          SG    + L    + D  +S    +L I+ +D G P +      + + +LDVND  P+      F        + E       V  V   D D G N ++   L   E  F++ N E    +  ++      T VK    ++S     +   D G P+Q  +  + V ++D ND+ P      F        + EN   GT++  + V D D     NGR    I  SG +L  FRLE        E+A L I  +    DRE+I   ++ LTV   ++ + + T  +      +I+ + D ND+ P+F K++Y   ++E  P   FV  + ATDED G N ++ Y I   S +    F++D  TG + T   +DRE     E  + ARD G   +++   + V + D ND  P+F   +     V+    +   T++  + A D+D+     +T+    S+E   P   F +D+  G ++  +         Y + +   D   P+ +SA  T+ + V +
Sbjct:   87 PTKPKFS---YRFNEPPREFTLD-------PVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYP-----IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDR-ESRGSYQLNISARDGGSPPRF-GYLQVNVTILDVNDNPPI------FDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTV-NPETGVISTTERVNCPQQTNVKSSASQKSCV-FTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDS--GLNGRTSVRIV-SGNELGHFRLE--------EAADLHIVRVNGVLDREEIG--KYNLTVVAMDQGTPARTTTAH-----LIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDI--LSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQF---SQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPL-QFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVAD 700          

HSP 14 Score: 139.428 bits (350), Expect = 9.839e-33
Identity = 172/669 (25.71%), Postives = 275/669 (41.11%), Query Frame = 2
Query:  428 NVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEA------SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPK---TGSINVIIRILDENDNAPIIEQLS----PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHG-KPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYK---------IVTKVKLDCEK-ESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYK-IDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSEN----TLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSN 2347
            NVL+   D ND+ P F S  +V  I E   + +P     A DPDS       Y   +        R F I      TG +I  LR    +DRE I   +LTV+A+D   P +   +    V + + D NDNAP+   ++    P            ++++ AKD D+  N L+++ +    V      F++ + +G+IT      +   +   + +L +   D   + ++ SS   +TII           S+     R      + EN      +  V  H             L   E ++ + N+     + Q +           + T  +LD E     Y + +     G   +T++ ++ V V+D ND+ P F  +     +SE+   G  ++T+   D D      G   + + +     F LEP  G+  L           + DRE  S  E  + VSD              + +   + + D NDN P+F  T Y F I E   +   VG + A D D G N ++SY  + D+++DV   F+L+  TG LT  +++D E++  +   V+A+D G P   +   V   V D+NDN P F         +S S +  EN    T ++ V+A D D      I YSI  GD    F IDSN
Sbjct: 1476 NVLV--VDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINT---ETG-VIHTLR---EIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEI----VSGPQELFKLQRNTGIITFTPGPQF---KQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSES--SVPQFEQRSKLSGSVYENEPIGTSILTVTAH-------------LASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL----GSVTFLLMDGHDGKFLLEPSTGKLILND---------TLDRETKSKYELRIRVSD----------GVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDV---FSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIF-------DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSN 2080          

HSP 15 Score: 135.576 bits (340), Expect = 1.724e-31
Identity = 179/719 (24.90%), Postives = 310/719 (43.12%), Query Frame = 2
Query:  395 NHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP-ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMN-HFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVI---SIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDL-IGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVI------DVNDNSPTFGRSRIEL----ELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL-FRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVI-VHIKDRNDNAPIFS-KTQYEFTITEEKPQNLFVG----LLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLL-IKVTDNDHPSRSAQITIHVKV 2473
            +  TP      +++I++ D+NDH P F   +    +SE     S      A D D+   +   Y     +  ++F ++     TG I+        LDRE     +L++ A D G  PK     + + ILDEND AP   Q    +++ ED      +  + A D D G N  ++F L  P+V+      F +D ++G +T  R +D    + + Q E+ +  +D G P   S+TAT+ + V DVND  P       I   +      ++ + ++  +++ +V   D D G N  ++  L  G E  F L+              +          +  Y+L++   D+G  ++ +QQ+ IV+++       +       G    ++    E   N  P   +  + V   +   K N   +Y I +  R   FR++   G         RI +    DRE+ +   + LT+  ++  S S    S+S    ++ + I D NDNAP+F+   + E TI+   P+N  VG    L +  D D G N +ISY +   +++    F +   TG L  +  I  E  S+   ++ A D G P   S  ++ V ++D+ND+ P F + + E    S    +  NT    + A D D     +I+Y I  G+   +F +  +  G  F + P   + R Y+ L +   D   PSRS+ + + + V
Sbjct:  468 DQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPL---TGLIV----TTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALA-PSVERLYPLQFALDALTGQLTTRRPLDR---EKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLD-------ARSGAISLRGDAPASMHWKPHYKLLVSARDAG--QRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTN--GKANSHIEYDIIQGDRAQNFRIDTRSG---------RITTARPLDREEQAN--YRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTIS--LPENAAVGQEIYLSRVRDRDAGVNSRISYSL---TNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYE---TSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPD--GYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHV 1143          

HSP 16 Score: 95.9005 bits (237), Expect = 2.237e-19
Identity = 128/514 (24.90%), Postives = 223/514 (43.39%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEY-----KIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNR 1768
            +++ TG I +++ +D D + E                  L   VQ L  H  PL+      +I +TD+ND+ P F   +    I E + + +      A D DS K +I  Y F  +   R F I    + T      +      D EE   + L + A +     ++ + N+ + +L  N+  P  ++ +    + E + V   +  ++A DKD+GE+  + + L      ND   FRID  +G+I +AR +D ++     ++ L +  +++G           +I   D ++   +ISI D     P  PE +++  ++ +     V      +   +  D+    + FS   I   N+K  F+      +I T  +LD E+ S Y L+I   D+G P QT    + +++ DVNDN PTF    +   +SENEP GT + T+  +D D   +  G F Y +     K +          ++     + S TSFDRE    +E  + V D+ +
Sbjct: 3279 VDERTGGIVIQQQLDYDLIQE----------------YHLNITVQDLGYH--PLSSVAMLTII-LTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGT------ISSAVSFDYEERRIYTLQIKAKNPDSSMESYA-NLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLV--GSSNDKG-FRIDTNTGLIYVARHLDRETQN---RVVLTVMAKNYG-----------SIRGNDTDEAQVIISIQD--GNDP--PEFIKHYYTSTISEAAPVGTKVTTVKA-IDKDVRTQNNQFSYSIIN-GNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPD-LPRNGGPFTYQLIGGKHKSWL--------SVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGK 3734          

HSP 17 Score: 91.2781 bits (225), Expect = 4.704e-18
Identity = 98/384 (25.52%), Postives = 165/384 (42.97%), Query Frame = 2
Query: 1247 LNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVT---KVKLDCEKESL---YRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGR--KLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFE---------FKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI--QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQID 2341
            L GQ +   +G+       +  +N    +F    VT   K  +  ++E +   Y L++  S   +P      E+ +KV+DVNDNSP F    I +  SE+   GT L     TD D    ENG  D     +G     FRL         +++ L + +  + DRE   + +  ++  D       G  +       V V I D NDN PIF  + Y  ++ E       V  + A+D D GDN KI+Y    + ++ ++ FT++  TG ++T  +++  + +  +         F V ARD G P +     V V + D ND+DP   +    +    A++   +   T++  V   D D     + +  I  G+  G F+++
Sbjct:   74 LEGQPRGTTVGFIPTKPKFSYRFNEPPREFTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPI-----EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADV--GENGVTDQYEIVAGNVDNKFRLVTTANPSG-DTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQ-------VNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITY----YLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLE 438          

HSP 18 Score: 84.3445 bits (207), Expect = 6.426e-16
Identity = 107/391 (27.37%), Postives = 161/391 (41.18%), Query Frame = 2
Query:  425 CNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGV--PPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDT-GENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQ-VKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTL-LTTINVTDLD 1576
             N+ + +  +N+  P F       ++SE   + +      A D DS +     Y    +S  + FRI+    NTG I     V   LDRE  +   LTV+A + G      T    VII I D ND    I+     +I E   V   +  ++A DKD   +N   S+ +   N++     F+ID  +G I+ A ++D +   +     L+I   D G P Q  S AT+ I + DVND  P       F+ +     I EN  +   +  +   D D   NG      LIG +    L         D+    + +    D E   +   II   DSG PKQ +Q  L + V+D NDN  T     I + L   + P  + L  +   D+D
Sbjct: 3423 ANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDT---NTGLIY----VARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQS---FKIDVQTGEISTASRLDREETSTY---NLVIGAIDTGLPPQTGS-ATVHIELEDVNDNGPT------FTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLS-------VDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLADVRPNDID 3786          
BLAST of Protocadherin 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 239.58 bits (610), Expect = 8.925e-64
Identity = 205/706 (29.04%), Postives = 326/706 (46.18%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTG----KIIPQLRVKSR---------LDREEISEHQLTVIASD---AGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLV---DHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG-RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNS---FTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGD-PYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            + + D NDHSPTF +++   +I E  T+ S      A D D  K          A   + IE   D  G    + +P  R+ SR         LDRE    + L V A+D   A    +T + +V +++LD+NDN P   E+   + + ED      D+ +  I A D D G N  I + +   N Q+    F ID MSG ++L + +DY+S++S     L+I  QD G P + S+T  L + V+D ND  P       F     +  +LEN+     +  V  +D+D G N ++   +   +D+F L         D     + T   LD E++  +   +   D G P ++A   +++ V DVNDN P F     E  + E++PPGT +TT+  TD D    E+ R  Y I+    R  F +    GRG +  A+    SL  + +EK     F LTV+ T+           S ++TV ++I D N+ APIF    Y  ++ E+ P    V ++ ATD D G N +I+Y +++ S +   S   F+++  TG + T + +DRE  S +   V A+D G+P      +V + V+D+NDN P F  P  +   +  ++     T +++V A D D     +I Y +   D   G F ID   G I   K         + L     D   P  S+ + + +++E+
Sbjct:  452 VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK---------NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVRSY---RLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAP------RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-------AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD----EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQ----SL-DYKQEK----RFLLTVAATD-------SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---GTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 196.823 bits (499), Expect = 2.061e-50
Identity = 189/697 (27.12%), Postives = 314/697 (45.05%), Query Frame = 2
Query:  449 DINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSK--FSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKE----PNVQND--MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQD--HGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIG--YEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL-FRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI--QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGL-----FQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            ++ + SP F     V ++ E +   +      A DP+ S   +S+       +   F+++     TG +       + LDRE +  H   V+A+D   PP++G+  + + +LD ND++P  E +    SI+E   V   +I + A D+D G+N  I + ++       +  D  M  FRID  SGVI+    +D ++  S     L++T  D    + ++ ++TA++ + VLD ND  P  S    ++ Q   PE       +  VA++   DAD G N  ++  +IG   +  FS++++  +          V+ VK LD E    YRL+IR  D G P ++   +L+V VID NDN+P F  S+ +  + EN P G  +  +   D DE    N    Y+ISE        ++P  G          + ++   DRE+     F++   D             S+SS+V++ ++D NDN P F+   YE  + E++P    V  + ATD D+  + ++ Y+I   ++  + + T     G +T    +D ++   F   V A D G  GR   A V + ++D N+  P F     EN   SAS+   +   T ++ V+A D D     QITYS+      GL     F I+   G I             Y L +   D  +PS S    + + V
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD---SRTGVVT----TSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSY---HLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQ--VPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDE--GANAEITYSISERDDNFPLAVDPRTG---------WVQTIKPLDREEQGRFAFQVVAKDGG-------VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF-----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 161.77 bits (408), Expect = 1.458e-39
Identity = 187/751 (24.90%), Postives = 313/751 (41.68%), Query Frame = 2
Query:  194 STVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMS--GVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDL-------IGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTIS----ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGT----LTTKSKIDREKI-SIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDP-----KFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKK 2374
            + + +  +  NTQ  S   I+  +G ++L +P+D +S                  +   + V++  D   +P       +L+ + D ND++P F++ +   ++ E   +        A+D D    +   Y   E    F +      TG +    +    LDREE       V+A D GVPPK+ S +V+I + D NDN P    +    ++ ED      +  + A D D  E+  + +   E    N    F I   +  G+IT+A+ +DY   +   +  L +   D G     S TAT+ I + D N+  P+      F   P    + E+      V  V+  D+D G+N Q+   L       +G  D FS+         +     IVT   LD E  S Y L +   D G+P  +   ++ + V DVNDN+P F     +  + E+   GT +  +  +D D     NGR  Y +S    E G   F ++P  G          I +    DRE ++   F LT    ++ S   +         V + ++D ND+ P F+  +    + E  P    VG + A D D+G N  + Y I     D  N+F+L    G+    L T +++D E     FE  V+A     P   + A++ + V+D+NDN P     + I+    +H  S  I         ++ A D D + K  + Y I  G+   L +++S+ GG+  + +
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYES------------------VRSYRLVIRAQDG-GSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWV----QTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHY---EITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK---RFLLTVAATDSGG---RSDTATVHINITDANNFAPI------FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSI---------NPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDV--GLNGRIKYLLSDRDIEDGS--FVIDPTSG---------TIRTNKGLDRESVAV--FHLTAIAVDKGSPPLSSTVE-----VQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIG--------RIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVLSPQ 1280          

HSP 4 Score: 161.384 bits (407), Expect = 2.120e-39
Identity = 175/702 (24.93%), Postives = 301/702 (42.88%), Query Frame = 2
Query:  428 NVLIEITDINDHSPTFFSDKVVINISE---AETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYK-------IVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLR-----IYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQN-SFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            +V +++ D ND+ P F      + + E     T D+      A D D    +  RY          F I+    +   + P       LD E +  ++L + A D G P ++ +  +++ ++D NDNAP     Q    S+ E+  V ++IIR++A D D G N  I++ + E   ++D     +D  +G +   + +D +      +    +  +D G P + S+++++ I V DVND  P       F+ +     + E+      V  V   D D              ED      I   N + +F          I     LD ++E  + L +  +DSG    TA   + + + D N+ +P F  +     + E+ P GT +  ++ TD D     N +  Y+++E        E + G G  +   +      I +    DRE  S     +T  D    S+S T         V + + D NDNAP F    Y+ +I E+      V  + A+D D G NG+I Y + D   D+++ SF +D  +GT+ T   +DRE +++F     A D+G P   S   V +++ D+ND+ P F    I   T+     S   +++ +++A D DE     + YSI GGD       DSN    +F+   +P   R+   L+ +T+ D+ S   +  + V+ 
Sbjct:  566 SVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKP-------LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE-SVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQTIKPLDREEQG---RFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPA------FNPKYYEANVGEDQPPGTPVTTVTATDPD--------------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV--GVNAQITYSLNE--------ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTD-------VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD--RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGD-------DSN----AFSLVTRPGSERAQ--LLTMTELDYESTRKRFELVVRA 1195          

HSP 5 Score: 133.265 bits (334), Expect = 7.728e-31
Identity = 150/554 (27.08%), Postives = 234/554 (42.24%), Query Frame = 2
Query:  407 PLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQN--DMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKID 2056
            P      +V+I + D+ND+ P F       N+ E +   +P     A DPD    S   Y     +   R   T  N   +I    +   LD ++     LTV A+D+G    T +++  I I D N+ API E      S+ ED  V   ++ + A D D G N  I++ L E ++      + F I+  +G I     +D ++        L +T +D G P  LS T  + I V DVND  P       F     +  ILE+      V  V   D D GLNG++K  L     D  +E+  +  V D     I T   LD E  +++ L     D G P  ++  E+ +++ DVND+ PTF   +I L + EN P G+++  I+  D DE    N    Y+ I       F L    G     S + ++ ++T  D E      FEL V   +    +           + + + D NDNAP+    Q  F    +   +  +G + A D D  D  K+ Y+I   S +  N   L+ ++G L    +++
Sbjct:  772 PPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFAITSQNGRGLI---TIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGY---LLTVTAKDGGNPS-LSDTTDVEIGVTDVNDNAPA------FKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL----SDRDIEDGSF--VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDE--GVNAVVHYSIIGGDDSNAFSLVTRPG-----SERAQLLTMTELDYESTRK-RFELVVRAASPPLRNDAH--------IEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRI--LSGNNANLLRLNSSSGGLVLSPQLN 1282          

HSP 6 Score: 57.7658 bits (138), Expect = 8.589e-8
Identity = 65/256 (25.39%), Postives = 103/256 (40.23%), Query Frame = 2
Query:  245 IVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID 1003
             VI+ ++G I   + +DR+S+                 +  L A+   +D    PL+     V I + D+ND  PTF SDK+ + + E   + S      AHDPD    ++  Y     + S  F +       G    QL   + LD E   +    V+   A  PP     ++ I + D NDNAP++     I +   D      I RI A D D  +              N+ N  R++  SG + L+ Q++
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVA----------------VFHLTAIA--VDKGSPPLSST-VEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL---VTRPGSERAQLLTMTELDYESTRKRFELVVR--AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRIL-----SGNNANLLRLNSSSGGLVLSPQLN 1282          
BLAST of Protocadherin 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 239.58 bits (610), Expect = 8.925e-64
Identity = 205/706 (29.04%), Postives = 326/706 (46.18%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTG----KIIPQLRVKSR---------LDREEISEHQLTVIASD---AGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLV---DHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG-RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNS---FTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGD-PYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            + + D NDHSPTF +++   +I E  T+ S      A D D  K          A   + IE   D  G    + +P  R+ SR         LDRE    + L V A+D   A    +T + +V +++LD+NDN P   E+   + + ED      D+ +  I A D D G N  I + +   N Q+    F ID MSG ++L + +DY+S++S     L+I  QD G P + S+T  L + V+D ND  P       F     +  +LEN+     +  V  +D+D G N ++   +   +D+F L         D     + T   LD E++  +   +   D G P ++A   +++ V DVNDN P F     E  + E++PPGT +TT+  TD D    E+ R  Y I+    R  F +    GRG +  A+    SL  + +EK     F LTV+ T+           S ++TV ++I D N+ APIF    Y  ++ E+ P    V ++ ATD D G N +I+Y +++ S +   S   F+++  TG + T + +DRE  S +   V A+D G+P      +V + V+D+NDN P F  P  +   +  ++     T +++V A D D     +I Y +   D   G F ID   G I   K         + L     D   P  S+ + + +++E+
Sbjct:  452 VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK---------NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVRSY---RLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAP------RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-------AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD----EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQ----SL-DYKQEK----RFLLTVAATD-------SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---GTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 196.823 bits (499), Expect = 2.061e-50
Identity = 189/697 (27.12%), Postives = 314/697 (45.05%), Query Frame = 2
Query:  449 DINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSK--FSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKE----PNVQND--MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQD--HGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIG--YEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL-FRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI--QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGL-----FQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            ++ + SP F     V ++ E +   +      A DP+ S   +S+       +   F+++     TG +       + LDRE +  H   V+A+D   PP++G+  + + +LD ND++P  E +    SI+E   V   +I + A D+D G+N  I + ++       +  D  M  FRID  SGVI+    +D ++  S     L++T  D    + ++ ++TA++ + VLD ND  P  S    ++ Q   PE       +  VA++   DAD G N  ++  +IG   +  FS++++  +          V+ VK LD E    YRL+IR  D G P ++   +L+V VID NDN+P F  S+ +  + EN P G  +  +   D DE    N    Y+ISE        ++P  G          + ++   DRE+     F++   D             S+SS+V++ ++D NDN P F+   YE  + E++P    V  + ATD D+  + ++ Y+I   ++  + + T     G +T    +D ++   F   V A D G  GR   A V + ++D N+  P F     EN   SAS+   +   T ++ V+A D D     QITYS+      GL     F I+   G I             Y L +   D  +PS S    + + V
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD---SRTGVVT----TSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSY---HLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQ--VPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDE--GANAEITYSISERDDNFPLAVDPRTG---------WVQTIKPLDREEQGRFAFQVVAKDGG-------VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF-----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 161.77 bits (408), Expect = 1.458e-39
Identity = 187/751 (24.90%), Postives = 313/751 (41.68%), Query Frame = 2
Query:  194 STVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMS--GVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDL-------IGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTIS----ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGT----LTTKSKIDREKI-SIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDP-----KFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKK 2374
            + + +  +  NTQ  S   I+  +G ++L +P+D +S                  +   + V++  D   +P       +L+ + D ND++P F++ +   ++ E   +        A+D D    +   Y   E    F +      TG +    +    LDREE       V+A D GVPPK+ S +V+I + D NDN P    +    ++ ED      +  + A D D  E+  + +   E    N    F I   +  G+IT+A+ +DY   +   +  L +   D G     S TAT+ I + D N+  P+      F   P    + E+      V  V+  D+D G+N Q+   L       +G  D FS+         +     IVT   LD E  S Y L +   D G+P  +   ++ + V DVNDN+P F     +  + E+   GT +  +  +D D     NGR  Y +S    E G   F ++P  G          I +    DRE ++   F LT    ++ S   +         V + ++D ND+ P F+  +    + E  P    VG + A D D+G N  + Y I     D  N+F+L    G+    L T +++D E     FE  V+A     P   + A++ + V+D+NDN P     + I+    +H  S  I         ++ A D D + K  + Y I  G+   L +++S+ GG+  + +
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYES------------------VRSYRLVIRAQDG-GSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWV----QTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHY---EITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK---RFLLTVAATDSGG---RSDTATVHINITDANNFAPI------FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSI---------NPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDV--GLNGRIKYLLSDRDIEDGS--FVIDPTSG---------TIRTNKGLDRESVAV--FHLTAIAVDKGSPPLSSTVE-----VQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIG--------RIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVLSPQ 1280          

HSP 4 Score: 161.384 bits (407), Expect = 2.120e-39
Identity = 175/702 (24.93%), Postives = 301/702 (42.88%), Query Frame = 2
Query:  428 NVLIEITDINDHSPTFFSDKVVINISE---AETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYK-------IVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLR-----IYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQN-SFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            +V +++ D ND+ P F      + + E     T D+      A D D    +  RY          F I+    +   + P       LD E +  ++L + A D G P ++ +  +++ ++D NDNAP     Q    S+ E+  V ++IIR++A D D G N  I++ + E   ++D     +D  +G +   + +D +      +    +  +D G P + S+++++ I V DVND  P       F+ +     + E+      V  V   D D              ED      I   N + +F          I     LD ++E  + L +  +DSG    TA   + + + D N+ +P F  +     + E+ P GT +  ++ TD D     N +  Y+++E        E + G G  +   +      I +    DRE  S     +T  D    S+S T         V + + D NDNAP F    Y+ +I E+      V  + A+D D G NG+I Y + D   D+++ SF +D  +GT+ T   +DRE +++F     A D+G P   S   V +++ D+ND+ P F    I   T+     S   +++ +++A D DE     + YSI GGD       DSN    +F+   +P   R+   L+ +T+ D+ S   +  + V+ 
Sbjct:  566 SVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKP-------LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE-SVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQTIKPLDREEQG---RFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPA------FNPKYYEANVGEDQPPGTPVTTVTATDPD--------------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV--GVNAQITYSLNE--------ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTD-------VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD--RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGD-------DSN----AFSLVTRPGSERAQ--LLTMTELDYESTRKRFELVVRA 1195          

HSP 5 Score: 133.265 bits (334), Expect = 7.728e-31
Identity = 150/554 (27.08%), Postives = 234/554 (42.24%), Query Frame = 2
Query:  407 PLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQN--DMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKID 2056
            P      +V+I + D+ND+ P F       N+ E +   +P     A DPD    S   Y     +   R   T  N   +I    +   LD ++     LTV A+D+G    T +++  I I D N+ API E      S+ ED  V   ++ + A D D G N  I++ L E ++      + F I+  +G I     +D ++        L +T +D G P  LS T  + I V DVND  P       F     +  ILE+      V  V   D D GLNG++K  L     D  +E+  +  V D     I T   LD E  +++ L     D G P  ++  E+ +++ DVND+ PTF   +I L + EN P G+++  I+  D DE    N    Y+ I       F L    G     S + ++ ++T  D E      FEL V   +    +           + + + D NDNAP+    Q  F    +   +  +G + A D D  D  K+ Y+I   S +  N   L+ ++G L    +++
Sbjct:  772 PPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFAITSQNGRGLI---TIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGY---LLTVTAKDGGNPS-LSDTTDVEIGVTDVNDNAPA------FKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL----SDRDIEDGSF--VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDE--GVNAVVHYSIIGGDDSNAFSLVTRPG-----SERAQLLTMTELDYESTRK-RFELVVRAASPPLRNDAH--------IEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRI--LSGNNANLLRLNSSSGGLVLSPQLN 1282          

HSP 6 Score: 57.7658 bits (138), Expect = 8.589e-8
Identity = 65/256 (25.39%), Postives = 103/256 (40.23%), Query Frame = 2
Query:  245 IVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID 1003
             VI+ ++G I   + +DR+S+                 +  L A+   +D    PL+     V I + D+ND  PTF SDK+ + + E   + S      AHDPD    ++  Y     + S  F +       G    QL   + LD E   +    V+   A  PP     ++ I + D NDNAP++     I +   D      I RI A D D  +              N+ N  R++  SG + L+ Q++
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVA----------------VFHLTAIA--VDKGSPPLSST-VEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL---VTRPGSERAQLLTMTELDYESTRKRFELVVR--AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRIL-----SGNNANLLRLNSSSGGLVLSPQLN 1282          
BLAST of Protocadherin 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 239.58 bits (610), Expect = 9.249e-64
Identity = 205/706 (29.04%), Postives = 326/706 (46.18%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTG----KIIPQLRVKSR---------LDREEISEHQLTVIASD---AGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLV---DHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG-RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNS---FTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGD-PYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            + + D NDHSPTF +++   +I E  T+ S      A D D  K          A   + IE   D  G    + +P  R+ SR         LDRE    + L V A+D   A    +T + +V +++LD+NDN P   E+   + + ED      D+ +  I A D D G N  I + +   N Q+    F ID MSG ++L + +DY+S++S     L+I  QD G P + S+T  L + V+D ND  P       F     +  +LEN+     +  V  +D+D G N ++   +   +D+F L         D     + T   LD E++  +   +   D G P ++A   +++ V DVNDN P F     E  + E++PPGT +TT+  TD D    E+ R  Y I+    R  F +    GRG +  A+    SL  + +EK     F LTV+ T+           S ++TV ++I D N+ APIF    Y  ++ E+ P    V ++ ATD D G N +I+Y +++ S +   S   F+++  TG + T + +DRE  S +   V A+D G+P      +V + V+D+NDN P F  P  +   +  ++     T +++V A D D     +I Y +   D   G F ID   G I   K         + L     D   P  S+ + + +++E+
Sbjct:  452 VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK---------NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVRSY---RLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAP------RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-------AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD----EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQ----SL-DYKQEK----RFLLTVAATD-------SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---GTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 196.823 bits (499), Expect = 1.975e-50
Identity = 189/697 (27.12%), Postives = 314/697 (45.05%), Query Frame = 2
Query:  449 DINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSK--FSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKE----PNVQND--MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQD--HGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIG--YEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL-FRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI--QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGL-----FQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            ++ + SP F     V ++ E +   +      A DP+ S   +S+       +   F+++     TG +       + LDRE +  H   V+A+D   PP++G+  + + +LD ND++P  E +    SI+E   V   +I + A D+D G+N  I + ++       +  D  M  FRID  SGVI+    +D ++  S     L++T  D    + ++ ++TA++ + VLD ND  P  S    ++ Q   PE       +  VA++   DAD G N  ++  +IG   +  FS++++  +          V+ VK LD E    YRL+IR  D G P ++   +L+V VID NDN+P F  S+ +  + EN P G  +  +   D DE    N    Y+ISE        ++P  G          + ++   DRE+     F++   D             S+SS+V++ ++D NDN P F+   YE  + E++P    V  + ATD D+  + ++ Y+I   ++  + + T     G +T    +D ++   F   V A D G  GR   A V + ++D N+  P F     EN   SAS+   +   T ++ V+A D D     QITYS+      GL     F I+   G I             Y L +   D  +PS S    + + V
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD---SRTGVVT----TSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSY---HLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQ--VPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDE--GANAEITYSISERDDNFPLAVDPRTG---------WVQTIKPLDREEQGRFAFQVVAKDGG-------VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF-----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 161.77 bits (408), Expect = 1.422e-39
Identity = 187/751 (24.90%), Postives = 313/751 (41.68%), Query Frame = 2
Query:  194 STVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMS--GVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDL-------IGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTIS----ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGT----LTTKSKIDREKI-SIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDP-----KFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKK 2374
            + + +  +  NTQ  S   I+  +G ++L +P+D +S                  +   + V++  D   +P       +L+ + D ND++P F++ +   ++ E   +        A+D D    +   Y   E    F +      TG +    +    LDREE       V+A D GVPPK+ S +V+I + D NDN P    +    ++ ED      +  + A D D  E+  + +   E    N    F I   +  G+IT+A+ +DY   +   +  L +   D G     S TAT+ I + D N+  P+      F   P    + E+      V  V+  D+D G+N Q+   L       +G  D FS+         +     IVT   LD E  S Y L +   D G+P  +   ++ + V DVNDN+P F     +  + E+   GT +  +  +D D     NGR  Y +S    E G   F ++P  G          I +    DRE ++   F LT    ++ S   +         V + ++D ND+ P F+  +    + E  P    VG + A D D+G N  + Y I     D  N+F+L    G+    L T +++D E     FE  V+A     P   + A++ + V+D+NDN P     + I+    +H  S  I         ++ A D D + K  + Y I  G+   L +++S+ GG+  + +
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYES------------------VRSYRLVIRAQDG-GSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWV----QTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHY---EITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK---RFLLTVAATDSGG---RSDTATVHINITDANNFAPI------FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSI---------NPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDV--GLNGRIKYLLSDRDIEDGS--FVIDPTSG---------TIRTNKGLDRESVAV--FHLTAIAVDKGSPPLSSTVE-----VQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIG--------RIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVLSPQ 1280          

HSP 4 Score: 161.384 bits (407), Expect = 2.121e-39
Identity = 175/702 (24.93%), Postives = 301/702 (42.88%), Query Frame = 2
Query:  428 NVLIEITDINDHSPTFFSDKVVINISE---AETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYK-------IVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLR-----IYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQN-SFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            +V +++ D ND+ P F      + + E     T D+      A D D    +  RY          F I+    +   + P       LD E +  ++L + A D G P ++ +  +++ ++D NDNAP     Q    S+ E+  V ++IIR++A D D G N  I++ + E   ++D     +D  +G +   + +D +      +    +  +D G P + S+++++ I V DVND  P       F+ +     + E+      V  V   D D              ED      I   N + +F          I     LD ++E  + L +  +DSG    TA   + + + D N+ +P F  +     + E+ P GT +  ++ TD D     N +  Y+++E        E + G G  +   +      I +    DRE  S     +T  D    S+S T         V + + D NDNAP F    Y+ +I E+      V  + A+D D G NG+I Y + D   D+++ SF +D  +GT+ T   +DRE +++F     A D+G P   S   V +++ D+ND+ P F    I   T+     S   +++ +++A D DE     + YSI GGD       DSN    +F+   +P   R+   L+ +T+ D+ S   +  + V+ 
Sbjct:  566 SVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKP-------LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE-SVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQTIKPLDREEQG---RFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPA------FNPKYYEANVGEDQPPGTPVTTVTATDPD--------------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV--GVNAQITYSLNE--------ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTD-------VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD--RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGD-------DSN----AFSLVTRPGSERAQ--LLTMTELDYESTRKRFELVVRA 1195          

HSP 5 Score: 133.265 bits (334), Expect = 7.996e-31
Identity = 150/554 (27.08%), Postives = 234/554 (42.24%), Query Frame = 2
Query:  407 PLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQN--DMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKID 2056
            P      +V+I + D+ND+ P F       N+ E +   +P     A DPD    S   Y     +   R   T  N   +I    +   LD ++     LTV A+D+G    T +++  I I D N+ API E      S+ ED  V   ++ + A D D G N  I++ L E ++      + F I+  +G I     +D ++        L +T +D G P  LS T  + I V DVND  P       F     +  ILE+      V  V   D D GLNG++K  L     D  +E+  +  V D     I T   LD E  +++ L     D G P  ++  E+ +++ DVND+ PTF   +I L + EN P G+++  I+  D DE    N    Y+ I       F L    G     S + ++ ++T  D E      FEL V   +    +           + + + D NDNAP+    Q  F    +   +  +G + A D D  D  K+ Y+I   S +  N   L+ ++G L    +++
Sbjct:  772 PPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFAITSQNGRGLI---TIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGY---LLTVTAKDGGNPS-LSDTTDVEIGVTDVNDNAPA------FKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL----SDRDIEDGSF--VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDE--GVNAVVHYSIIGGDDSNAFSLVTRPG-----SERAQLLTMTELDYESTRK-RFELVVRAASPPLRNDAH--------IEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRI--LSGNNANLLRLNSSSGGLVLSPQLN 1282          

HSP 6 Score: 57.7658 bits (138), Expect = 8.810e-8
Identity = 65/256 (25.39%), Postives = 103/256 (40.23%), Query Frame = 2
Query:  245 IVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID 1003
             VI+ ++G I   + +DR+S+                 +  L A+   +D    PL+     V I + D+ND  PTF SDK+ + + E   + S      AHDPD    ++  Y     + S  F +       G    QL   + LD E   +    V+   A  PP     ++ I + D NDNAP++     I +   D      I RI A D D  +              N+ N  R++  SG + L+ Q++
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVA----------------VFHLTAIA--VDKGSPPLSST-VEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL---VTRPGSERAQLLTMTELDYESTRKRFELVVR--AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRIL-----SGNNANLLRLNSSSGGLVLSPQLN 1282          
BLAST of Protocadherin 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 239.58 bits (610), Expect = 9.249e-64
Identity = 205/706 (29.04%), Postives = 326/706 (46.18%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTG----KIIPQLRVKSR---------LDREEISEHQLTVIASD---AGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLV---DHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG-RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNS---FTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGD-PYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            + + D NDHSPTF +++   +I E  T+ S      A D D  K          A   + IE   D  G    + +P  R+ SR         LDRE    + L V A+D   A    +T + +V +++LD+NDN P   E+   + + ED      D+ +  I A D D G N  I + +   N Q+    F ID MSG ++L + +DY+S++S     L+I  QD G P + S+T  L + V+D ND  P       F     +  +LEN+     +  V  +D+D G N ++   +   +D+F L         D     + T   LD E++  +   +   D G P ++A   +++ V DVNDN P F     E  + E++PPGT +TT+  TD D    E+ R  Y I+    R  F +    GRG +  A+    SL  + +EK     F LTV+ T+           S ++TV ++I D N+ APIF    Y  ++ E+ P    V ++ ATD D G N +I+Y +++ S +   S   F+++  TG + T + +DRE  S +   V A+D G+P      +V + V+D+NDN P F  P  +   +  ++     T +++V A D D     +I Y +   D   G F ID   G I   K         + L     D   P  S+ + + +++E+
Sbjct:  452 VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK---------NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVRSY---RLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAP------RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-------AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD----EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQ----SL-DYKQEK----RFLLTVAATD-------SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---GTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 196.823 bits (499), Expect = 1.975e-50
Identity = 189/697 (27.12%), Postives = 314/697 (45.05%), Query Frame = 2
Query:  449 DINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSK--FSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKE----PNVQND--MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQD--HGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIG--YEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL-FRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI--QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGL-----FQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            ++ + SP F     V ++ E +   +      A DP+ S   +S+       +   F+++     TG +       + LDRE +  H   V+A+D   PP++G+  + + +LD ND++P  E +    SI+E   V   +I + A D+D G+N  I + ++       +  D  M  FRID  SGVI+    +D ++  S     L++T  D    + ++ ++TA++ + VLD ND  P  S    ++ Q   PE       +  VA++   DAD G N  ++  +IG   +  FS++++  +          V+ VK LD E    YRL+IR  D G P ++   +L+V VID NDN+P F  S+ +  + EN P G  +  +   D DE    N    Y+ISE        ++P  G          + ++   DRE+     F++   D             S+SS+V++ ++D NDN P F+   YE  + E++P    V  + ATD D+  + ++ Y+I   ++  + + T     G +T    +D ++   F   V A D G  GR   A V + ++D N+  P F     EN   SAS+   +   T ++ V+A D D     QITYS+      GL     F I+   G I             Y L +   D  +PS S    + + V
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD---SRTGVVT----TSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSY---HLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQ--VPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDE--GANAEITYSISERDDNFPLAVDPRTG---------WVQTIKPLDREEQGRFAFQVVAKDGG-------VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF-----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 161.77 bits (408), Expect = 1.422e-39
Identity = 187/751 (24.90%), Postives = 313/751 (41.68%), Query Frame = 2
Query:  194 STVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMS--GVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDL-------IGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTIS----ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGT----LTTKSKIDREKI-SIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDP-----KFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKK 2374
            + + +  +  NTQ  S   I+  +G ++L +P+D +S                  +   + V++  D   +P       +L+ + D ND++P F++ +   ++ E   +        A+D D    +   Y   E    F +      TG +    +    LDREE       V+A D GVPPK+ S +V+I + D NDN P    +    ++ ED      +  + A D D  E+  + +   E    N    F I   +  G+IT+A+ +DY   +   +  L +   D G     S TAT+ I + D N+  P+      F   P    + E+      V  V+  D+D G+N Q+   L       +G  D FS+         +     IVT   LD E  S Y L +   D G+P  +   ++ + V DVNDN+P F     +  + E+   GT +  +  +D D     NGR  Y +S    E G   F ++P  G          I +    DRE ++   F LT    ++ S   +         V + ++D ND+ P F+  +    + E  P    VG + A D D+G N  + Y I     D  N+F+L    G+    L T +++D E     FE  V+A     P   + A++ + V+D+NDN P     + I+    +H  S  I         ++ A D D + K  + Y I  G+   L +++S+ GG+  + +
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYES------------------VRSYRLVIRAQDG-GSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWV----QTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHY---EITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK---RFLLTVAATDSGG---RSDTATVHINITDANNFAPI------FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSI---------NPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDV--GLNGRIKYLLSDRDIEDGS--FVIDPTSG---------TIRTNKGLDRESVAV--FHLTAIAVDKGSPPLSSTVE-----VQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIG--------RIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVLSPQ 1280          

HSP 4 Score: 161.384 bits (407), Expect = 2.121e-39
Identity = 175/702 (24.93%), Postives = 301/702 (42.88%), Query Frame = 2
Query:  428 NVLIEITDINDHSPTFFSDKVVINISE---AETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYK-------IVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLR-----IYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQN-SFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            +V +++ D ND+ P F      + + E     T D+      A D D    +  RY          F I+    +   + P       LD E +  ++L + A D G P ++ +  +++ ++D NDNAP     Q    S+ E+  V ++IIR++A D D G N  I++ + E   ++D     +D  +G +   + +D +      +    +  +D G P + S+++++ I V DVND  P       F+ +     + E+      V  V   D D              ED      I   N + +F          I     LD ++E  + L +  +DSG    TA   + + + D N+ +P F  +     + E+ P GT +  ++ TD D     N +  Y+++E        E + G G  +   +      I +    DRE  S     +T  D    S+S T         V + + D NDNAP F    Y+ +I E+      V  + A+D D G NG+I Y + D   D+++ SF +D  +GT+ T   +DRE +++F     A D+G P   S   V +++ D+ND+ P F    I   T+     S   +++ +++A D DE     + YSI GGD       DSN    +F+   +P   R+   L+ +T+ D+ S   +  + V+ 
Sbjct:  566 SVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKP-------LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE-SVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQTIKPLDREEQG---RFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPA------FNPKYYEANVGEDQPPGTPVTTVTATDPD--------------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV--GVNAQITYSLNE--------ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTD-------VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD--RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGD-------DSN----AFSLVTRPGSERAQ--LLTMTELDYESTRKRFELVVRA 1195          

HSP 5 Score: 133.265 bits (334), Expect = 7.996e-31
Identity = 150/554 (27.08%), Postives = 234/554 (42.24%), Query Frame = 2
Query:  407 PLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQN--DMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKID 2056
            P      +V+I + D+ND+ P F       N+ E +   +P     A DPD    S   Y     +   R   T  N   +I    +   LD ++     LTV A+D+G    T +++  I I D N+ API E      S+ ED  V   ++ + A D D G N  I++ L E ++      + F I+  +G I     +D ++        L +T +D G P  LS T  + I V DVND  P       F     +  ILE+      V  V   D D GLNG++K  L     D  +E+  +  V D     I T   LD E  +++ L     D G P  ++  E+ +++ DVND+ PTF   +I L + EN P G+++  I+  D DE    N    Y+ I       F L    G     S + ++ ++T  D E      FEL V   +    +           + + + D NDNAP+    Q  F    +   +  +G + A D D  D  K+ Y+I   S +  N   L+ ++G L    +++
Sbjct:  772 PPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFAITSQNGRGLI---TIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGY---LLTVTAKDGGNPS-LSDTTDVEIGVTDVNDNAPA------FKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL----SDRDIEDGSF--VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDE--GVNAVVHYSIIGGDDSNAFSLVTRPG-----SERAQLLTMTELDYESTRK-RFELVVRAASPPLRNDAH--------IEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRI--LSGNNANLLRLNSSSGGLVLSPQLN 1282          

HSP 6 Score: 57.7658 bits (138), Expect = 8.810e-8
Identity = 65/256 (25.39%), Postives = 103/256 (40.23%), Query Frame = 2
Query:  245 IVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID 1003
             VI+ ++G I   + +DR+S+                 +  L A+   +D    PL+     V I + D+ND  PTF SDK+ + + E   + S      AHDPD    ++  Y     + S  F +       G    QL   + LD E   +    V+   A  PP     ++ I + D NDNAP++     I +   D      I RI A D D  +              N+ N  R++  SG + L+ Q++
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVA----------------VFHLTAIA--VDKGSPPLSST-VEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL---VTRPGSERAQLLTMTELDYESTRKRFELVVR--AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRIL-----SGNNANLLRLNSSSGGLVLSPQLN 1282          
BLAST of Protocadherin 1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 303.908 bits (777), Expect = 1.281e-86
Identity = 239/806 (29.65%), Postives = 381/806 (47.27%), Query Frame = 2
Query:   95 GLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSM--CE-KMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            G+ +++ EE P +  IGS+            QG     H          ++ ++  TG I T   PIDR+++  C  K K C +E   S         V  L+ N    L +      IE+ DIND++P F S  + +++ E   + +   +P+A D D+ +  +  Y      EA   F ++  +D  G+ +PQL V   LDRE    + LT+ A D G PP+  S  + + I D NDNAP  E+ S    + E++ + H +++++A D D G N  I + L +  +       RID+ SG+I +   +D + I +L   +  +  +D G P   SS   ++I V D ND  P + I  I L +       I E++     VA V V D D G N  V C + G +  F L     ++V ++ +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D NDNSP F  +  E+E +E   PG  +  +  +D D        +      S R LF ++P  G          + + +  DRE     EF +T +D           S   ++TV++ + DRNDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++    DV   F +   TGT+ +    DREK S + F++KA D G P R S   V + V D NDN P    P+  +  +  S  ++ ++++  V A D D     ++ YSI GG+P+ LF I  + G I+  K+     +  + L+IKV+D   PSR A   +H+ V E+
Sbjct:   24 GILYRVHEEQPPSTLIGSLAAD---------QGLPDTGHLYKLEVGA-PYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVS---------VTDLIQNQSPRLIEG----RIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDR-GEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQ-AIDPVPKLLRIDRSSGIIYVKGPLDREEINNL---KFYVVARDKG-PSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG-DVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSG---------EVRARSPLDREHKDRYEFRVTAADKG-------VPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVE---PDV-GKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPS-NSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNET 778          
BLAST of Protocadherin 1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 303.523 bits (776), Expect = 1.228e-85
Identity = 239/806 (29.65%), Postives = 381/806 (47.27%), Query Frame = 2
Query:   95 GLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSM--CE-KMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            G+ +++ EE P +  IGS+            QG     H          ++ ++  TG I T   PIDR+++  C  K K C +E   S         V  L+ N    L +      IE+ DIND++P F S  + +++ E   + +   +P+A D D+ +  +  Y      EA   F ++  +D  G+ +PQL V   LDRE    + LT+ A D G PP+  S  + + I D NDNAP  E+ S    + E++ + H +++++A D D G N  I + L +  +       RID+ SG+I +   +D + I +L   +  +  +D G P   SS   ++I V D ND  P + I  I L +       I E++     VA V V D D G N  V C + G +  F L     ++V ++ +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D NDNSP F  +  E+E +E   PG  +  +  +D D        +      S R LF ++P  G          + + +  DRE     EF +T +D           S   ++TV++ + DRNDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++    DV   F +   TGT+ +    DREK S + F++KA D G P R S   V + V D NDN P    P+  +  +  S  ++ ++++  V A D D     ++ YSI GG+P+ LF I  + G I+  K+     +  + L+IKV+D   PSR A   +H+ V E+
Sbjct:   24 GILYRVHEEQPPSTLIGSLAAD---------QGLPDTGHLYKLEVGA-PYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVS---------VTDLIQNQSPRLIEG----RIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDR-GEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQ-AIDPVPKLLRIDRSSGIIYVKGPLDREEINNL---KFYVVARDKG-PSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG-DVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSG---------EVRARSPLDREHKDRYEFRVTAADKG-------VPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVE---PDV-GKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPS-NSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNET 778          
BLAST of Protocadherin 1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 288.115 bits (736), Expect = 5.818e-81
Identity = 242/830 (29.16%), Postives = 386/830 (46.51%), Query Frame = 2
Query:   20 NSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG--RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            ++ F    L+ + LL      + N  LY ++ EE P N  IGS+            QG     H          ++ ++  TG I T    IDR+S+ +     C  L +   C ++ +  +  L     P   +     IEI D ND++P F S  + ++I E   + +   +P+A D DS    I  Y      EA+  F ++  QD+  K+ PQL V   LDRE    + L +   D G PP+  S  + I I D NDN P  E+      + E++ V H +++++A D D G N  +++ L +P+    M    ID+ +G+I +   +D + I  L   +  +  +D+G P+  SS A +TI V D ND  P I I  I L + +     I E++     VA V V D D G N  V C + G +  F L +        + +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D+NDN+P F  +  E+E  E   PG  +  +  TD D     N    Y+I+       LF + P  G       ++R+  ++  DRE++   +F +  +D           SL  ++TV+V + DRNDN P F    Y F++ E  P    VG++   D D+G+N ++   ++  +      F +   T T+ +    DREK S + F++KA D G P R S   + + V D NDN P    P   ++      ++S  T +  V A D D    +++ ++I GG+P+GLF+I S  G I+ AK+  P     + L++KV D   P R     +H+ V E+
Sbjct:   29 SALFNYAMLVWILLLLCCSANVVNTILY-QVTEEQPPNTLIGSLASD---------QGLPDTGHLYKLEVGA-PYLRVDGKTGDIYTTENSIDRESLKD-----CRNLFEGDPCFLEFEVSITDLMKGTGP---RLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKL-PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPS-SPVMRLLSIDRNTGIIFVKGSVDREEISIL---KFYVQAKDNG-PQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAG-DVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADS--GTNAELTYSITGGSVPEGLFEINPNTG-------EVRV--MSQLDREQLDHYQFLVAAADKG-------VPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNG----KFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSE-GEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 808          
BLAST of Protocadherin 1 vs. Ensembl Zebrafish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 290.812 bits (743), Expect = 7.410e-81
Identity = 243/881 (27.58%), Postives = 404/881 (45.86%), Query Frame = 2
Query:   41 CLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITL-RRPIDRDSMCEKMKLCCVELHQSSECIIQ--------LKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR------------------------------------FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVK------DQFE-----YKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKID--------DFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            C L + L  +      +  L +++ EE PA++ IG++  +  G S   +    V F   S +     F  I+  TG +T   R IDR+ + +     C  +   +EC +         L++ V L D              I +TDIND++P+F S  + +++ E   I + + LP A D D  +  I+RY   + SR                                     F ++      G+  PQL VK  LDRE    ++L +   D G PP++    + + I D NDN+P  E+ +    + E+      ++++ A D+D G N  + +       ++     R+D+ SG +++  +ID + +    Q+   IT +D G+P +   T T+ + V D ND VP++ I  I     +     + EN+  +  VA V V D D G NG V C ++G +  F+L+      +       D FE     Y + T   LD E    Y + I   DSG P  ++   L+V+V+D+ND++PTF +S +E+  +EN  PG  + T+   D D    +N    Y++  S    F ++   G          I +  + DRE     EF +   D           SL  S+TV+V + DRNDNAP F +  + F + E    N  VG++  TD D+G+N ++S  ++        +     Q  F+++ NTGT+ + +  DRE+ S + F+V+A D G P R + A V + V+D NDN P    P  E++T+     S   T++  V+A D D      + Y++ GG+P+ LF+I S+ G I+ A+  +      + L+++V D+  PS  A   +HV + ES
Sbjct:   14 CYLVLILQLLTQLPHADSALRYRVAEEGPADVHIGNVA-SDLGLSTSGIGTGDVTFALESGS----EFFKIDNVTGELTTGSRRIDREKLPQ-----CQMIFDENECFLNFEVSVIGPLQSWVDLFDGR------------IVVTDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELIQDSRDGGSSSRRPANGPTNGNGGDRRRGPETGTGPASRSSVFELQVADTPEGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVSITDVNDNSPRFERAVYEAEMAENAPPGTPVLQVRATDRDVGVNGQVEYVFGA-ATESVRRLLRLDEASGWLSVLHRIDREEVS---QLRFTITARDRGQPPRTDRT-TVVLNVRDENDNVPIVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVG-DVPFTLKPAGETALAPPPATDDAFERNKKKYFLHTSALLDYEATREYSVTIVAVDSGSPSLSSNSSLLVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADS--GKNAEIAYSLDPSVNGAFYIDADNG---------DIRATGALDRELRERYEFRVIARDKG-------TPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLTNSPVGMVTVTDADEGENAELSLFVEHDEEEGGEEGKEGKQEVFSIENNTGTIFSSASFDRERRSTYSFRVRAVDGGEPPRSATATVSLFVTDENDNAPSITSPANESYTLLPPA-SGARTVVRTVSASDGDTGSNADLRYALVGGNPFRLFEIGSSSGVITLAEPLERRHRGLHRLVVRVNDSGMPSLCATALVHVFINES 847          
BLAST of Protocadherin 1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 287.345 bits (734), Expect = 8.320e-81
Identity = 241/822 (29.32%), Postives = 383/822 (46.59%), Query Frame = 2
Query:   44 LLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG--RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            L+ + LL      + N  LY ++ EE P N  IGS+            QG     H          ++ ++  TG I T    IDR+S+ +     C  L +   C ++ +  +  L     P   +     IEI D ND++P F S  + ++I E   + +   +P+A D DS    I  Y      EA+  F ++  QD+  K+ PQL V   LDRE    + L +   D G PP+  S  + I I D NDN P  E+      + E++ V H +++++A D D G N  +++ L +P+    M    ID+ +G+I +   +D + I  L   +  +  +D+G P+  SS A +TI V D ND  P I I  I L + +     I E++     VA V V D D G N  V C + G +  F L +        + +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D+NDN+P F  +  E+E  E   PG  +  +  TD D     N    Y+I+       LF + P  G       ++R+  ++  DRE++   +F +  +D           SL  ++TV+V + DRNDN P F    Y F++ E  P    VG++   D D+G+N ++   ++  +      F +   T T+ +    DREK S + F++KA D G P R S   + + V D NDN P    P   ++      ++S  T +  V A D D    +++ ++I GG+P+GLF+I S  G I+ AK+  P     + L++KV D   P R     +H+ V E+
Sbjct:   16 LVWILLLLCCSANVVNTILY-QVTEEQPPNTLIGSLASD---------QGLPDTGHLYKLEVGA-PYLRVDGKTGDIYTTENSIDRESLKD-----CRNLFEGDPCFLEFEVSITDLMKGTGP---RLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKL-PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPS-SPVMRLLSIDRNTGIIFVKGSVDREEISIL---KFYVQAKDNG-PQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAG-DVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADS--GTNAELTYSITGGSVPEGLFEINPNTG-------EVRV--MSQLDREQLDHYQFLVAAADKG-------VPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNG----KFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSE-GEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 787          
BLAST of Protocadherin 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 293.508 bits (750), Expect = 1.134e-82
Identity = 244/832 (29.33%), Postives = 387/832 (46.51%), Query Frame = 2
Query:   41 CLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQ--------LKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI--SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            C L +F   + + G   K + +++ EE P NI IGS+             G   + H          ++ ++  TG I T    IDR+S+ E     C  L    +C ++        +  V +LLD              IEI DIND++P F S  + ++I E   I    P+P A D DS    ++ Y      EA   F ++  +D   K  PQL V   LDRE+   + LT+   D G P +  S  + I ILD NDNAP  E+++    + E++ + H +++++A D D G N  I + F +  +    + H  +D+ +G+IT+   ID + + +L   +  +  +D G   + + T  +TI + D ND  PVI I    L + Q     I E++     VA V V D D G+N  V C + G +  F L+ +       + +Y + T   LD E    Y + I   DSG+P  ++   L V+V DVNDN+P F +S +E+   EN     L+  ++ TD D     N +  Y+I    S R +F + P       +S ++R+   T  DRE+    +F +   D           SL  +++V++ + DRNDN P F    Y F++ E  P+   VG++   D D+G+N  I   ++  S +    F +   TGT+ +    DRE  S + F++KA D G P R S   V + V D NDN P  + P+  ++    + Q+   T +  V A D D     ++ YSI  G+P+ LFQI  N G ++  K         + L++KVTD   PSR     +H  + E+
Sbjct:   52 CFLWLFF-QLPILGSSTK-VAYRVPEEQPPNILIGSLASD---------YGYPDSKHLYKLELG-HPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQ------------IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQ-PQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLH--LDRSTGLITVQGPIDREDVGTL---KFSVVAKDKGANPKTARTQ-VTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAG-DVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADS--GPNSQLHYSILPDPSARGIFSINP-------DSGQIRVN--TVLDREQREHYDFHVVAVDKG-------IPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINET 823          
BLAST of Protocadherin 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 293.123 bits (749), Expect = 1.715e-82
Identity = 244/832 (29.33%), Postives = 387/832 (46.51%), Query Frame = 2
Query:   41 CLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQ--------LKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI--SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            C L +F   + + G   K + +++ EE P NI IGS+             G   + H          ++ ++  TG I T    IDR+S+ E     C  L    +C ++        +  V +LLD              IEI DIND++P F S  + ++I E   I    P+P A D DS    ++ Y      EA   F ++  +D   K  PQL V   LDRE+   + LT+   D G P +  S  + I ILD NDNAP  E+++    + E++ + H +++++A D D G N  I + F +  +    + H  +D+ +G+IT+   ID + + +L   +  +  +D G   + + T  +TI + D ND  PVI I    L + Q     I E++     VA V V D D G+N  V C + G +  F L+ +       + +Y + T   LD E    Y + I   DSG+P  ++   L V+V DVNDN+P F +S +E+   EN     L+  ++ TD D     N +  Y+I    S R +F + P       +S ++R+   T  DRE+    +F +   D           SL  +++V++ + DRNDN P F    Y F++ E  P+   VG++   D D+G+N  I   ++  S +    F +   TGT+ +    DRE  S + F++KA D G P R S   V + V D NDN P  + P+  ++    + Q+   T +  V A D D     ++ YSI  G+P+ LFQI  N G ++  K         + L++KVTD   PSR     +H  + E+
Sbjct:   52 CFLWLFF-QLPILGSSTK-VAYRVPEEQPPNILIGSLASD---------YGYPDSKHLYKLELG-HPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQ------------IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQ-PQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLH--LDRSTGLITVQGPIDREDVGTL---KFSVVAKDKGANPKTARTQ-VTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAG-DVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADS--GPNSQLHYSILPDPSARGIFSINP-------DSGQIRVN--TVLDREQREHYDFHVVAVDKG-------IPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINET 823          
BLAST of Protocadherin 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 293.508 bits (750), Expect = 3.764e-82
Identity = 244/832 (29.33%), Postives = 387/832 (46.51%), Query Frame = 2
Query:   41 CLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQ--------LKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI--SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            C L +F   + + G   K + +++ EE P NI IGS+             G   + H          ++ ++  TG I T    IDR+S+ E     C  L    +C ++        +  V +LLD              IEI DIND++P F S  + ++I E   I    P+P A D DS    ++ Y      EA   F ++  +D   K  PQL V   LDRE+   + LT+   D G P +  S  + I ILD NDNAP  E+++    + E++ + H +++++A D D G N  I + F +  +    + H  +D+ +G+IT+   ID + + +L   +  +  +D G   + + T  +TI + D ND  PVI I    L + Q     I E++     VA V V D D G+N  V C + G +  F L+ +       + +Y + T   LD E    Y + I   DSG+P  ++   L V+V DVNDN+P F +S +E+   EN     L+  ++ TD D     N +  Y+I    S R +F + P       +S ++R+   T  DRE+    +F +   D           SL  +++V++ + DRNDN P F    Y F++ E  P+   VG++   D D+G+N  I   ++  S +    F +   TGT+ +    DRE  S + F++KA D G P R S   V + V D NDN P  + P+  ++    + Q+   T +  V A D D     ++ YSI  G+P+ LFQI  N G ++  K         + L++KVTD   PSR     +H  + E+
Sbjct:   52 CFLWLFF-QLPILGSSTK-VAYRVPEEQPPNILIGSLASD---------YGYPDSKHLYKLELG-HPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQ------------IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQ-PQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLH--LDRSTGLITVQGPIDREDVGTL---KFSVVAKDKGANPKTARTQ-VTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAG-DVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADS--GPNSQLHYSILPDPSARGIFSINP-------DSGQIRVN--TVLDREQREHYDFHVVAVDKG-------IPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINET 823          
BLAST of Protocadherin 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 293.893 bits (751), Expect = 6.259e-82
Identity = 244/832 (29.33%), Postives = 387/832 (46.51%), Query Frame = 2
Query:   41 CLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQ--------LKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI--SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            C L +F   + + G   K + +++ EE P NI IGS+             G   + H          ++ ++  TG I T    IDR+S+ E     C  L    +C ++        +  V +LLD              IEI DIND++P F S  + ++I E   I    P+P A D DS    ++ Y      EA   F ++  +D   K  PQL V   LDRE+   + LT+   D G P +  S  + I ILD NDNAP  E+++    + E++ + H +++++A D D G N  I + F +  +    + H  +D+ +G+IT+   ID + + +L   +  +  +D G   + + T  +TI + D ND  PVI I    L + Q     I E++     VA V V D D G+N  V C + G +  F L+ +       + +Y + T   LD E    Y + I   DSG+P  ++   L V+V DVNDN+P F +S +E+   EN     L+  ++ TD D     N +  Y+I    S R +F + P       +S ++R+   T  DRE+    +F +   D           SL  +++V++ + DRNDN P F    Y F++ E  P+   VG++   D D+G+N  I   ++  S +    F +   TGT+ +    DRE  S + F++KA D G P R S   V + V D NDN P  + P+  ++    + Q+   T +  V A D D     ++ YSI  G+P+ LFQI  N G ++  K         + L++KVTD   PSR     +H  + E+
Sbjct:   44 CFLWLFF-QLPILGSSTK-VAYRVPEEQPPNILIGSLASD---------YGYPDSKHLYKLELG-HPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQ------------IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQ-PQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLH--LDRSTGLITVQGPIDREDVGTL---KFSVVAKDKGANPKTARTQ-VTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAG-DVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADS--GPNSQLHYSILPDPSARGIFSINP-------DSGQIRVN--TVLDREQREHYDFHVVAVDKG-------IPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINET 815          
BLAST of Protocadherin 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 293.123 bits (749), Expect = 1.044e-81
Identity = 244/832 (29.33%), Postives = 387/832 (46.51%), Query Frame = 2
Query:   41 CLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQ--------LKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI--SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            C L +F   + + G   K + +++ EE P NI IGS+             G   + H          ++ ++  TG I T    IDR+S+ E     C  L    +C ++        +  V +LLD              IEI DIND++P F S  + ++I E   I    P+P A D DS    ++ Y      EA   F ++  +D   K  PQL V   LDRE+   + LT+   D G P +  S  + I ILD NDNAP  E+++    + E++ + H +++++A D D G N  I + F +  +    + H  +D+ +G+IT+   ID + + +L   +  +  +D G   + + T  +TI + D ND  PVI I    L + Q     I E++     VA V V D D G+N  V C + G +  F L+ +       + +Y + T   LD E    Y + I   DSG+P  ++   L V+V DVNDN+P F +S +E+   EN     L+  ++ TD D     N +  Y+I    S R +F + P       +S ++R+   T  DRE+    +F +   D           SL  +++V++ + DRNDN P F    Y F++ E  P+   VG++   D D+G+N  I   ++  S +    F +   TGT+ +    DRE  S + F++KA D G P R S   V + V D NDN P  + P+  ++    + Q+   T +  V A D D     ++ YSI  G+P+ LFQI  N G ++  K         + L++KVTD   PSR     +H  + E+
Sbjct:   52 CFLWLFF-QLPILGSSTK-VAYRVPEEQPPNILIGSLASD---------YGYPDSKHLYKLELG-HPYLRVDGKTGDIYTTETSIDRESLRE-----CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQ------------IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQ-PQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLH--LDRSTGLITVQGPIDREDVGTL---KFSVVAKDKGANPKTARTQ-VTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAG-DVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADS--GPNSQLHYSILPDPSARGIFSINP-------DSGQIRVN--TVLDREQREHYDFHVVAVDKG-------IPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINET 823          
BLAST of Protocadherin 1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 319.701 bits (818), Expect = 4.334e-92
Identity = 241/809 (29.79%), Postives = 388/809 (47.96%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQ----TSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGK-PKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            + +K+ EE P N  IGS+         G   ++  G+               ++ ++  TG I T    IDR+ + E     C      + CI++ + ++  L+ N    L +      IE+ DIND++P F S  + + I E   I S  P+P+A D D+    +  Y      EA   F ++  +D   K  PQL V   LDRE    + LT+   D G PP+  S  + + +LD NDNAP  E+ +    + E++ + H +I+++A D D G N  I + F + P V   +   R+D+ +G+IT+   +D + + +L      +  +D G  PK  S+ A + + V D+ND  P I I  I L + Q     I E++     VA V V D D G N  V C + G +  F L          + +Y + T   LD EK   Y + I   DSG+P  ++   L V+V+DVNDN+P F +S  E+   EN  PG ++  +  +D D        +      + + LF + P       E+ ++R+   TS DRE+  + E ++  +D    S+ GT        TV+V++ D NDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++  + D    F +   TGT+ +    DRE+ S + F++KA D G P R +   V + V D NDN P    P+  +H +  + Q+     + +V A D D     ++TYSI GG+PYGLFQI S+ G I+  K+ +      + L++KV+D   P R     +H+ V E+
Sbjct:   38 VVYKVPEEQPPNTLIGSLAADYGLPDVGHLYKLEVGA--------------PYLRVDGKTGDIFTTETSIDREGLRE-----CQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQ----IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTL---RFSVLAKDRGATPK--SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG-DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISP-------ENGEIRVK--TSLDREQRDSYELKVVAADRGSPSLQGTA-------TVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 793          
BLAST of Protocadherin 1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 319.701 bits (818), Expect = 4.334e-92
Identity = 241/809 (29.79%), Postives = 388/809 (47.96%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQ----TSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGK-PKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            + +K+ EE P N  IGS+         G   ++  G+               ++ ++  TG I T    IDR+ + E     C      + CI++ + ++  L+ N    L +      IE+ DIND++P F S  + + I E   I S  P+P+A D D+    +  Y      EA   F ++  +D   K  PQL V   LDRE    + LT+   D G PP+  S  + + +LD NDNAP  E+ +    + E++ + H +I+++A D D G N  I + F + P V   +   R+D+ +G+IT+   +D + + +L      +  +D G  PK  S+ A + + V D+ND  P I I  I L + Q     I E++     VA V V D D G N  V C + G +  F L          + +Y + T   LD EK   Y + I   DSG+P  ++   L V+V+DVNDN+P F +S  E+   EN  PG ++  +  +D D        +      + + LF + P       E+ ++R+   TS DRE+  + E ++  +D    S+ GT        TV+V++ D NDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++  + D    F +   TGT+ +    DRE+ S + F++KA D G P R +   V + V D NDN P    P+  +H +  + Q+     + +V A D D     ++TYSI GG+PYGLFQI S+ G I+  K+ +      + L++KV+D   P R     +H+ V E+
Sbjct:   38 VVYKVPEEQPPNTLIGSLAADYGLPDVGHLYKLEVGA--------------PYLRVDGKTGDIFTTETSIDREGLRE-----CQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQ----IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTL---RFSVLAKDRGATPK--SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG-DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISP-------ENGEIRVK--TSLDREQRDSYELKVVAADRGSPSLQGTA-------TVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 793          
BLAST of Protocadherin 1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 303.138 bits (775), Expect = 4.923e-86
Identity = 213/684 (31.14%), Postives = 338/684 (49.42%), Query Frame = 2
Query:  455 NDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGK-PKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            ND++P F S  + + I E   I S  P+P+A D D+    +  Y      EA   F ++  +D   K  PQL V   LDRE    + LT+   D G PP+  S  + + +LD NDNAP  E+ +    + E++ + H +I+++A D D G N  I + F + P V   +   R+D+ +G+IT+   +D + + +L      +  +D G  PK  S+ A + + V D+ND  P I I  I L + Q     I E++     VA V V D D G N  V C + G +  F L          + +Y + T   LD EK   Y + I   DSG+P  ++   L V+V+DVNDN+P F +S  E+   EN  PG ++  +  +D D        +      + + LF + P       E+ ++R+   TS DRE+  + E ++  +D    S+ GT        TV+V++ D NDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++  + D    F +   TGT+ +    DRE+ S + F++KA D G P R +   V + V D NDN P    P+  +H +  + Q+     + +V A D D     ++TYSI GG+PYGLFQI S+ G I+  K+ +      + L++KV+D   P R     +H+ V E+
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTL---RFSVLAKDRGATPK--SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG-DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISP-------ENGEIRVK--TSLDREQRDSYELKVVAADRGSPSLQGTA-------TVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 654          

HSP 2 Score: 162.155 bits (409), Expect = 6.989e-40
Identity = 164/595 (27.56%), Postives = 258/595 (43.36%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQD-NTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE---------QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQ---------IDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIF---SKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSD 2155
            + + D ND++P F        +SE   I        A+D D    +   Y FH+A    R     D NTG I     V+  +DRE++S  + +V+A D G  PK+    V++ + D NDNAP IE         Q    +I ED   +  +  ++  D+D GEN  ++       V  D+  F++ Q S   + +++         +DY+ ++    IE++    D G P  LSST +L + V+DVND  PV      F++        EN +  ++VA V   DAD G N ++   L        L  I   N       +I  K  LD E+   Y L +  +D G P       ++V V+D NDN P F  S     + EN P  + +  + V D D+   EN R   ++ +            G   +++    I S  SFDRE+ ST  F+L   D             S+   V +++ D NDNAP     S T +   +T +      V  + A D D G N +++Y I     +    F +  ++G +T + +I+R    +    VK  D+G P RY  A V + V++
Sbjct:  107 VTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLIT----VQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCV-----VAGDV-PFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDY-TIEIVAV--DSGNPP-LSSTNSLKVQVVDVNDNAPV------FTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPEN------GEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDK--GENARVQLSVEQD----------NGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGG-------VPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSI--AGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNE 653          

HSP 3 Score: 112.079 bits (279), Expect = 2.295e-24
Identity = 109/448 (24.33%), Postives = 199/448 (44.42%), Query Frame = 2
Query:  200 VNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKV--------VINISEAETIDSPHPLPMAHDPDSSKFSINR--------YYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGEN-ELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDL-FSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSP 1486
            +++ F      +   + ++++TG IT++ P+DR+ +                    L+  V   D   TP + +   V++ + D+ND++PT     +        + NISE    ++   L    D D  + +           +   +AS     E   D+  K    L+  + LD E++ ++ + ++A D+G PP + + ++ ++++D NDNAP+  Q ++ ++  E+      +  + A D D+G N EL+     EP  Q     F I   +G I +   +D +   S    EL +   D G P  L  TAT+ + VLD ND  P   +    FS       ++EN+ +   V  V V D D G N +V+  +     DF ++N             I++ +  D E++S Y   ++  D G P ++A   + + V+D NDN+P
Sbjct:  154 IDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLS------------------TLRFSVLAKDRGATPKSAR-AQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQAS-----ETGSDSKKKYF--LQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQ---GLFTISPENGEIRVKTSLDREQRDSY---ELKVVAADRGSPS-LQGTATVLVNVLDCNDNDPKFMLSGYNFS-------VMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQN---------GTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP 552          

HSP 4 Score: 80.1073 bits (196), Expect = 1.274e-14
Identity = 68/246 (27.64%), Postives = 112/246 (45.53%), Query Frame = 2
Query:  365 QLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPIS---IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID--YDSIQSLPQIELIITVQDHGKPKQLSST 1087
            +LK V     +  +P  Q    VL+ + D ND+ P F       ++ E     SP  +    D D  + +  +    + +  F I   Q+ TG I+  L      DRE+ S +   + A D GVPP++  + V I +LDENDNAP I   S  S   +   T +   + ++ A+D D+G N  +++ +      N    F+I   SG ITL ++I+  +  +       L++ V D GKP +  + 
Sbjct:  418 ELKVVAA---DRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVI---QNGTGTILSSL----SFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAG---GNPYGLFQIGSHSGAITLEKEIERRHHGLH-----RLVVKVSDRGKPPRYGTA 645          
BLAST of Protocadherin 1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 285.804 bits (730), Expect = 3.461e-81
Identity = 232/813 (28.54%), Postives = 374/813 (46.00%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVN--FHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII-EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            MD   ++    LL   +  +++     + L + I EE P N+ IG+I +      +    G++ +  +  VS+       + ++ STG I T    IDR+ +C           + +EC  +L+ V+   D  +         + I + D ND++P F S  + I+I E   I+S  P+P A DPD+    +  Y        F ++  +   G+  PQL V+  LDRE+   + + +   D G P K+ +  + + + D NDN P+  E    + I E+  V   +I++ A D D G N  I +             F ++  +G+IT+ R +D +       I  +  +   G      + AT+TI V DVND  P I +  + S       + E    N  +A + V D D  +NG+V C  I  E  F L+ + Y+N     +Y + T   LD E    +   I  SDSG P       + VK+ D NDN P F +  IEL +SEN   G  LTTI+ TD  E   +N    Y +  +    F L+     G L ++++       F+RE+     F +T  D     +            VIV + D NDN+P F+   ++F ++E  P+   VG++  TDED G+N  ++  I    +D +N F LD  +G + +    DRE+ S + F VKA D G P R S A V + V D+NDN P  I P          + +   +++ +V A+D D     ++ Y+I  G+  GLF+ID   G I+  +KP PTD   + L++ ++D  +P
Sbjct:    1 MDLRDFY----LLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD-APLVKVSSSTGEIFTTSNRIDREKLCAGASYA-----EENECFFELEVVILPNDFFRL------IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETA----IHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEREVPFHLKAV-YDN-----QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATD--EDSGKNADIVYQLGPNA-SFFDLD--RKTGVLTASRV-------FNREEQERFIFTVTARDNGTPPLQSQA-------AVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSI---LNDNEN-FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 287.345 bits (734), Expect = 7.958e-81
Identity = 238/797 (29.86%), Postives = 372/797 (46.68%), Query Frame = 2
Query:   59 LLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHF-VSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPI-IEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE-NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            LLA  V+    +   + + EE P N+ IG + +     S+   +  T    F +   T  +  I I + TG I T    IDR+ +C  + L        + C  +++  V +L +    L +     LIE  DIND++P F +  + I+I E   I+S + LP A DPD     +  Y   ++   F ++  +   G  +PQL V+  LDREE   + + V   D G P ++ +  + + + D NDN PI IE+   +SI E+  +   + ++ A D D GEN  I F+            F ++  +G+IT+   +D    +  P  +L++   D G      + AT+ + V D+ND VP I I  + +       + EN   N  +A + V D D   NG+V C    +E  F L  +  N      ++ + T   LD E    Y + +  +D+G P       L++KV D NDN+P F +S I L + EN  PG  LT I+ TD D    +N    Y +       F L+  +  G L + K         DREK     F +   D            L S++TV V + D+NDN+PIF+  +Y F + E  P++  VGL+  TD D G+N  ++  I     DV + FT+D  +G +      DRE+   + F VKA D G   R S A V + V D+NDN P FI P   N++    + S+   T++ KV A+D D     ++ YSI GG+  GLF I+   G I+  +K   +D   + +++K  D   P
Sbjct:   13 LLACVVFQSGAQEKNYTVREEMPENVLIGDLLK-DLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVL-------DARCFYEVE--VAVLPDEIFRLVK--IRFLIE--DINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDR---EESPSHKLLVLATDGG---STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRLRPVFSN------QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS--GQNAEISYMLGFDAPPEFNLD--QRTGILTAVK-------KLDREKQEKYYFTVLAQDNG-------IPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSI----LDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPP-SNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin 1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 322.398 bits (825), Expect = 6.120e-92
Identity = 240/808 (29.70%), Postives = 387/808 (47.90%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQI---LSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHG-KPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            + +K+ EE P N  IGS+              +   F  V    ++     ++ ++  TG I T    IDR+ + E     C        CI++ + ++  L+ N    L +      IE+ DIND++P F S  + + I E   I S  P+P+A D D+    +  Y      EA   F ++  +D   K  PQL V   LDRE    + LT+   D G PP+  S  + + +LD NDNAP  E+ S    + E++ + H +I+++A D D G N  I + F + P V   +   R+D+ +G+IT+   +D + + +L      +  +D G  PK  S+ A + + V D+ND  P I I  I L + Q     I E++     VA V V D D G N  V C + G +  F L          + +Y + T   LD EK   Y + I   DSG+P  ++   L V+V+DVNDN+P F +S  E+   EN  PG ++  I  +D D        +      + + LF + P       E+ ++++   TS DRE+  + E ++  +D           SL  ++TV+V++ D NDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++  + D    F +   TGT+ +    DRE+ S + F++KA D G P R +   V + V D NDN P    P+  +H +  + Q+     + +V A D+D     ++ YSI GG+PYGLFQI S+ G I+  K+ +      + L++KV+D   P R     +H+ V E+
Sbjct:   60 VVYKVPEEQPPNTLIGSL-------------AADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRE-----CQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQ----IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTL---RFSVLAKDRGTNPK--SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG-DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISP-------ETGEIQVK--TSLDREQRESYELKVVAADRGSP-------SLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 815          
BLAST of Protocadherin 1 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 2.259e-78
Identity = 230/813 (28.29%), Postives = 372/813 (45.76%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVN--FHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII-EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            MD   ++    LL   +  +++     + L + I EE P N+ IG+I +      +    G++ +  +  VS+       + ++ STG I T    IDR+ +C           + +EC  +L+ V+   D  +         + I + D ND++P F S  + I+I E   I+S  P+P A DPD+    +  Y        F ++  +   G+  PQL V+  LDRE+   + + +   D G P K+ +  + + + D NDN P+  E    + I E+  V   +I++ A D D G N  I +             F ++  +G+IT+ R +D +       I  +  +   G      + AT+TI V DVND  P I +  + S       + E    N  +A + V D D  +NG+V C  I  E  F L+ + Y+N     +Y + T   LD E    +   I  SDSG P       + VK+ D NDN P F +  IEL +SEN   G  LTTI+ TD  E   +N    Y +  +    F L+     G L ++++       FDRE+     F +T  D     +            VIV + D NDN+P F+   ++F ++E  P+   VG++  TD D G+N  ++  I     +  ++F LD  +G + +    DRE+ S + F VKA D G P R S A V + V D+NDN P  I P          + +   +++ +V A+D D     ++ Y+I  G+  GLF+ID   G I+  +KP PTD   + L++ ++D  +P
Sbjct:    1 MDLRDFY----LLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDA-PLVKVSSSTGEIFTTSNRIDREKLCAGASYA-----EENECFFELEVVILPNDFFRL------IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETA----IHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEREVPFHLKAV-YDN-----QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATD--EDSGKNADIVYQLGPNA-SFFDLD--RKTGVLTASRV-------FDREEQERFIFTVTARDNGTPPLQSQA-------AVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI----LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 4.807e-77
Identity = 242/815 (29.69%), Postives = 380/815 (46.63%), Query Frame = 2
Query:   59 LLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHF-VSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH--FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSS-ENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP-SRSAQITIHVKVEES 2482
            LLA  V+    +   + I EE P N+ IG + +     S+   +  T    F +   T  +  I I + TG I T    IDR+ +C  +        +   C  +++  V +L +    L +     LIE  DIND++P F +  + I+I E   I+S + LP A DPD     +  Y   ++   F ++  +   G  +PQL V+  LDREE   + + V   D G P ++ +  + + + D NDN P+ ++    +SI E+  V   + ++ A D D GEN  I F     N+ +++    F ++  +G+IT+   +D    +  P  +L++   D G    + + A + + V DVND VP I I  + +       + EN+  N  +A + V D D   NG+V C    +E  F L  +  N      ++ + T   LD E    Y + +  +D+G P       L +KV D NDN+P F +S + + + EN  PG  LT ++ TD D     N   +Y +       F L+     G L   K         DREK     F +   D            L+S+ TV V I D+NDN+P+F+  +Y F + E  P++  VGL+  TD D GDN  ++  I D + D    FT+D  TG +      DREK   + F VKA D G   R S A V + V D+NDN P FI P   N++    + S+   T++ +V A+D D     ++ YSI GG+   LF ID   G I+  +K   TD   + +L+K  D   P S  + + +++ V ES
Sbjct:   13 LLACVVFHSGAQEKNYTIREEMPENVLIGDLLK-DLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP-------RDEHCFYEVE--VAILPDEIFRLVK--IRFLIE--DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS--NLVSNIARRLFHLNATTGLITIKEPLDR---EETPNHKLLVLASDGG---LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSN------QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADS--GPNAEINYLLGPDAPPEFSLD--RRTGMLTVVK-------KLDREKEDKYLFTILAKDNG-------VPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD----FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-SNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNES 775          
BLAST of Protocadherin 1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 4.986e-77
Identity = 242/815 (29.69%), Postives = 380/815 (46.63%), Query Frame = 2
Query:   59 LLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHF-VSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH--FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSS-ENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP-SRSAQITIHVKVEES 2482
            LLA  V+    +   + I EE P N+ IG + +     S+   +  T    F +   T  +  I I + TG I T    IDR+ +C  +        +   C  +++  V +L +    L +     LIE  DIND++P F +  + I+I E   I+S + LP A DPD     +  Y   ++   F ++  +   G  +PQL V+  LDREE   + + V   D G P ++ +  + + + D NDN P+ ++    +SI E+  V   + ++ A D D GEN  I F     N+ +++    F ++  +G+IT+   +D    +  P  +L++   D G    + + A + + V DVND VP I I  + +       + EN+  N  +A + V D D   NG+V C    +E  F L  +  N      ++ + T   LD E    Y + +  +D+G P       L +KV D NDN+P F +S + + + EN  PG  LT ++ TD D     N   +Y +       F L+     G L   K         DREK     F +   D            L+S+ TV V I D+NDN+P+F+  +Y F + E  P++  VGL+  TD D GDN  ++  I D + D    FT+D  TG +      DREK   + F VKA D G   R S A V + V D+NDN P FI P   N++    + S+   T++ +V A+D D     ++ YSI GG+   LF ID   G I+  +K   TD   + +L+K  D   P S  + + +++ V ES
Sbjct:   13 LLACVVFHSGAQEKNYTIREEMPENVLIGDLLK-DLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP-------RDEHCFYEVE--VAILPDEIFRLVK--IRFLIE--DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS--NLVSNIARRLFHLNATTGLITIKEPLDR---EETPNHKLLVLASDGG---LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSN------QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADS--GPNAEINYLLGPDAPPEFSLD--RRTGMLTVVK-------KLDREKEDKYLFTILAKDNG-------VPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD----FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-SNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNES 775          
BLAST of Protocadherin 1 vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.263e-76
Identity = 231/798 (28.95%), Postives = 365/798 (45.74%), Query Frame = 2
Query:   59 LLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHF-VSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII-EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH--FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            LLA  V+    +   + I EE P N+ IG + +     S+   +  T    F +   T  +  I I + TG I T    IDR+ +C  +    V+ H    C  +++  V +L +    L +     LIE  DIND++P F +  + I+I E   I+S + LP   DPD+    +  Y+  +    F ++  +   G+ +PQL V+  LDREE   + + +   D G P ++ +  + + + D NDN P+  E    +SI E+  V   + ++ A D D GEN  I F+    N+ ++M    F ++  +G+IT+   +D    +  P  +L++   D G      + A + + V D+ND +P I I  + +       + EN   N  +A + V D D   NG V C    +E  F L  +  N      ++ + T   LD E    Y + +  +D+G P       L++KV D NDN+P F +  + L + EN  PGT LT I+  D D     N   +Y +       F L+     G L + K         DREK     F +   D     +           TV+V + D+NDN+P+F+  +Y F + E  P++  VGL+  TD D G+N  +   I D + D    FT+D  TG +      DREK   + F VKA D G   R S A V + V D+NDN P F+ P+           ++  T++  V A+D D     ++ YS+ GG+  GLF ID   G I+  +K    D   + L++K  D   P
Sbjct:   13 LLACIVFQSGAQEKNYTIREEMPENVLIGDLLK-DLNLSLIPDRSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGI---VVDAH----CFYEVE--VAVLPDEIFRLVK--IRFLIE--DINDNAPLFPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFS--NLISNMAKKLFHLNSTTGLITIKEPLDR---EESPNHKLLVLASDGG---LTPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSC-FTDHEVPFRLRPVFSN------QFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADS--GRNAEINYLLGFDAPSEFNLD--HRTGILTAVK-------KLDREKQEKYSFTVLAKDNGMPPLMTNA-------TVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDD----FTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          
BLAST of Protocadherin 1 vs. TrEMBL
Match: A0A087W1P7 (Protocadherin 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000238200 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 1.899e-112
Identity = 294/948 (31.01%), Postives = 449/948 (47.36%), Query Frame = 2
Query:   23 SYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQ--------TSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCC----------VEL-------HQSSECIIQLKAVVQLLDNHKTPLTQKD--CNVLIEITDINDHSPTFF---------------SDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRF-----------FRIECTQDNTG--------------KIIPQLRVKSRLDREEISEHQLTVIASD---AGVP-----------PKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHF--RIDQMSGVITLARQIDYDSIQSLPQ-----IELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQ-PARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHP---KQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDET----DKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTD-ARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSK 2575
            S+  V  +L +  L ++        L   I EE P    +  I Q        +S  G+ +        F  V  N+ I  +  I+ + GRI+L++ +DRD +C+  +LCC          V++         +  C +  + V  L  N  T    +   C V + I D+ND +P F                 + ++I I E   ID+   LPMA D DS +FSI  Y    + +            F I     + G               + P+L+++ +LDRE I E+ L ++ SD   +G P           P + S+++ + + D ND+AP +E    I +KEDT V   + +I A DKD G+N  I + ++ P V + ++ F   ID  +GV+++   +D DS   LPQ     +E ++   D+G+    SST T+++ + D+NDE P+I  IDL SR  P RP + ENL    LVA+V V DAD G+NG   C +     +F LE+I   N K++ E +++TK+ LD E   +  + I C D  HP    +T  Q ++V + D NDN P F    IEL + EN PPG LL  +N TD DE             Y I  +G+  F L+P  G          +Y+  SFDREK   IEF +   D      S + +       VIV I DRND+AP F +  Y  ++ E       V  + A DEDQG + + S+ ++D     Q  F LD  +G LT KSK+DRE+ S + F++ + D+G P + +   V ++V D+NDN PKF+YPT  NHT+  S  +S  + ++K+ A D D     +  + I  G+  G+FQ+D   G +S      P   A  Y L ++V D+  PS S    I V ++ +R     P    G+   ++E +S  E  N  K
Sbjct:    3 SHAFVQFILAIIPLLVKTSKTPRDFLTVDIIEEQPVGSHVTDIAQELGLPVDKSSTSGAADTAS----YFKIVVANSAINGYFAISPTNGRISLKKHLDRDMLCQNERLCCESEDDRRSSPVQMPDGTYFRRTAKACKMSFRVVYHLSANGSTTHESRMAFCTVDVNIHDLNDCAPRFLLKDSYPTYGGHYHPEPNAILITIPENTEIDTCFDLPMAFDEDSVRFSIQGYQLEVSGKVDQALDGSIHDTFAIRLGSCDGGPNAIYGVANGVEIANLKPKLQLRRKLDREAIEEYNLNLVVSDGMNSGTPKPLYTKQTNLLPHSASLSITVIVGDVNDHAPEVEASVEIRLKEDTPVGTRVTQIFANDKDAGDNAKIRYEIR-PLVSSQLSRFPFTIDSTTGVVSIVNPLDADS---LPQEAHGLMEFLVISSDNGQDITFSSTTTVSVQIDDINDEAPIIKTIDLASRSNPPRPTVRENLPPGTLVAFVTVTDADSGVNGMFTCRV--DNPNFGLESIGDKNAKEK-ELQLITKMALDRELAPMQPVTIICVDHAHPVAFAKTGFQRILVSITDDNDNDPVFPNDVIELSVYENSPPGELLYHLNATDADEMVSWISSLRTPLIYEIDPTGKAFFSLDPSSGN---------LYTKESFDREKQEIIEFGVVAFDHGTPQRSASAK-------VIVRILDRNDHAPEFDQKLYNVSVPESTSLGEVVLKVSAHDEDQGPSSEFSFHLEDLRGSAQKHFELDPLSGNLTIKSKLDRERESHYSFQIYSVDRGVPRQTAYCRVNIQVLDVNDNPPKFVYPTQMNHTIHFSSWNSPESPLLKLTATDKDTGVNAEKIFLIAEGNEKGIFQLDMQTGDLSLKPDLDPVKVAGHYNLKLEVRDDGTPSLSGFTYITVILDAARPPLSVPTLPPGQI--KVEQTSLKEVKNIPK 921          
BLAST of Protocadherin 1 vs. TrEMBL
Match: A0A158QF93 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8533 PE=4 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 2.881e-109
Identity = 289/897 (32.22%), Postives = 447/897 (49.83%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSEC------IIQLKAVVQLLDNH------------KTPLTQKD-----CNVLIEITDINDHSPTFF-------------SDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS---------RF-----FRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVP-PKTGSINVIIRILDENDNAP----------------IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKE---PNVQNDMNHFRIDQMSGVITLARQIDYDSI-QSLPQ--IELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDAD--HGLNGQVKCDL-------------IGYE-----DDFSLENIEYNNVKD--QFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFR-LEPVEG-RGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSK-TQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRY-SIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQ 2491
            L F++ EE P N +I  +         +        F  +S N  I     I+Q TG +    PIDRD +C++ +LCC  + Q          I+ ++AV     NH            +   + K       ++ I++ D+ND++P F              S   V++ISE   I    PLP+AHD D+  F I  Y     S         RF     F +  T+ + G I+P+L ++  LD E+  ++ +++IA D       +  I V + ++DENDN P                I    + ++++EDT V   +   EA+D D GEN  ++F   E   P VQ     F ++  +G + L  ++DYDS+ +S P     L++   DHG+P +LS++A++ I ++DVNDE P I+I+DL +R P + E+LEN +S+  VA V V D D  +G NGQ  C L             +G++     DD S     +N+V    + E+++VT    D E+  ++ + IRC D G     +Q    V V+DVNDN P F  + + + + E+  PGTL+  +N TD D  D  +      IS +     + + P+     +LE    R+      DRE I  +E++LTV  T+R S +     L     + + + D NDNAP+F   + Y F I EEK     VG++ ATD D+G NGKISY++   ++ VQ  F ++ NTG +TTK  +DRE  +++EF V A D     R  + ANVVV++ DINDNDPKFIYPT  NHT+ AS  S   T I+K+   D D AG+  + + ++     GLF ++ + G +SFA++    D  S++L I+  DN  PSRS+  +I V ++    Q
Sbjct:   22 LRFQMPEEVPVNTEIADLPSLLNLHLTDDSASPNYIFKILSSNPMINQMFAIDQRTGVLRTNGPIDRDQLCQRAELCCTMVGQHEIANAHDLKIVGMEAVQSKFGNHIISTGLKCTLDFRVAYSSKTDPTSFASIQIDLLDLNDNAPKFTGIPSSQISRNYDGSLMYVVSISENAHIGYQLPLPIAHDGDAGSFGIQGYRLEGPSAQYLSSFDHRFSSDFPFELISTRRDDGVILPKLELREHLDFEKRQDYYISLIAYDTDRHMAHSSDILVRVDVIDENDNQPNVTVRKRMQGGYDSSTIGLGQNQLNLREDTPVGTLLATFEARDADNGENGRVTFAWAETIPPRVQR---LFDLNPSTGELRLGDRLDYDSLAKSSPNRAYNLVVVASDHGRPNRLSTSASIIIELVDVNDEEPKITIMDLANRSPTQLEVLENAKSDTFVALVTVQDLDGPNGPNGQFYCTLNSTLFRLISADSFMGHKMIPDHDDISFVG-GHNSVGGVGRAEFQLVTTTSFDREQTPVHFVSIRCRDKGISPLESQTTFAVTVLDVNDNPPQFPVNPLTVTIPEDAQPGTLIVNLNATDPDRPDDPHPLTYSLISVTALSTSQPMSPMNSTHFRLEGHTGRLLLAEPLDREMI--MEYQLTVRATDRGSPTPLSCDL----ALRIQVLDVNDNAPVFGNPSGYRFVIEEEKEPGTVVGVVSATDADEGKNGKISYRLFGTAAAVQRGFAVNPNTGEITTKMSLDREVNAVYEFFVTAEDSSSSKRLTATANVVVELLDINDNDPKFIYPTQPNHTIHASAYSKVGTPIVKLTVFDADAAGEQGLLFLLKNATSQGLFSLNPSTGELSFAREILDDDIGSHYLEIEAKDNGVPSRSSVTSITVVIDTRNLQ 908          
BLAST of Protocadherin 1 vs. TrEMBL
Match: A0A068WRC2 (Protocadherin 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000238200 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 1.064e-106
Identity = 276/878 (31.44%), Postives = 420/878 (47.84%), Query Frame = 2
Query:  206 FHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCC----------VEL-------HQSSECIIQLKAVVQLLDNHKTPLTQKD--CNVLIEITDINDHSPTFF---------------SDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRF-----------FRIECTQDNTG--------------KIIPQLRVKSRLDREEISEHQLTVIASD---AGVP-----------PKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKE-PNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQ-----IELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQ-PARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHP---KQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDET----DKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTD-ARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSK 2575
            F  V  N+ I  +  I+ + G+I+L++ +DRD +C   +LCC          V++         +  C +  + V  L  N  T    +   C V + I D+ND +P F                 + ++I I E   I +   LPMA D DS +FSI  Y    + +            F I     + G               + P+L+++ +LDRE I E+ L ++ SD   +G P           P + S+++ + + D ND+AP +E    I +KEDT V   + +I A DKD G+N  I + ++   + Q     F ID  +GV+++   +D DS   LPQ     ++ ++   D+G+    SST T+++ + D+NDE P+I  IDL SR  P RP + ENL +  LVA+V V DAD G+NG   C +     +F LE I   N K++ E +++TK+ LD E   +  + I C D  HP    +T  Q + V + D NDN P F    IEL + EN PPG LL  +N TD DE             Y I  +G+  F L+P  G          +Y+  SFDREK   IEF +   D      S + +       V+V I DRND+AP F +  Y  ++ E       V  + A DEDQG + + S+ ++D     Q  F LD  +G LT KSK+DRE  S + F++ + D+G P + +   V ++V D+NDN PKF+YPT  NHT+  S  +S  + ++K+ A D D     +  + I  G+  G+FQ+D   G +S      P   A  Y L ++V D+  PS S    I V ++ +R     P    G+   ++E +S  E  N  K
Sbjct:   68 FKIVVANSAINGYFAISPTNGKISLKKHLDRDMLCHNERLCCESEDDRQSSPVQMPDGTYFRRTAKACKMSFRVVYHLSANGSTKHESRMAFCTVDVNIHDLNDCAPRFLLKDSYPTYGGHYRPEPNAILITIPENTEIGTCFDLPMAFDEDSVRFSIQDYQLEVSGKVDQALDGSIHGTFAIRLGSCDGGPNAIYGVASGVEIANLKPKLQLRQKLDREAIEEYNLNLVVSDGMNSGSPKPLYTKQTNLLPHSASLSITVIVGDVNDHAPEVEASVEIRLKEDTPVGTRVTQIFAHDKDAGDNAKIRYEIRSLVSSQLSRFPFTIDSTTGVVSIVNPLDADS---LPQEAHGLMKFLVISSDNGQDITFSSTTTVSVQIEDINDEAPIIKTIDLASRSNPPRPTVRENLPAGTLVAFVTVTDADSGVNGMFTCRV--DNPNFGLEPIGDKNAKEK-ELQLITKMALDRELAPMQPVTIICVDHAHPVAFAKTGFQLIPVSITDDNDNDPIFPNDVIELSVYENSPPGELLYRLNATDADEMVSWISSLRTPLIYEIDPTGKAFFSLDPSSGN---------LYTKESFDREKQEIIEFGVVAFDHGTPQRSASAK-------VVVRILDRNDHAPEFDQKVYNVSVLESTSLGEVVLKVSAHDEDQGPSSEFSFHLEDLRGSAQKHFELDPLSGNLTIKSKLDRETESHYSFQIYSVDRGVPRQTAYCRVNIQVLDVNDNPPKFVYPTQMNHTIHFSSWNSPESPLLKLTATDKDTGVNAEKIFLIAEGNERGIFQLDLQTGDLSLKPDLDPIKVAGHYNLKLEVRDDGTPSLSGFTYITVILDAARPPLSVPTLPPGQI--KVEQTSLKEVKNIPK 921          

HSP 2 Score: 102.064 bits (253), Expect = 5.313e-18
Identity = 169/734 (23.02%), Postives = 302/734 (41.14%), Query Frame = 2
Query:   62 LAIQVYGMKNKGLYFKIDEESPANI-DIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHE--ASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEH-----QLTVIASDAGVPPKTGSINVI-IRILDENDNAPIIEQLSPIS--------IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQ----NDMNHFRID-QMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTA--TLTIIVLDVNDEVPVIS--IIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLN--GQVKCDLIGYEDD------FSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFS-KTQYEFTI---TEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISI-FEFKVKARDQGHPGRYSIANVVV 2143
             +IQ Y ++  G   K+D+    +I    +I+  SC G    + G             + S + I     ++ LR+ +DR+++ E      V    +S     L      L  H   L+     + + + D+NDH+P   +  V I + E   + +      AHD D+   +  RY      +S+  R   T D+T  ++    + + LD + + +      +  VI+SD G      S   + ++I D ND APII+ +   S        ++E+      +  +   D D+G N + +  +  PN       D N    + Q+   + L R++        P   + I   DH  P   + T    + + + D ND  P+    +I+L         + EN    +L+  +N  DAD  ++    ++  LI YE D      FSL+    N         + TK   D EK+ +    +   D G P+++A  +++V+++D ND++P F +    + + E+   G ++  ++  D D+       F    +  S +K F L+P+ G   ++S           DRE  S   F++   D             ++   V + + D NDN P F   TQ   TI   +   P++  +  L ATD+D G N +  + I +   + +  F LD  TG L+ K  +D  K++  +  K++ RD G P       + V
Sbjct:  223 FSIQDYQLEVSG---KVDQALDGSIHGTFAIRLGSCDGGPNAIYG-------------VASGVEIANLKPKLQLRQKLDREAIEEYNLNLVVSDGMNSGSPKPLYTKQTNLLPHSASLS-----ITVIVGDVNDHAPEVEA-SVEIRLKEDTPVGTRVTQIFAHDKDAGDNAKIRYEIRSLVSSQLSRFPFTIDSTTGVV---SIVNPLDADSLPQEAHGLMKFLVISSDNGQDITFSSTTTVSVQIEDINDEAPIIKTIDLASRSNPPRPTVRENLPAGTLVAFVTVTDADSGVNGMFTCRVDNPNFGLEPIGDKNAKEKELQLITKMALDREL-------APMQPVTIICVDHAHPVAFAKTGFQLIPVSITDDNDNDPIFPNDVIEL--------SVYENSPPGELLYRLNATDADEMVSWISSLRTPLI-YEIDPTGKAFFSLDPSSGN---------LYTKESFDREKQEIIEFGVVAFDHGTPQRSASAKVVVRILDRNDHAPEFDQKVYNVSVLESTSLGEVVLKVSAHDEDQGPSSEFSFHLEDLRGSAQKHFELDPLSGNLTIKS---------KLDRETESHYSFQIYSVDRG-------VPRQTAYCRVNIQVLDVNDNPPKFVYPTQMNHTIHFSSWNSPESPLLK-LTATDKDTGVNAEKIFLIAE--GNERGIFQLDLQTGDLSLKPDLDPIKVAGHYNLKLEVRDDGTPSLSGFTYITV 887          
BLAST of Protocadherin 1 vs. TrEMBL
Match: A0A5K3F9P2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.880e-106
Identity = 273/852 (32.04%), Postives = 419/852 (49.18%), Query Frame = 2
Query:  203 NFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCC-----------------VELHQSSECIIQLKAVVQLLDNHKTPLTQ---KDCNVLIEITDINDHSPTFF---------------SDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR------------FFRIE---CTQD------NTGK-----IIPQLRVKSRLDREEISEHQLTVIASDA--------------GVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH-FRIDQMSGVITLARQIDYDSIQSLPQ-----IELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQ-PARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHP---KQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENG-----RFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTD-ARSYFLLIKVTDNDHPSRSAQITIHVKVEESR 2485
            +F  V  N+ I  +  I+Q++GR++L++ +DRD++C   ++CC                 + L  + +C +  + V  +++N  T L +     C+V I I DIND +P F                S  + I I E    ++   LPMA D DSS+F++  Y   EAS+             F I    C  D       TGK     + P L+++ RLDRE I+++ L ++ +D                + P T S+++ + + D ND+AP +E    I +KEDT V   + +I A+DKD G+N  I + ++           F ID  SG+I++   +D D+   LPQ     +  ++   D G+   LSST T+   + D+NDE+PVI  +DL SR  P RP + ENL    LVA+V V DAD G+NG V C +   +  F+LE I   N + + E ++VTK  LD E   +  + I C D  HP    +T  Q  +V + D NDN+PTF     E+ + EN P G LL  +N TD DE    N         Y + +SG+  FRL+ + G          IY+  SFDREK +  EF++ V D  +   S + R       V+V I DRND+AP F +  Y  ++ E  P    +  + A D+D+G N + +Y ++D     Q  F LD + G LT  +++DRE    + F++ A D+G P + S   + V+V D+NDN PKF+YPT  NHT+  +   S  + ++K+ A D D     +  + I  G+  G+FQ+D   G +S      P   A  Y L ++V D+  PS S    I V +  +R
Sbjct:   67 SFKIVVANSVISDYFGISQNSGRVSLKKHLDRDTLCHNERICCPGEDERISNRVAMPDGSLFLRTAEKCQVSFRVVYDIVEN-TTELEEVRVAFCSVDINILDINDCAPRFLIKDIYPTYGGHYLPQSKSISIIIPENTEPNTCFELPMAFDEDSSRFNVQDYRL-EASKKNERTLAETIRDAFAIRLGSCDADFHAIYEATGKSDMTNLRPYLQLRQRLDRETIAKYHLKMVVTDGIGSDGLNAQFDKRVNLLPHTVSLSITVIVEDVNDHAPEVESKVNIKLKEDTPVGTRVTQIIARDKDAGDNAKIRYEIRPLGASKSFRFPFSIDPSSGIISVINPLDADT---LPQESQGVMTFLVISSDAGQDVSLSSTTTVNAQIDDINDEIPVIRTVDLASRSDPPRPTVQENLPPGTLVAFVTVTDADSGVNGMVSCHVDNPK--FALELISDKNARKK-ELQLVTKSVLDRELSPVQPVTIICVDHAHPVAFAKTGIQRFLVSIADENDNNPTFPNDIFEISVYENNPSGELLLCLNATDADELVSWNSVPKLSPLVYEMGKSGQDFFRLDSMTGN---------IYTKESFDREKQALFEFDVFVHDHGKPKRSASAR-------VMVRILDRNDHAPEFEQKVYNVSVLESVPIGEVILKVTAHDKDEGPNAEFTYHLEDLRGSAQKHFRLDSHLGNLTLLTELDREVEPYYTFQIYAVDKGTPRQTSYCRINVQVLDVNDNPPKFVYPTQLNHTIDFTSWDSPGSPLIKLTATDKDTGVNAEKIFLIAEGNEIGIFQLDLQSGDLSLKPGLDPLKVAGRYNLKLEVRDDGSPSLSGFTYITVILHATR 894          
BLAST of Protocadherin 1 vs. TrEMBL
Match: A0A158QVX9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8742 PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 3.027e-105
Identity = 273/852 (32.04%), Postives = 419/852 (49.18%), Query Frame = 2
Query:  203 NFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCC-----------------VELHQSSECIIQLKAVVQLLDNHKTPLTQKD---CNVLIEITDINDHSPTFF---------------SDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR------------FFRIE---CTQD------NTGK-----IIPQLRVKSRLDREEISEHQLTVIASDA--------------GVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH-FRIDQMSGVITLARQIDYDSIQSLPQ-----IELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQ-PARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHP---KQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENG-----RFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTD-ARSYFLLIKVTDNDHPSRSAQITIHVKVEESR 2485
            +F  V  N+ I  +  I+Q++GR++L++ +DRD++C   ++CC                 + L  + +C +  + V  +++N  T L +     C+V I I DIND +P F                S  + I I E    ++   LPMA D DSS+F++  Y   EAS+             F I    C  D       TGK     + P L+++ RLDRE I+++ L ++ +D                + P T S+++ + + D ND+AP +E    I +KEDT V   + +I A+DKD G+N  I + ++           F ID  SG+I++   +D D+   LPQ     +  ++   D G+   LSST T+   + D+NDE+PVI  +DL SR  P RP + ENL    LVA+V V DAD G+NG V C +   +  F+LE I   N + + E ++VTK  LD E   +  + I C D  HP    +T  Q  +V + D NDN+PTF     E+ + EN P G LL  +N TD DE    N         Y + +SG+  FRL+ + G          IY+  SFDREK +  EF++ V D  +   S + R       V+V I DRND+AP F +  Y  ++ E  P    +  + A D+D+G N + +Y ++D     Q  F LD + G LT  +++DRE    + F++ A D+G P + S   + V+V D+NDN PKF+YPT  NHT+  +   S  + ++K+ A D D     +  + I  G+  G+FQ+D   G +S      P   A  Y L ++V D+  PS S    I V +  +R
Sbjct:   67 SFKIVVANSVISDYFGISQNSGRVSLKKHLDRDTLCHNERICCPGEDERISNRVAMPDGSLFLRTAEKCQVSFRVVYDIVEN-TTELEEVRVAFCSVDINILDINDCAPRFLIKDIYPTYGGHYLPQSKSISIIIPENTEPNTCFELPMAFDEDSSRFNVQDYRL-EASKKNERTLAETIRDAFAIRLGSCDADFHAIYEATGKSDMTNLRPYLQLRQRLDRETIAKYHLKMVVTDGIGSDGLNAQFDKRVNLLPHTVSLSITVIVEDVNDHAPEVESKVNIKLKEDTPVGTRVTQIIARDKDAGDNAKIRYEIRPLGASKSFRFPFSIDPSSGIISVINPLDADT---LPQESQGVMTFLVISSDAGQDVSLSSTTTVNAQIDDINDEIPVIRTVDLASRSDPPRPTVQENLPPGTLVAFVTVTDADSGVNGMVSCHVDNPK--FALELISDKNARKK-ELQLVTKSVLDRELSPVQPVTIICVDHAHPVAFAKTGIQRFLVSIADENDNNPTFPNDIFEISVYENNPSGELLLCLNATDADELVSWNSVPKLSPLVYEMGKSGQDFFRLDSMTGN---------IYTKESFDREKQALFEFDVFVHDHGKPKRSASAR-------VMVRILDRNDHAPEFEQKVYNVSVLESVPIGEVILKVTAHDKDEGPNAEFTYHLEDLRGSAQKHFRLDSHLGNLTLLTELDREVEPYYTFQIYAVDKGTPRQTSYCRINVQVLDVNDNPPKFVYPTQLNHTIDFTSWDSPGSPLIKLTATDKDTGVNAEKIFLIAEGNEIGIFQLDLQSGDLSLKPGLDPLKVAGRYNLKLEVRDDGSPSLSGFTYITVILHATR 894          
BLAST of Protocadherin 1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 296.204 bits (757), Expect = 4.077e-84
Identity = 243/833 (29.17%), Postives = 393/833 (47.18%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI--SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            MDF+  + +L     F L +        G+ + + EE P N  IGS+            QG   + H          ++ ++  TG I T   PIDR    E +K C +   +   C ++ +  V  L  +++P   +     IE+ DIND++P F S  + +++ E   + +   +P A D D+ +  + +Y      EAS  F ++   D  G+ +PQL V   LDRE    + LT+ A D G P +  S  + + I D NDNAP  E+ S    + E++ V + +++++A D D G N  I + + + +        +I++ +G+I++   +D + I S    +  +  +D G P   SST  ++I V D ND  P + I  I L +       I E++     VA V V D D G N  V C + G +  F L     ++V ++ +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D NDNSP F     E+E +E   PG     ++V  LD     N    Y+I    S R LF ++P  G          + + +  DRE     EF +T +D           S   ++TV++ + DRNDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++    DV N F +   TGT+ +    DREK S + F++KA D G P R S   V + V D NDN P    P+  +    + + ++ ++++  V A D D     ++ YSI GG+P+ LF I  + G I   K+        + L++KV+D   PSR A   +H+ V E+
Sbjct:    1 MDFSVGWFLL-----FALLVDSINSALGGILYHVREEQPPNTLIGSLAAD---------QGLPDSGHLYKLEVGA-PYLRVDGKTGEIFTTEIPIDR----ETLKDCRI---KGKPCFLEFEVSVTDLIQNQSP---RLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDR-GEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQAS-DPVPKMLQIERSTGIISVKGPLDREEISSF---KFHVIARDKG-PSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG-DVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGE--KVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSG---------EVRARSPLDREHKERYEFRVTAADKG-------VPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVE---PDVGN-FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPL-AAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNET 778          

HSP 2 Score: 161.77 bits (408), Expect = 6.159e-40
Identity = 184/695 (26.47%), Postives = 292/695 (42.01%), Query Frame = 2
Query:  215 VSENTQILSFIVINQSTGRITLRRPI---DRDSMCEKMKLCCVEL-HQSSECIIQLKAVV----QLLDNH---------KTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS----RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE---------QLSPISIKEDTLVDHHIIRIEAKDKDTGENELIS--------FFLK---EPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSK---TQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDN 2167
            V EN  + +   I Q+T R T R  +   D  +  E   L  +++ +   E + QL  +     +L D++          TP       + + ITD ND++P F        +SE   +        A+D D        Y  H+AS    +  +IE +   TG I     VK  LDREEIS  +  VIA D G  PK+ +  V I + D+NDNAP +E              +I ED  V   +  ++  DKD GEN +++        F L+   + +V N   +F        +     +DY+ I+   ++E++    D G P  LSST +L + V D ND  P+      FS      E  E  Q  + V  V   DAD G N ++   +I       L  I      D    ++  +  LD E +  Y   +  +D G P       +++KV+D NDN P F  S     + EN PP + +  + V D+D+             E+ +    +EP  G   +++    I S  SFDREK S+  F L   D      S           V +++ D NDNAP+ +K   + +        P ++ V +++A D D G N ++ Y I     +    F +  + G +    ++ R+   +    VK  D+G P R++IA V + V++   N
Sbjct:  140 VQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERS---TGII----SVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF--------LQTTTPLDYERIRDY-RVEIVAV--DSGNPA-LSSTNSLRVQVTDTNDNSPI------FSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEI------DPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDK------------GENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYV-------GVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSV-VEVVEAEDIDYGSNAELVYSI--AGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISN 781          
BLAST of Protocadherin 1 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 296.59 bits (758), Expect = 5.949e-84
Identity = 236/816 (28.92%), Postives = 382/816 (46.81%), Query Frame = 2
Query:   59 LLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQ--DNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELI--SFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            +L +   G     + +++ EE P N  +GS+            QG     H          ++ ++  TG I T   PIDR+++ +     C  L +   C ++ +  +  L     P   +     IEI D ND++P F S  + + I E   + + + +P+A D D+    I  Y  +  S    +   Q  DNT + +PQL V   LDRE+   + L++   D G PP+  S  + I I D NDN P  E+      + E+T V   +++++A D D G N  +  SF    PNVQ  ++   ID  +G+I +   +D + +   P ++  +  +D+G P+  SS A +TI V D ND  P I I    L + +     + E++     VA V V D D G N  V C + G +  F L +   ++   + +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D+NDN+P F  S  E++ +E   PG  +  +  TD D        +      + + LF + P  G       ++R+  +   DRE     EF +  +D           SL  ++TV+V + DRNDN P F    Y F++ E  P    VG++   D D+G+N  +   ++  +      F +   TGT+ +    DREK S + F++KA D G P R S   + + V D NDN P    P+  ++     + +S +T + KV+A D D     ++ YSI GG+P+GLF+I S  G I+ AK+        + L++KV+D   PSR     +H+ V E+
Sbjct:   22 VLLLYSCGSSLASITYQLREEQPPNTLVGSLAAD---------QGLPDTGHLYKLEVG-GPYLRVDGKTGDIYTTDVPIDRETLKD-----CRNLFEGDPCFLEFEVSITDLMKGSGP---RLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLH---IDHNTGIIQVKGSVDREEV---PLLKFSVQARDNG-PQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAG-DVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTG-------EVRV--MNQLDREYKERYEFHVEAADKG-------VPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENG----KFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPL-TSPDTRVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFVNET 790          

HSP 2 Score: 144.05 bits (362), Expect = 2.115e-34
Identity = 168/631 (26.62%), Postives = 260/631 (41.20%), Query Frame = 2
Query:  404 TPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS----RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP---------IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQ---------IDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSK---TQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI 2221
            TP       + I ITD ND+ P F        ++E   +        A+D D        Y FH+ S    R   I+    NTG I    +VK  +DREE+   + +V A D G   K+    V I + D NDNAP         +  +    ++ ED  V   +  +E  DKD GEN +++       V  D+  F++   S   + +++         +DY+ I+   +IE++    D G P  LSST +L + V D+ND  PV      FS      +  E  Q    V  V   DAD G N ++   +I       L +I  N      E +++ +  LD E +  Y   +  +D G P       ++V+V+D NDN P F  +     + EN PP + +  + V D D+             E+      +EP  G+  +++    I S  SFDREK ST  F L   D      S           + +++ D NDNAP  +K   + Y+F      P +  V  + A D D G N ++ Y I     +    F +    G +T   +  R+   +    VK  D+G P R++ A V +           F+  TI N T+  S+
Sbjct:  232 TPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHID---HNTGII----QVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCV-----VAGDV-PFQLRSASASDSTSKRKYFLQTTTPLDYERIKEY-RIEIVAV--DSGNPA-LSSTNSLKVQVTDMNDNAPV------FSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNT----GEVRVMNQ--LDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADK------------GENAHVQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVG-------ITINVLDENDNAPYVTKPSNSSYKFLQPLTSP-DTRVEKVDAEDIDTGLNAELVYSIT--GGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHI-----------FVNETISNVTLVESL 800          
BLAST of Protocadherin 1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 297.36 bits (760), Expect = 2.027e-83
Identity = 244/834 (29.26%), Postives = 393/834 (47.12%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI--SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            MDF+  + +L     F L +        G+ + + EE P N  IGS+            QG   + H          ++ ++  TG I T   PIDR    E +K C +   +   C ++ + +V  L+ N    L +      IE+ DIND++P F S  + +++ E   + +   +P A D D+ +  + +Y      EAS  F ++   D  G+ +PQL V   LDRE    + LT+ A D G P +  S  + + I D NDNAP  E+ S    + E++ V + +++++A D D G N  I + + + +        +I++ +G+I++   +D + I S    +  +  +D G P   SST  ++I V D ND  P + I  I L +       I E++     VA V V D D G N  V C + G +  F L     ++V ++ +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D NDNSP F     E+E +E   PG     ++V  LD     N    Y+I    S R LF ++P  G          + + +  DRE     EF +T +D           S   ++TV++ + DRNDN P F  + Y F++ E  P    VG++   D D+G+N ++   ++    DV N F +   TGT+ +    DREK S + F++KA D G P R S   V + V D NDN P    P+  +    + + ++ ++++  V A D D     ++ YSI GG+P+ LF I  + G I   K+        + L++KV+D   PSR A   +H+ V E+
Sbjct:   37 MDFSVGWFLL-----FALLVDSINSALGGILYHVREEQPPNTLIGSLAAD---------QGLPDSGHLYKLEVGA-PYLRVDGKTGEIFTTEIPIDR----ETLKDCRI---KGKPCFLEFEVSVTDLIQNQSPRLIEGR----IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDR-GEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQAS-DPVPKMLQIERSTGIISVKGPLDREEISSF---KFHVIARDKG-PSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG-DVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGE--KVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSG---------EVRARSPLDREHKERYEFRVTAADKG-------VPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVE---PDVGN-FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPL-AAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNET 814          

HSP 2 Score: 162.155 bits (409), Expect = 7.008e-40
Identity = 185/695 (26.62%), Postives = 293/695 (42.16%), Query Frame = 2
Query:  215 VSENTQILSFIVINQSTGRITLRRPI---DRDSMCEKMKLCCVEL-HQSSECIIQLKAVV----QLLDNH---------KTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS----RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE---------QLSPISIKEDTLVDHHIIRIEAKDKDTGENELIS--------FFLK---EPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSK---TQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDN 2167
            V EN  + +   I Q+T R T R  +   D  +  E   L  +++ +   E + QL  +     +L D++          TP       + + ITD ND++P F        +SE   +        A+D D        Y  H+AS    +  +IE +   TG I     VK  LDREEIS  +  VIA D G  PK+ +  V I + D+NDNAP +E              +I ED  V   +  ++  DKD GEN +++        F L+   + +V N   +F        +     +DY+ I+   ++E++    D G P  LSST +L + V D ND  P+ S   LF       E  E  Q  + V  V   DAD G N ++   +I       L  I      D    ++  +  LD E +  Y   +  +D G P       +++KV+D NDN P F  S     + EN PP + +  + V D+D+             E+ +    +EP  G   +++    I S  SFDREK S+  F L   D      S           V +++ D NDNAP+ +K   + +        P ++ V +++A D D G N ++ Y I     +    F +  + G +    ++ R+   +    VK  D+G P R++IA V + V++   N
Sbjct:  176 VQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERS---TGII----SVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF--------LQTTTPLDYERIRDY-RVEIVAV--DSGNPA-LSSTNSLRVQVTDTNDNSPIFSP-PLFEV-----EFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEI------DPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDK------------GENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYV-------GVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSV-VEVVEAEDIDYGSNAELVYSI--AGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISN 817          
BLAST of Protocadherin 1 vs. Ensembl Cavefish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 287.345 bits (734), Expect = 4.977e-81
Identity = 235/845 (27.81%), Postives = 395/845 (46.75%), Query Frame = 2
Query:   89 NKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLR-RPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR------------------------------------FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDV------QNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            +  L ++I EE P ++ IG++     G S   +    V F   S       F  I+  TG +T   R IDR+ + +     C  +   +EC +  + +V+  L +       +     I +TD+ND++P+F S  + +++ E   I + + LP A D D  +  I+RY   + SR                                     F ++      G+  PQL VK  LDRE    ++L +   D G PP++    + + I D NDN+P  E+ +    + E+T     ++++ A D+D G N  + +       ++     R+D+ SG +++  +ID + +    Q+   +T +D G+P + +  AT+ + V D ND VPV+ I  I     +     + EN+  +  VA V V D D G NG V C ++G +  F+L+    N  K +F     T   LD E    Y + I   DSG P  ++   L+V+V+D+ND++PTF +S +E+  +EN  PG  + T+   D D    +N    Y++  S    F ++   G          I +  + DRE+    EF +   D           SL  S+TV+V + DRNDNAP F +  + F + E    N  VG++  TD D+G+N ++   +++   +       Q  F+++ NTGT+ + +  DRE  S + F+V+A D G P R + A V + V+D NDN P    P  E++T+     S   T++  V A D D      + Y++ GG+P+ LF+I  + G I+ A+  +      + L+++V D+  PS  A   +HV + ES
Sbjct:   31 DSALRYRIAEEGPPDVRIGNVA-ADLGLSTSGIGTGDVTFALESG----AEFFKIDNVTGELTTSSRRIDREKLPQ-----CQMIFDENECFLDFEVSVIGPLQSWVDLFEGR-----IVVTDVNDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEYVFGAAT-ESVRRLLRLDEASGWLSVLHRIDREEVS---QLRFTVTARDRGQPPR-TDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVG-DVPFTLKPAGENRNKKKFFLH--TSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADS--GKNAEIAYSLDPSVNGAFYIDADNG---------DIRATGALDREQRERYEFRVIARDKG-------SPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANESYTLLPP-ASGARTVVRTVMASDGDAGSNADLRYALVGGNPFQLFEIGPSSGVITLAEPLERRHRGLHRLVVRVNDSGVPSLCATALVHVFINES 833          
BLAST of Protocadherin 1 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 281.952 bits (720), Expect = 7.893e-79
Identity = 242/834 (29.02%), Postives = 380/834 (45.56%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSME--MVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKM---KLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEIL--ENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQIT-IHVKVEES 2482
            MD  S   VL L+   L+++     K+    + + EE P N+ IG+++ T    +++  +   S + F  V + T  +  + +  STG I T    IDR+ +C  +   K C  E+    E  +    + +L+             +   I DIND++P F S  + I+I E   I++ +P+P A DPD     I  Y   ++   F ++  +   G   PQL V+  LDRE      + +   D G PPK+ +  + + + D NDN P+ +     +++ E+  +   + ++ A D D G N  I F            HF ID  +G+IT+ + +D    +S P  +LI+   D        S AT+ + V DVND VP  SI   +   P    +L  EN   N  +A + V D D  LNG+V C    ++  F L+ +      DQF  +  T   LD E    Y + I  SDSG P       +++K+ D NDN+P F +  I+L + EN  PGT L  I  TD D     N    Y++       F ++P   R  + S   R+      DREK     F +   D     +           TV + ++D+NDN+P F+  +Y F + E  P    VGL+  TD D GDN  ++  I     + +++F +D  TG +      DRE+ S + F VKA D G     S A V + V D+NDN P F+ P+           ++  +++ +V A+D D     ++ YSI GG P GLF ID   G I+  +K    D   + L++KV D   P     I  +H+ V ++
Sbjct:   41 MDLASEAHVLVLILTCLVSLCWAQEKD----YTVKEEQPENVRIGNLR-TDLDLNLDPNIKLSSALQFKPVYK-TGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEI----EVAVLPDEIFRLV------------KIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDR---ESNPVHKLIVLASDGSA---TPSRATVIVNVTDVNDNVP--SIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTC-YTDHDVPFRLKPV----FNDQFLLE--TAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADS--GSNALIIYSLGPDAPDGFNIDP---RSGILSVSKRL------DREKQEKYSFTVIARDNGSNPLQSNV-------TVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSI----INGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDT 815          
BLAST of Protocadherin 1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 276.559 bits (706), Expect = 3.507e-78
Identity = 217/740 (29.32%), Postives = 358/740 (48.38%), Query Frame = 2
Query:  242 FIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS----RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP-ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH-----FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLT-SFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTD 2425
             + +N  TG +    R +DR+++C              EC + ++  V +L     P   K   V I + DIND++P F +  + +++ E        P+  A+DPDS    + RY    +       F +  T+   G+ +P L V+  LDREE   +++ + A D G PP +GS  + I + D NDN+P+ +Q    + I E++ V  H++++ A D+D G N  + + L                FR+DQ SG++T+   ++    +  P   +II   D G P+ + +TAT+T+ V DVND  P I I D+ +       I E    N  VA + V D D G NG V C +   E  F L+ + Y N     +Y + T+  LD E ++ Y + I+ +D+G    +    + +K++D NDN+P F     ++ + EN   G  L T++ TD D  DK N    Y +      +F ++P  G          I SLT   DREK +   F +   D            L  ++TVIV++ D NDN P FS  +++F + E  P++  VG++   D D+G+NG++   I    +D +  F++D  +G + +    DRE+   +  +V+A D G P R S   VV+ V DINDN P  + P           ++   T++ +V+A+D D     ++ Y I GG+P+ LF ID  +G I+  +    T    + L+++V+D
Sbjct:   85 LVRVNPRTGELFAAGRKMDREALCGGQD-------PGDECHVDVQ--VGVLPVQPGPFF-KLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNR---EESPVYRIIILATDKG-PEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPN-----QYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRD-MDK-NAEMVYFLGPDAPTMFHMDPETG----------IISLTEQLDREKKANYSFTILAKDQG-------IPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSI--LGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSD 784          

HSP 2 Score: 93.9745 bits (232), Expect = 1.257e-19
Identity = 118/479 (24.63%), Postives = 189/479 (39.46%), Query Frame = 2
Query: 1100 IIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYE----DDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI---------SESGRKLFRLEPVEG----RGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMK----VNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            I V D+ND  P  +   L    P      EN  + +       +D D   NG  + +L+  +      F L   E  N  ++  Y +V K  LD E+  LY + +R  D G P  +    L + V D NDNSP F ++ + +E+ EN P GT +  ++ +D D     N    Y +          + G++LFRL+   G     G L   +  +Y +     +K                +      +  + ++  + I+D      I +       I+E    NL V L+  +D D G NG ++  I +     Q       N   L T+  +D E  + +  ++KA D G        +V +K+ D NDN P F  PT +       +   EN +I K    V+A D D     ++ Y + G D   +F +D   G IS  ++       +Y   I   D   P      T+ V V
Sbjct:  141 INVEDINDNAPAFAAPVLTVSVP------ENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETAN-GEKVPYLVVRK-SLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDA--GSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDK--------GPEPVPATATVTVTVTDVNDNSPTIEIRD------IVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYK-------VSVPENNVIGKHLITVSATDRDMDKNAEMVYFL-GPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNV 587          
BLAST of Protocadherin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.136 bits (640), Expect = 9.977e-70
Identity = 234/857 (27.30%), Postives = 382/857 (44.57%), Query Frame = 2
Query:   83 MKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR-------FFRIECTQDNTGKIIPQ-----------LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII--EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISF-FLKEPNVQNDMNHFRIDQMSGVITL--ARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVL--DVNDEVPVISIIDLFSR--QPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTF-------GRSRI-ELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSL---TSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIF------SKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLI-MKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTD-NDHPSR-----------SAQITIHVKVEES 2482
            +    L +++DEE      IG ++Q++    +  V       H         S  ++N+ +G +++   +DR+++C +    C    +S+  +  ++          + L   D  +L+   DINDH+P F +  + ++ISE+E +    PLP A DPD+   SI  Y    AS        F  +E   D+ G  +             L ++ +LDRE +  ++L +   D G P  +GS+ + I ++D NDNAP+       P+ I E + V   ++++ A D D G N  I++ F  +           +D  +G++T+  A ++D    +++P   L++  +D G   QLS +A++T+ V   D ND  PV  +I L          +I+ENL S   V  ++V D D G +G V   L   E     E    N V  QF  K  T   LD E+   Y + +  +D G PK +    LI+ V+D+NDN+P F       G   + E+ L EN P GT++  +  TD D     NG   +T+SE       L   E   +L S  +R   L   T  DREK   + +EL+V   +            + + V V + D NDNAP F      +   Y+F + EE     +VG +  +D D+GDN +++  +   +         D   G + T   +DRE    +E  V+A D G P   +   V + VSD NDN P    P   +        S    L+ + V A D D     +  Y I GG+P G+F ++++ G +S A+     D   + L+++V D     SR           +A + +HV V E+
Sbjct:   24 LVQGALLYEVDEEVLVGYVIGDLRQSN----LLCVCFFPPAPHVSPLPLHTPSLCIVNELSGELSVALRLDREALCMEEPDAC----RSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVR--DINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDR---ETMPVHRLVVVARDGG---QLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL---EFPTGAELASPNKV--QFLLK--TTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADS--GPNGAITFTLSE-------LAGGESVAELFSLNMRTGQLTLATPLDREK--RMRYELSVEACDGG-----SPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSRRVRAVSGLLEAAAPVLLHVFVNET 841          
BLAST of Protocadherin 1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 225.713 bits (574), Expect = 2.137e-61
Identity = 195/710 (27.46%), Postives = 317/710 (44.65%), Query Frame = 2
Query:  104 FKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNF---HFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP-ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISES---GRKL---FRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYE-FTITEEKPQNLFVGLL----QATDEDQGDNGKISYKIDDFSSDVQNSFTLD------FNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDND 2170
            + + EE PA   +G +           +QG        HF        S + + ++ G ++ R  IDR+  C           Q+  C+I+   +  L       L Q   +  +E+ DINDH+P F   ++ + ISE+  + +  PL  A D D    ++  Y+  E  RF  +       G    +L VKSRLDRE+  E+ L + A D G PP++G+  V I +LD NDN+P+  Q S  ++++ED      ++ + A D D G N  + +    P        F++D  +G ++L  Q+D++ + S  + E+ I  +D G P  + +   + + V D+ND  P I +  +   +     + E       V  V V D D   NG V C L G+   F L  + Y +     +Y +VT   LD E+ + Y L++  SD G P + A ++  V+++D NDN P F RS  E  L EN  PG  +TT+   D D   + NG   Y + ES   G  +     + P  G          IY+L   D E ++++ F++   D            L +++TV V I D NDNAP+ +       T     P++  +G L    +A D D   NG++SY+I     + +N F ++      F      T +     + S+    V  RD+G P   + A + ++V    D D
Sbjct:   33 YALYEEQPAGTLVGRLSDD--------LQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQC----------GQAPSCVIRFDVLCTL----PRGLFQL-VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFG-LALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHE-LNS--EYEISIQARDMG-PSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPH-FKL--LPYRD-----DYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADA--EHNGMIAYNVVESEVAGASVSTYVSINPSSG---------AIYALRPLDYEAMTSLTFQVQARDDG-------VPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRI--VQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLV---VMVRDRGSPALSATAAIEIRVGAHGDGD 683          

HSP 2 Score: 142.51 bits (358), Expect = 1.051e-34
Identity = 151/595 (25.38%), Postives = 254/595 (42.69%), Query Frame = 2
Query:  755 INVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMS-GVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEY-----KIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFG-----RSRIE-LELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDD---FSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHT--VSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARS----YFLLIKVTDNDHPSRSAQITIHVKV 2473
            ++  + +LD ND+AP        + I E   +   +    A+D D G N L ++ L E          R D      + +  ++D    +   +  L +T  D G P + S T  + I VLD ND  PV      F++      + E+     ++  +N  D D G NG+V          +S  +     V+  F+      K+  K +LD E  S Y + I+  D G     A  +++V V D+NDN+P        +SR + + +SE     + +  + V+D+D    ENG     +   G   F+L P             + + +S DRE+++     L  SD              ++    V + D NDN P F ++ YE ++ E      +V  + A D D   NG I+Y + +     + V    +++ ++G +     +D E ++   F+V+ARD G P   + A V V++ D NDN P   +P + N T  V     +    L+  V A D D     +++Y I  G+   LF+I+  +GG  F      TDA +    + L++ V D   P+ SA   I ++V
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDR---EQEGEYTLQLTAWDGGDPPR-SGTTLVRITVLDSNDNSPV------FAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVV---------YSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSA--ENGLVACHLR--GHPHFKLLPYRD-------DYVVVTNSSLDREQMADYFLVLEASDGG-------TPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRIN-RLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 3 Score: 110.923 bits (276), Expect = 5.712e-25
Identity = 116/435 (26.67%), Postives = 194/435 (44.60%), Query Frame = 2
Query: 1286 DDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTS-FDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDD-FSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPK----FIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGL--FQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSA--QITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEY 2560
            DDFSL ++E  +        I  + +       + R  + C+      Q    E  V+++D+ND++P F RS + +E+SE+   GT +      DLD     N    Y + E+ R    L     R + + AK     + S  DRE+      +LT  D             S ++ V + + D NDN+P+F++T    T+ E+      +  L ATD D+G NG++ Y       ++V+  F LD  TG L+ K ++D E  S +E  ++ARD G     +   V+V V DINDN P+    FI  +    TV  S  ++  + +  V   D D A    +   + G   + L  ++ D  V   S   + +  D   YFL+++ +D   P R A  Q T+ +  E   +  +   +++  E   +E++S   Y
Sbjct:   70 DDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAE--VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGG--NALRAYHLDENERFGLAL-----RARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGG-------DPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQS-RGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMAD---YFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRF---HRSTYEASLLENNSPGAY 481          
BLAST of Protocadherin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.312 bits (547), Expect = 5.894e-57
Identity = 206/789 (26.11%), Postives = 334/789 (42.33%), Query Frame = 2
Query:  218 SENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIK-EDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDM-----NHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGI------------------SFA--------KKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            + N ++   IV     G   L  P         +++  V      E I      +   DN K        ++++ + D+NDH+P F        +SE     S      A D DS   +  RY     +   +F ++   ++TG +        ++DRE  S   L + A D G  PKT   ++ + +LD ND  P+  Q   ++   E++L    ++ + A D D GEN  + +     N   DM       FR+D ++G +T  + +D + ++  P   L++  QD G P  L STA +T++V D+ND  PV   +  F+       ILEN      V  V   D D G NG V+  L   +        + N V       + T+V LD E+ ++Y+L +   D GH +  +   + + V D  D  PTF R      + EN  PGTL+ +++ + LD     N    Y I    ++        G   +E +  RI++  + DRE+ +  +  +  +            +  +S +V+VH  D N++AP+F +  YE +I E++P N     ++ATD+D G NG++ Y+I +   +    F + F  G L  + ++DRE    +   V A D G     S   V V V D+NDN P F   +   H      +    +L+  V A D D      +TYS E   P   F++DS  G I                  SF+         +PKP   R+   +     ND+P + A+      V ES
Sbjct:  261 TANGELSVSIVGGNERGHFVLHAP-----GVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVD---ESTGLVT----TDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY-----NFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYP---LVVQAQDRGSPP-LGSTAKVTVVVGDLNDNHPVFYPVQYFA------SILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGD----AARFQVNAVTG----AVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD----LNANVTYLIVSGDQR--------GSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG--------VAGEASVSVLVH--DVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGE--GNGGEKFGI-FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCE---EQEVGSLVGAVQATDADAGSNGGVTYSFE--KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSES 984          

HSP 2 Score: 206.838 bits (525), Expect = 2.930e-54
Identity = 190/710 (26.76%), Postives = 308/710 (43.38%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSI---QSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKID-DFSSDVQNSFTLDFNTGTLTTKSKIDREKIS-IFEFKVKARDQG---HPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVG 2353
            I  S GRI     IDR+                 +   QL+ V     N      +   +VL+   D+N+H+P F      ++I+E E ++S      A D DS K    +Y   E +   +     D       QL V+  LDRE   E+ LTV A D GV P + S+ V + +LD NDN P+    S +    E+  V   +  ++A D D G N  +++  ++P V     +F +D  +G I   R  D +++            +   D G+PK L   AT+ + V DVND  P       F++   +  + E+  +   +  V   D D G+NG ++     Y  +   E  ++    D    +I     LD E+ + Y L++  +DSG     A   + V+V+D NDN P F  S + ++  E+   G LL T+  +D D     + R+   ++ +    F ++   G          ++     D E        ++  D  R   S           ++VH++D NDN P F       +I E  P    V  + A D D   NG++ Y I   F       FT+D  +G + T ++IDRE    +FE  V+A D+    H  R ++ NV V V+D NDN P+F+ PT     +   ++++  +++  + A D DEA    + Y++ GGD   LF++D   G
Sbjct:  706 IEWSGGRIFTANAIDREE----------------QAFYQLRVVA----NSGGVAGEASVSVLVH--DVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDG------QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQV-----NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPP------QFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALR-----YAINEGNEGGKFT--VDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRY-AIVAGNTHATFAIDRSTGS---------VFLARRLDFETQRLYRLNVSAEDGGRPPRSSAT-------ILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAH--FTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTA---ILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTG 1347          

HSP 3 Score: 197.208 bits (500), Expect = 3.341e-51
Identity = 218/779 (27.98%), Postives = 344/779 (44.16%), Query Frame = 2
Query:  200 VNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLP-------MAHDPDSSKFSINRYYF-----HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISES-GRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKI------SIFEFKVKARDQGHPGRYS-IANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            + +  VS N   L +  +++STG +T    +DR+               +S  ++ + A     D    P T    ++ + + D+ND  P F   K V    E       + LP        A D D  +    RY F      +    FR++     TGK+     +KS LDREE+ E+ L V A D G PP   +  V + + D NDN P+   +    SI E+      +  + A D D G N  + + L       D   F+++ ++G ++    +D +  +++ Q++  +T  D G  +   S A +TI V D  D  P       F+R      + EN+    LV  V+    D  LN  V   LI   D     +IE++        +I T   +D E+++ Y+L +  +  G      +  + V V DVN+++P F R+  E+ ++E+EP  +   ++  TD D    +NG   Y I E  G + F + P +G         ++Y     DRE  +  E+ LTVS  +          LSSS TV V + D NDN P+F+ + Y F   EE+     VG +QATD D G NG ++Y  +      Q +F LD  TG + +    DRE +      + F F V A D G P      A V V V D+NDN P+F       +  S S  +S  T +++V A D DE     + Y+I  G+  G F +D++ G I+        +  SY L++  TD+     +A  T+ V+V
Sbjct:  376 LRYSIVSGND--LGWFSVDESTGLVTTDGKVDREV--------------ASSVVLNISA----QDQGAQPKTAY-TSLTVTLLDVNDEPPLFTQTKYVATAVE-------NSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSL---TGKVT---TLKS-LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL----TAGDAARFQVNAVTGAVSTRVSLDREE-RAVYQLQ--VTALDGGHLRA-RSPAIVTITVADAQDTPPT------FARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTY-LIVSGDQRGSFSIEWSG------GRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDS--GKNGEVKYEIGEGNGGEKFGIFP-DG---------QLYVRYELDRE--TREEYSLTVSAMD-----TGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE----KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSV---YQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQV 1067          

HSP 4 Score: 185.652 bits (470), Expect = 1.039e-47
Identity = 198/763 (25.95%), Postives = 322/763 (42.20%), Query Frame = 2
Query:  245 IVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE--QLSP----ISIKEDTLVDHHIIRIEAKDKDT------------GENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENG----RFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHV 2467
            IV     GR+   RP+ + +         ++   +    + ++A     ++  +P       V + + D ND+ P F  +K     S AE              DS   +  R   H       +      TG +      +  LD E   ++ L++ A+D G PP +G    +I++LD NDN P I    L P     S+ E          +   D D+            G NE   F L  P V       R      V+ +A Q+D + I   P   L I   D+GKP   S+TA+L + V DVND  P       F+       + E   +   V  V   DAD GLN +++  ++   D      + + +V D+    + T  K+D E  S   L I   D G   +TA   L V ++DVND  P F +++      EN  PG  + +++  D D    ENG     FD  +    R++FRL+ + G         ++ +L S DRE++   E+ L V   +R S      +      V V + D NDN P+F   QY  +I E +P    V  + ATD D+G NG + Y++   ++     F ++  TG ++T+  +DRE+ ++++ +V A D GH    S A V + V+D  D  P F     ++++       +  TL+  V+A   D      +TY I  GD  G F I+ + GG  F       + ++++ L  V ++   +  A +++ V
Sbjct:   65 IVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQA-----EDGGSPRRYGRLQVNVTVQDANDNPPAF--EKPAYRASVAE--------------DSPVGAALRDLLHRGRGPLAVPF-DPKTGMV----STRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPG----LR------VLKVASQLDRERI---PMYNLTILASDNGKPVARSATASLVVYVNDVNDHAP------RFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGND------LGWFSV-DESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDL--GENGTVRYNFDPDMPAQYREMFRLDSLTG---------KVTTLKSLDREELE--EYPLVVQAQDRGSPPLGSTAK-----VTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL---TAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFAR---DDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWS-GGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLV 748          

HSP 5 Score: 184.496 bits (467), Expect = 2.986e-47
Identity = 187/656 (28.51%), Postives = 285/656 (43.45%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVVI----NISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR-FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIR-----IEAKDKDTGENELISFFLKEPNVQNDM--NHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGY--EDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSG-HPKQTAQQELIVKVI--DVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTIS----------ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENT-----LIMKVNALDYDEAGKNQITY 2299
            V I + D+ND+ P F   ++ +    N  E E I +      A D D  + ++  Y     S   F ++            LR   RLDREE + + LTV ASD G       ++V +R  D NDN+P   + +    + ED   D    R     + A D D+G    +++ L  P+  +D     F +  ++G + + R +D +S        L     D G    L++TA L + VLD ND  P +    L +      E+ E+      +  ++  D D G+N +++  +     E  F++ N          + ++     LD E++S Y L++R SD   HP       + V +I  DVNDN+P F   R  L   E+ P G ++ T+   D D     N   +Y ++           +G   F L  V G  +L         +   DRE   +    +   D  R  ++ T        T+ V + D NDNAP F + +YE  I E++P    V  L A D D+G NG++ Y I   S D    F LD   GTL     +DRE+ + +E  V+ARD G P R   A+V V +SD+ND  P F    +  +TV A     ENT     LI++V A D D     Q+TY
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLS----ATDADQGQNALVTYSVLSGSEGAFVVDAASG-------VLRASRRLDREERASYLLTVRASD-GTHATDARLSVAVR--DANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALA-PSEDSDWADGAFGLHPVTGALNVTRPLDRESRACY---VLRARATDGGG---LAATARLYVNVLDANDNAPSVQNDSLAA------EVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGN----------DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALA-PEDSPVGAVVATVQAVDPDS--GRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRL---------VRELDREARQSYALTVLAVDKGRPPLTSTA-------TLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDI--ASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAF---QLSPYTVHA----RENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 6 Score: 181.8 bits (460), Expect = 1.631e-46
Identity = 168/598 (28.09%), Postives = 268/598 (44.82%), Query Frame = 2
Query:  737 PPKTGSINVIIRILDENDNAPI--IEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQ-----SNQLVAYVNVHDADHGLNGQVKCDLIGYED-DFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKI-------DDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE--NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            PP +    V I + D NDN P+  + ++  + ++E+T     I  + A D D G+N L+++ +    +      F +D  SGV+  +R++D +   S      ++TV+        ++ A L++ V D ND  P       FSR     ++ E+       +  ++  V   DAD G  G+V   L   ED D++      + V        VT+  LD E  + Y L  R +D G    TA+  L V V+D NDN+P+     +  E+ E+ PPGT L  I+ TD DE    N   +++IS SG    R   V   G+L  A+       + DRE+ S     + VSD  R   +    ++     V + + D NDNAP F+  +      E+ P    V  +QA D D G N  + Y +          +      F L+  TG +    ++DRE    +   V A D+G P   S A + V V D NDN P+F     E     A+I   E   T +++++A D DE    ++ Y I  GDP G F++D  +G ++ A+        SY L ++  D   P+RS   ++ V + +
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEME-LEVEENTGEGEVIFTLSATDADQGQNALVTYSV----LSGSEGAFVVDAASGVLRASRRLDREERAS-----YLLTVR--ASDGTHATDARLSVAVRDANDNSP------RFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALN---VTR-PLDRESRACYVLRARATDGGGLAATAR--LYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDE--GVNAELEFSIS-SGDPEGRFA-VGNDGQLSVAR-------ALDRERQSFYNLVVRVSDRARHPPARLSSAVR----VSLILTDVNDNAPAFTSPRSALA-PEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYE-----AAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSD 2046          

HSP 7 Score: 177.948 bits (450), Expect = 3.136e-45
Identity = 193/691 (27.93%), Postives = 303/691 (43.85%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVV-INISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSR----------LDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPA--RPEILENLQSNQLVAYVNVHDADH-GLNGQVKCDLIGYED--DFSLENIEYNNVKDQFEYKIVTKV--KLDCEKESLYRLIIRCSDSGHP-KQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKID-DFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE--NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDH 2434
            V + + D+ND++P+F    V+ +   E   +     L  A D D     +N    H A +      + +  G+++P   V  R          LDRE    + L V A D G P + G + V + + D NDN P  E+ +   S+ ED+ V   +  +  +    G   L   F               D  +G+++  + +D+++ +   Q  L +   D G P  LS  AT  I +LDVND  P I  + L    PA     + E+     + A V V DAD    NG++   ++G  +   F L       ++       V KV  +LD E+  +Y L I  SD+G P  ++A   L+V V DVND++P F  S     LSE  P G+ +   +VT +D     N +  Y+I  SG  L       G   ++ +   + +    DRE  S++   ++  D   +         ++ +++ V + D ND  P+F++T+Y  T  E     LFV  + A D D G+NG + Y  D D  +  +  F LD  TG +TT   +DRE++  +   V+A+D+G P   S A V V V D+NDN P F YP        ASI  +E   T +  V A D D      + Y +  GD    FQ+++  G +S        +   Y L +   D  H
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVN----HHAYKI----VSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHR----GRGPLAVPF---------------DPKTGMVSTRQPLDFEARR---QYTLSLRAADGGNPP-LSGRATAVIQLLDVNDNDPAIRFVYL---PPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLR-------VLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVK--DVTAMDADSGLNAKLRYSIV-SGNDL-------GWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQ-------PKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPV----QYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGD-AARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGH 635          

HSP 8 Score: 175.252 bits (443), Expect = 1.798e-44
Identity = 198/724 (27.35%), Postives = 303/724 (41.85%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEK------ESLYRLIIRCSDSGHPKQTAQQELI-VKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSEN----TLIMKVNALDYDEAGKNQITYSIEGGDPYGL-FQIDSNVGGISFAKK 2374
            +N  TG ++ R  +DR+                   + QL+ V  L   H     +    V I + D  D  PTF  D     + E     +P  L  +    +   + N  Y     +    F IE +    G+I       + +DREE + +QL V+A+  GV    G  +V + + D N++AP+ ++ S  +SI ED  V+     + A DKD+G+N  + + + E N       F   Q+     L R+       +  +  L ++  D G  + LSS+ T+ + VLDVND  P      LF+         E  +   LV  V   DAD G NG V          +S E  + N   D    +I +    D E        + +   +  +D G PK    +  + V V DVNDN P F +S  +  +SE+    T L  +  +D+DE    NG   Y I+E            G+  ++++  +I  L S DRE+  T  + L VS T+  +            TV V + D NDN P F+++       E       +  L A+DED G +G + Y I   + +   +F +D +TG++    ++D E   ++   V A D G P R S   +VV V D NDN P F+        V ASI   EN    T ++ V A D D     ++ YSI    P G  F ID   G I  A +
Sbjct:  603 VNAVTGAVSTRVSLDREE----------------RAVYQLQ-VTALDGGHLR--ARSPAIVTITVADAQDTPPTFARDDYSFVVFENV---APGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSG---GRIF----TANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRE-------TREEYSLTVSAMDTGV-EPLSSSVTVNVTVLDVNDNKP------LFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVT---------YSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDE--GVNGALRYAINEGNEG--------GKFTVDASTGQITLLGSLDREE--TASYTLVVSATDSGTSPLAASC-----TVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI--VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL-----PGDVFASIM--ENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAE 1245          

HSP 9 Score: 160.614 bits (405), Expect = 6.566e-40
Identity = 155/570 (27.19%), Postives = 242/570 (42.46%), Query Frame = 2
Query:  380 VQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEI------SEHQLTVIASDAGVP-PKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREK 2065
            V  +D    PL+     V + + D+ND+ P F S   V +  E + + S      A D D+       Y F +    F ++     TG+I   LRV    DRE +      +    +V+A+D G P P      V + + D NDN P   + +   S+ E       ++R+ A D D G N  + + + E    N+   F +D  +G ITL   +D +   S     L+++  D G    L+++ T+ + VLD ND  P       F+      + LE+ +  +L+  +   D D G +G V+  ++         N       D+    +    +LD E + LYRL +   D G P +++   L+V V D NDN P F    +   + EN P GT + T+   D D     NG   Y+I+       R  P      ++     I +    DRE    + FE+TV  T++     T RS   + TV+V   D NDNAP F                  VG LQA+D D+ +N  + Y +     D    F LD  TG + T +++DRE 
Sbjct:  832 VSAMDTGVEPLSSS-VTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDS---ETGRIA-SLRV---FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINE---GNEGGKFTVDASTGQITLLGSLDREETASY---TLVVSATDSGT-SPLAASCTVAVQVLDENDNPP------RFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVA-------GNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDA--DVNGELHYSIA-------RQFPPGAHFTIDPESGEICTAAEIDREVTGGL-FEVTVRATDKAIPVHTRRSALKNVTVLV--TDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVT--GGDAAILFRLDRRTGIIETSTELDRES 1359          

HSP 10 Score: 153.68 bits (387), Expect = 8.740e-38
Identity = 191/791 (24.15%), Postives = 343/791 (43.36%), Query Frame = 2
Query:  200 VNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSS-----KFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISE-HQLTVIASDAGVPPKT---GSINVIIRILDENDNAPIIEQLSPISIKEDTL---VDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLV----AYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFE--YKIVTKVKLDCEKESLYRLIIRCSDSG-----HPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEE-----KPQNLFVGLLQATDEDQGDNGKISYKI--DDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASI--QSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDND-HPSRSAQITIHVKV 2473
            V +  V+ NT   +   I++STG + L R +D     E  +L    L+ S+E            D  + P +     +++ + D ND+ P F    V  +I E   I +      A DPD+       +SI R +   A   F I+     +G+I       + +DRE      ++TV A+D  +P  T      NV + + DENDNAP    ++P +I  D L       +  ++A D D  EN  + + +   +       FR+D+ +G+I  + ++D +S      +E++        P+   +  T+    +  N  +P         R P   E   NL   Q +    +Y+ +    H L+ + +  L+ +     L     + V +  +  +++   +   C       L+    D+G      P  ++  ++ + V DVNDN P F    +ELE+ EN   G ++ T++ TD D+   +N    Y++         L   EG   +++A   + +    DRE+ ++    +  SD    + +           + V ++D NDN+P FS+  Y F + E+     K     +G + A D D G  G+++Y +   + S     +F L   TG L     +DRE  + +  + +A D G  G  + A + V V D NDN      P+++N +++A +   +   T +++++A D DE    ++ +SI  GDP G F +  N G +S A+         Y L+++V+D   HP   A+++  V+V
Sbjct: 1112 VRYAIVAGNTH--ATFAIDRSTGSVFLARRLD----FETQRLY--RLNVSAE------------DGGRPPRSSATI-LVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGA--HFTIDP---ESGEIC----TAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRF--VTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDA---AILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLP---------RFPQDYESPINLLQGQTIPMPSSYLFLR---HHLDWEPEGQLVFFT--LLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQ--GQNALVTYSV---------LSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDAR----------LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDN-----APSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV-GNDGQLSVARALDRERQSFYNLVVRVSDRARHP--PARLSSAVRV 1822          

HSP 11 Score: 136.346 bits (342), Expect = 1.574e-32
Identity = 143/590 (24.24%), Postives = 249/590 (42.20%), Query Frame = 2
Query:  761 VIIRILDENDNAPIIEQ--LSPISIKEDTLVDHHIIRIEAKDKDTGENEL--ISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTF--------GRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI---SESGRKLFRLEPVEGRGKLESAKLRIYSLTS-FDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYG---LFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP--SRSAQITIHV 2467
            V + + D NDNAP   +  +  ++ KED  V   ++   A D+D G N +   ++ +   N +  +   R       + LA     D  ++ P   L +  +D G P++      + + V D ND  P       F +   R  + E+           + D  H   G +                      D     + T+  LD E    Y L +R +D G+P  + +   +++++DVNDN P           RS     + E+  PGT+   + VTD D +   NG    +I   +E G  +     V G        LR+  + S  DRE+I      +  SD  +        + S++++++V++ D ND+AP F+ + Y   ++E  P   +V  + A D D G N K+ Y I   S +    F++D +TG +TT  K+DRE  S     + A+DQG   + +  ++ V + D+ND  P F   T   +  +A   S     ++ V+A D D      + Y+ +   P     +F++DS  G ++  K     +   Y L+++  D   P    +A++T+ V
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDR-EANPSYALAVQAEDGGSPRRYGRL-QVNVTVQDANDNPPA------FEKPAYRASVAEDSPVG-----AALRDLLHRGRGPLAVPF------------------DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARS---ASVDESAAPGTVAALVTVTDAD-SPTANGELSVSIVGGNERGHFVLHAPGVPG--------LRVLKVASQLDRERIPMYNLTILASDNGKP------VARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI--VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLF---TQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVV 544          

HSP 12 Score: 136.346 bits (342), Expect = 1.818e-32
Identity = 149/539 (27.64%), Postives = 222/539 (41.19%), Query Frame = 2
Query:  422 DCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLP-----MAHDPDSSKFSINRYYFHE------ASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGK--PKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTK-----VKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKL--FRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQ--ATDEDQGDNGKISY 1969
            D  + + + D ND+SP F       +++E    D           +A D DS  F    Y          A   F +         +   L V   LDRE  + + L   A+D G    T  +   + +LD NDNAP ++  S    + ED      ++RI A D D G N  + F +   + +     F +    G +++AR +D +  QS     L++ V D  +  P +LSS   +++I+ DVND  P  +        P      E+     +VA V   D D G N  V+  L     D              F    VT       +LD E    Y L +   D G P  T+   L V V D NDN+P F R   E  ++E+EPPGT +  ++  D DE    NG   Y I+ SG     FRL+PV   G L  A+         DRE+ ++ E  +   D           + S +++V V + D ND +P F  + Y      E  Q   V +LQ  A D+D G +G+++Y
Sbjct: 1600 DARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLH-------PVTGALNVTRPLDRESRACYVLRARATDGGGLAATARL--YVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEG---RFAVGN-DGQLSVARALDRER-QSF--YNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-------SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYAL---ATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDE--GANGELRYDIA-SGDPTGDFRLDPV--LGTLAVAR-------PLDRERTASYELAVRARDGGGP-------ARSDTASVRVTLSDVNDCSPAFQLSPYTVH-ARENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 13 Score: 113.235 bits (282), Expect = 2.148e-25
Identity = 119/449 (26.50%), Postives = 181/449 (40.31%), Query Frame = 2
Query:  263 TGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPM----AHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASD-AGVPPK--TGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLK------EPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYE--DDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENE--PPGTLLTTI 1558
            TG + + RP+DR+S        C  L   +     L A  +L             NVL    D ND++P+  +D +   + E    D+P    +    A D D    +   +         R     D       QL V   LDRE  S + L V  SD A  PP   + ++ V + + D NDNAP           ED+ V   +  ++A D D+G N  + + L                 F ++ ++G + L R++D ++ QS     L +   D G+P  L+STATL + V D ND  P       F R+     I E+      V  ++  D D G NG+++ D+   +   DF L         D     +     LD E+ + Y L +R  D G P ++    + V + DVND SP F  S   +   EN   PP  +L  +
Sbjct: 1680 TGALNVTRPLDRESR------ACYVLRARATDGGGLAATARLY-----------VNVL----DANDNAPSVQNDSLAAEVPE----DAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDG------QLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSY---ALTVLAVDKGRPP-LTSTATLAVTVGDANDNAP------RFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRL---------DPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVV 2078          

HSP 14 Score: 78.5666 bits (192), Expect = 7.268e-15
Identity = 93/360 (25.83%), Postives = 146/360 (40.56%), Query Frame = 2
Query: 1427 KQTAQQELIVKVIDVNDNSPTFGRSRI-ELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDP--KFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKN-QITYSIEGGDPYGLFQIDS-NVGGISFAKKPKPTDARS---YFLLIKVTDNDHP-SRSAQITIHVKVEE 2479
            + T   E+ V V DVNDN+P+F    + E+   E+   G  +      D D          Y I  SG +  RL P   R   + A L + +    DRE   +    +   D       G  +       V V ++D NDN P F K  Y  ++ E+ P       + A   D    G+    +             D  TG ++T+  +D E    +   ++A D G+P     A  V+++ D+NDNDP  +F+Y      + S    ++  T+   V   D D    N +++ SI GG+  G F + +  V G+   K     D      Y L I  +DN  P +RSA  ++ V V +
Sbjct:    2 QPTYPTEVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIV-SGNEEGRLVPP--RPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQ-------VNVTVQDANDNPPAFEKPAYRASVAEDSP-------VGAALRDLLHRGRGPLAV-----------PFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVND 333          
BLAST of Protocadherin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 3.984e-53
Identity = 188/676 (27.81%), Postives = 308/676 (45.56%), Query Frame = 2
Query:  425 CNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLN-GQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSG--HPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEF----ELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDN 2428
              V I + + ND+ P F      +++ E  T+ +     +A D D+  F    Y+F + S  F ++            + V + LD E      +TV+A D G     G +   I +LD NDN P+ ++ S + + +E+      ++R+ A D+D+  N  I++ +   +  +      +    GV+TLAR +DY+ I     I L I   D G P  L+ST T  + V D ND  P+      F R      I EN+ +   V YVN  D D     GQ+   LI     +SLE      +  +    I +   LD E  S Y LI+R  D G  + ++T    + + ++DVNDN P +      + + EN P GT + T++  D D    ENG   Y I +     +R+    G       K+R   L   DRE ++ I F     + VS  +R S      + +   TV V ++D NDN P F    Y   + E  P N  +  + ATD D+G NG ++Y +   ++  +  F LD  TG +TT  ++DRE ++ ++ ++ A D+G P   S   + + V D+NDN P F +P     ++  S+  + +++++ +N  D D     ++++ I GG+  G F +    G +            SY L+I+  DN
Sbjct:   14 ARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASG-------LISVAAALDFEATPRFTVTVMARDGGGQETAGRVR--INLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPG-GTISLTIMALDGGSPP-LNSTVTAIVEVFDENDNSPI------FDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLS--LI-----YSLEGSTQFRINAR-SGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDL--NENGTLVYAI-DPPNPFYRINAASG-------KIRTTGL-QLDREDLNPISFASMRSIVVSGADRGSPPRRATASA---TVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMT--AALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF-HPARSAVSLMESV--ARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDN 645          

HSP 2 Score: 174.481 bits (441), Expect = 3.724e-44
Identity = 184/666 (27.63%), Postives = 290/666 (43.54%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEH--QLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGE--NELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPK-QLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEK------ESLYRLIIRCSDSGHPKQTAQQELIVKVI--DVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISES-GRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPG--RYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKP 2377
            V I + D+ND++P F  D  V    E +   +P     A D DS   +   Y     S +        + G  +  L     LD E+I      LT++A D G PP   ++  I+ + DENDN+PI ++ S  I+I E+ L    ++ + A D D      +L   +  E + Q     FRI+  SG IT    +D +++    Q  LI+   D G    Q +  AT+ I +LDVND  P       +   P    I+EN      +  V+  D D   NG +    I   + F   N     ++        T ++LD E        S+  +++  +D G P + A     V V+  DVNDN P+F      L++ E  P  + L  +  TD DE    NG   Y+++ +  R  F+L+   G          I +L   DRE ++  +  L  +D    ++S T        T+ + + D NDNAP F   +   ++ E   ++  V  L  TD D G N ++S+ I   + D Q  F++ F  G + T   +DRE  + +   ++A D G  G  R     + V V D+NDN P F+  + E   VS     +   +I++V A D DE    ++ Y I  G+  G F ++ + G IS    P
Sbjct:  117 VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTL--ARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ-----FRINARSGDITSTTLLDREAVS---QYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPA------WRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTL-VYAIDPPNPFYRINAASGKIR-------TTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDE--GANGNVTYSMTAALPRPDFQLDAATGL---------ITTLVQLDREAVAAYQLRLVATDRGTPALSSTT-------TLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQ--FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYE---VSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATP 735          

HSP 3 Score: 171.785 bits (434), Expect = 2.656e-43
Identity = 171/646 (26.47%), Postives = 289/646 (44.74%), Query Frame = 2
Query:  245 IVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTF----FSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVP--PKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVI-TLARQIDYDSIQSLPQIEL---IITVQDHGKP-KQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGY--EDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLT-TKSKIDREKISIFEFKVKARDQGHPGRYSIANV 2137
            I ++   G +TL R +D     EK+    + L             +  LD    PL       ++E+ D ND+SP F    +S  +  NI    T+   +       P+  + S+   Y  E S  FRI      +G I       + LDRE +S++ L V A D G     KTG   V I +LD NDN P    L   ++I E+T     I  + A D D  EN  + + +  PN       +RI+  SG I T   Q+D + +  +    +   +++  D G P ++ +++AT+T+++ DVND  P       F   P   ++LE L +N  +  V   D D G NG V   +       DF L         D     I T V+LD E  + Y+L +  +D G P  ++   L + V+DVNDN+PTF  +R  + L E+    +++ ++N TD D     N    + I+   +        +G+  +      + ++ S DRE  ++    +   D             + ++T+ V + D NDN P+F +  YE ++ E   +   +  +QATD D+G NG++ Y+I   S +   +F ++ ++G ++   + +DRE +++   +V+A +    G  S+  V
Sbjct:  182 ITVSGGYGVVTLARALD----YEKIPGGTISL------------TIMALDGGSPPLNST-VTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSL--IYSLEGSTQFRINA---RSGDITS----TTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPN-----PFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPS------FVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQL---------DAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADS--GLNAELSFFITGGNQ--------DGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNG-----PAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRI--ISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFNNDSVGLSSVIRV 764          

HSP 4 Score: 164.081 bits (414), Expect = 5.306e-41
Identity = 165/596 (27.68%), Postives = 259/596 (43.46%), Query Frame = 2
Query:  749 GSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLI---GYEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEK--ESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSF-TLDFNTGTL-TTKSKIDREKISIFEFK------VKARDQGHPGRYSIANVVVKV--SDINDNDPKFIYPTIENHTVSASIQSSE----NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            GS  V I +++ENDN PI    L  +S+ E+  +   ++++ A D D G    +S+   +     D + F +D  SG+I++A  +D+   ++ P+  + +  +D G  +   +   + I +LDVND  PV      F R        EN  S   V  V   D D   N Q+   ++    Y   FS        +     Y +VT  + LD EK       L I   D G P   +    IV+V D NDNSP F R+   + + EN   G  +  +N TD D++  E G+     S  G   FR+    G          I S T  DRE +S  ++ L V   +    +     ++   TV + + D NDN P +    Y  TI E  P    +  + A D D  +NG + Y ID       N F  ++  +G + TT  ++DRE ++   F       V   D+G P R + A+  V V   D+NDN+P F+        +  ++Q  E    N+ + +V A D DE     +TYS+    P   FQ+D+  G I+   +       +Y L +  TD   P+ S+  T+ + V
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSD-----DSDKFSLDPASGLISVAAALDF---EATPRFTVTVMARDGGGQE---TAGRVRINLLDVNDNTPV------FQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFS--------ITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQS-PEYGQLSLIYSLEGSTQFRINARSGD---------ITSTTLLDREAVS--QYILIVRAVDGGDGNDQKTGIA---TVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDP-----PNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFV-------GLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVV 555          

HSP 5 Score: 157.532 bits (397), Expect = 6.925e-39
Identity = 152/596 (25.50%), Postives = 255/596 (42.79%), Query Frame = 2
Query:  740 PKTGSINVIIRILDENDNAPIIEQLS--PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISE--SGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFV----GLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTG--TLTTKSKIDREKI--SIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGG--DPYGLFQ---IDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVE 2476
            P   + +V+IRI DENDNAP     +   +  +  +     +  + A D D G+N  + + +   N       F ID  +GV+T  + +D++    L  + +  T Q     ++L+STAT+++ V DVND  P       F R    P  +   Q    +A     D D GLNG+++  +I    D    N E+       + ++   V+LD E ++ Y L I   D G P   +   + V+V+DV+DN P F        LSE      +++ +  +D +E         ++ +   +G + F  +   G          +Y     DRE+++     LTV    R +      +   S  +IV I D NDN+P+FS+  YE  I E  P    +    G + A+D D G N  ++Y +   SS     F +D + G  ++     +DRE I     E  +  +D G   R +   + V V D+NDN P F   +   H +  S     + +++K    D        + YSI  G  D +G+ +   +   V  I +  +P+      Y L++  TD   P  +A   + V ++
Sbjct: 1151 PAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAAT---FGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTP------WFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSII----DGDPRN-EFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGL---------VYVNRPLDRERVAEYRLTLTV----RDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAY---FLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPE------YLLMVVATDQAPPFHTASCELRVSLQ 1708          

HSP 6 Score: 138.658 bits (348), Expect = 3.665e-33
Identity = 196/789 (24.84%), Postives = 314/789 (39.80%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVE-----LHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPH-PLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIP---QLRVKSRLDREEISEHQLTVIASDAG-------VPPKTGSINVIIRILDENDNAPIIEQLSP--ISIKEDTLVDHHIIRIEAKDKDTGENELISFFL-KEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELI-ITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDL-IGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIF--SKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKI---DDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRY-SIANVVVKVSDINDNDPKFI-YPTIENHTVSASI--QSSENTLIMKVN-ALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKE 2524
            I++STG I    PID ++  E + +          H +S C  +L+  +Q   + K   +       +        S       VV+ ++  +    P  PLP+A         I    +HE  R  + E   DN   I     ++  ++ LDRE    + LTV++ D G       +  K G+  V + + DENDN+P  E  S   + ++E       +  + A D+D G N  +S         +    +  I Q    +T+      D ++   Q  L  I   D G P + S+T  L++IVLDVND VP+       S       ++E      LVA V   DAD G NGQV   +  G  D  S+              ++     +D E  + Y L++   D G+P  +    + V V DVND  P F      + + E+   G+ + T+  T  +     N ++ Y I+  G+  F +      G + S +L    L S++R       F LT   T+        ++      + V + D ND+ P+F          ITE  P  + +  + A D D+G NG + Y         S    SF ++  +G ++T   +DRE  +++   + A DQG P  Y S   + V + DI+DN+P FI  P       S SI   S   T +  V+ A+D D      + Y I  G+    F +                    + LL+ ++D D   R       + V+ S    + P   TG E
Sbjct: 1662 IDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTAS-C--ELRVSLQNELDEKLSFSLAAYQAAL--------SEAAVPGTVVVRVAAPQMKAPPKLPLPLA---------ILVQKWHEDKRHKQQE--SDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAY-VYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPR-STTFNLSVIVLDVNDNVPI-----FLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIG-------PSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKAT--ENYKGHNTKYTYKIAGIGKNAFTVHATS--GLVTSTRL----LKSYER-------FNLTAVATDHGRPPLWGQAG-----LYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLS------------------RWGLLVVLSDLD---REVSPYYAIIVKASSNPNWTPAVTTGPE 2373          

HSP 7 Score: 129.413 bits (324), Expect = 2.491e-30
Identity = 184/719 (25.59%), Postives = 302/719 (42.00%), Query Frame = 2
Query:  164 CGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI---TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEA-ETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDRE-EISEHQLTVIASDAGVPPK---TGSINVIIRILDENDNAPIIEQL--SPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQE---LIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTIN--VTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELT--VSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQ-NLFVGLLQATDEDQG--DNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNA 2260
            C G+  +   +T++  F    +QI + + I+ ++G +   TL +           +LC   L + +       A  + +    TP  Q   +VLI ITD ND++P F +    + ++E   T         A DPD    +  R  +   S         DN   ++  ++    LD E     + L V A+D    P    T +  V + + D ND  P   +    PI + E       I    A D+D+G N  + + + + + +N+   F I    G + + R ++ D  ++     L I  +D G P  L+ST T+ + VLDV+D  PV      F   PA   + E      +V+ V   DA+ G N    C  +      S  N E     D     +     LD E+ + YRL +   D+      A+++   +IV ++D NDNSP F +   E E+ EN P GT+LT +N  +   D     N    Y++       F ++    RG +  A  +       DRE I     ELT  V D  R++ +             V + D NDN P F+ T     + E  P     V +++A D D G  D G + Y I   +S   ++F +D +TG + T + ID E    +   V A DQ  P  +  A+  ++VS  N+ D K  + ++  +  + S  +   T++++V A
Sbjct: 1075 CAGATTL---TTLSRGFEMSISQIEAAVTISGASGVLSEATLNKQASIKITTITQRLCTKVLVKRAA-----SASTRGICLTATP-AQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNA--RVVYAIVSGNTAATFGIDNGTGVLTAVKA---LDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQ-PGPRIATFMASDQDSGLNGELEYSIIDGDPRNE---FVISPADGDLRVRRYVELDR-ETQAFYNLTIMAKDMGTPP-LNSTLTVGVRVLDVHDNDPV------FLNLPANASLSEAAAVLAIVSRVRASDANEGRN----CAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLID--RDRGNVSMALGQ-----GLDREGIPGGRLELTILVQDGGRRNATVRLG---------VTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSI---ASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPP--FHTASCELRVSLQNELDEKLSF-SLAAYQAALSEAAVPGTVVVRVAA 1741          

HSP 8 Score: 114.005 bits (284), Expect = 1.129e-25
Identity = 161/661 (24.36%), Postives = 269/661 (40.70%), Query Frame = 2
Query:  431 VLIEITDINDHSPTF-FSDKVVINISEAETIDSPHPLPMAHDPDS-SKFSIN-RYYFHEASRFF--RIECTQDNTGKIIPQLRVKSRLDREEISEHQL-TVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP----ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG------RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIF-----SKTQYE-FTITEEKPQNLFVG-LLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGH------------PGR-YSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSI 2305
            V + +TD ND+SP F      ++ + E+    +   +  A D D+ S  +++ R + H  +R     I   Q+ +G  I  +     +  E+ S+  L  ++A D G PP++ + N+ + +LD NDN PI   LSP    +S+ E       +  + A D D G N  ++F ++        +   I    G+I +A   + D  ++     L++   D G P  LS +A + ++V DVNDE P       F        +LE+L     VA V   +   G N +           + +  I  N         +VT  +L    E  + L    +D G P    Q  L V+V+DVND+ P F        ++  E    ++  + V  +D  + +NG   Y+   +G       + FR+    G          I +  + DRE  +     L  SD  +     + + L       V + D +DN P+F         Y+ F+I E  P    VG +  A D D G N  + Y I   + +  N F L    G L   S +DRE    +   VKA    +            P +  ++  V V + DIND  P F   T   +T   ++ +   + ++++ A+D D    + + Y I
Sbjct: 1825 VYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFV--EKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF--LSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIE----SGGGDKLSIGPSDGIIRVAPGANIDR-ETRAAYTLMVVAVDRGNPP-LSGSAIVRVLVDDVNDERPA------FLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYT---------YKIAGIGKNAFTVHATSGLVTSTRLLKSYER-FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSG---------IISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQ------VVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFI--AAGNEGNKFNLS-RWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVF---TNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 9 Score: 61.2326 bits (147), Expect = 1.753e-9
Identity = 71/272 (26.10%), Postives = 113/272 (41.54%), Query Frame = 2
Query:  395 NHKTPLTQKDCNVLIEITDINDHSPTFF--SDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRF-------FRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDE-NDNAPIIEQL----SP---ISIKEDTLVDHHIIRIE-AKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID-YDSI----QSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVIS 1141
            +H  P       + +E+ D+NDH P F    +  V+NI+E   +       +A D D  +    RY F  A          FRI  T      II   R    LDRE  + + L ++ASD G P    S   +  +LD+ +DN P+   L    +P    SI E +     +  +  A D D G N ++ +F+   N  N  N  R   +  +  L R++  Y +I     S P     +T      P +  +   + + + D+ND+ PV +
Sbjct: 2136 DHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATS----GIISTARA---LDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFT 2400          
BLAST of Protocadherin 1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 271.937 bits (694), Expect = 9.380e-75
Identity = 242/796 (30.40%), Postives = 367/796 (46.11%), Query Frame = 2
Query:  104 FKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEA--SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDD--FSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE-NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTD--NDHPSRSAQITIHV 2467
            F + EE P    +G +   S        +GS   F F             N +TG I+    IDR                  E   Q+   ++ L+    P++     V +++ DIND+ P F +    + I E+  +++ +P+  A DPD+       Y       +  F +  T   TG  +  +  K  LDRE    +QL + A+D G P   G   + I ILDEND+AP+  Q S + SI E+T     I+R+ A D+D+G N  I + +    +Q++ + F +D  +GVI   + +D++   S       +   D G P + +  AT+TI VLD ND  P + I  L      +    EN   N  +AY+ V D D   N Q +  +   +D+  F +E + +        Y I  +  LD E    Y L +  +D G P ++    +++ V DVNDNSP F  +     +SE    G+ +  +N TD DE D  NG   Y+I+  G  L   +     G + +AK         DRE++S++   +T  D      +G+        TV V I D NDN P F K+ Y+ TI+E       V  + ATD D GDNG+I+Y+I    + V   F L+  TG L TKS++DRE  S++ F V A+D G P   S   V + +SDINDN P F YP +E     ASI  +E    +++V A D DE     I+Y I GG+  G F IDS+ G IS            + L+I   D  N + +++A + + V
Sbjct:   14 FHVQEEQPPGTYVGKVDGASA------FEGSPKQFGF-------------NSNTGVISTTARIDR------------------ETTTQISLQLRTLNPSNQPIS-----VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVI-TKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSN-SIFDLDSSTGVIRTKQNLDFEVKNSY---TFNVIASDGGVPSK-NDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGF--------YFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGD--NGTVSYSIT-GGNDLGWFQVDFQSGLVTTAK-------PLDREQVSSVTITITAQDHGSAPKTGST-------TVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YP-VEYF---ASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTV 731          

HSP 2 Score: 204.142 bits (518), Expect = 2.942e-53
Identity = 212/711 (29.82%), Postives = 325/711 (45.71%), Query Frame = 2
Query:  395 NHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSS-----KFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSP----ISIK-EDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSG-VITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQ--ATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDIN--DNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            +  TP     C + I I D NDH+P F  +  + +I+E            A D DS      K++I+ +   +++  F ++ +   TG I    R K  LD E  + +   VIASD GVP K     V I +LD NDN+P   I  L P     +I+ E++L++ +I  I   DKD+  N      LK  N  +D   F+++ +    I L + +D + +   P   L + V D G P + S+   + I V DVND  P       F+       I E  Q+   V  +N  D D G NG V   + G  +D     ++       F+  +VT  K LD E+ S   + I   D G   +T    + V +ID NDN P F +S  +  +SE    G  +  ++ TD+D  D  NGR  Y IS S  +      V G  +L +    +++ +  DRE  S   F +   D     +  + +       V + I D NDNAP+F   +Y  +I E +P      LLQ  ATD D+G N  ISY I     +   +F++D +TG ++T + +D E    F   + A+D G+  +Y+    VV V+ +N  DN P F+Y  + N TV  ++   + TL+ +V A   D+ G   I+Y+I  GDP  LF +DS  G I         +   Y L +          SAQ T++++V
Sbjct:  180 DRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAID-WDAIQSNSIFDLDSS---TGVI----RTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTE--LKITN-GDDEGCFKVEFLGFYFIQLQKPLDRELV---PFYNLTLNVTDKGVPSR-STLGFVLIDVTDVNDNSPA------FTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITG-GNDLGWFQVD-------FQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGD--NGRITYEISSSDAQ------VNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVK-------VELTISDINDNAPVFYPVEYFASIMENEPPG---KLLQVTATDADEGTNAVISYDI--IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGN--KYAAKTAVVNVTVLNKADNLPVFLYE-MYNFTVYENVP--KGTLVGRVYATTKDKNGS--ISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEV 834          

HSP 3 Score: 173.711 bits (439), Expect = 7.690e-44
Identity = 182/635 (28.66%), Postives = 274/635 (43.15%), Query Frame = 2
Query:  632 DNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQI-DYDSIQSLPQIELIITVQDHGKPKQLSSTATLTI-IVLDVNDEVPVIS----IIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESL------YRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREK--------ISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            D+TG II   ++   +DREE +++ L VIA    V P +    V I +LD NDNAP     S I  I    LV   +    A D D G+N L+ + L      N      I+  SGVI LAR++ D D  Q   Q+       D G P Q S   T+TI I L +N   P  +    +  + + QP   +            YV   D D G NGQ+              +I   N +  F   I    KL   K  L      Y LI+R +D G P  +A   + + + D ND+   F  +     ++EN  PGTL+ T+    LD +  ++  +    SES         V+ R    + ++R+      DRE+        +  ++ E   +DT  K              VIV + D NDNAP+FS+  Y  T++E       V  ++A D D+GDN K  Y +   S    + F ++ +TG L     +DRE  S +   VKA D  +   YS A + + V D ND  P  ++P   ++TV+ +  +   +L++ +NA D D      I YSI  G+   +F ++S  G +  AK       + Y L I   D+     S+ + + V V
Sbjct:  790 DSTGGII---KINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQL----TSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQV----LASDSGSPPQHS---TMTIHITLSINHP-PKFTLSSYVTHVLASQPLSYQFF----------YVVAVDQDSGKNGQL------------FYSIPQGNEEGLF--GIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFA------VDVRSGQITTRVRL------DREELIKNTGSNVYIMQAEAMYNDTTIKRDKAI---------VIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSL--VSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPE-SDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNV 1359          

HSP 4 Score: 162.155 bits (409), Expect = 3.403e-40
Identity = 184/725 (25.38%), Postives = 319/725 (44.00%), Query Frame = 2
Query:  368 LKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF-HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPK--TGSINVIIRILDENDNAPIIEQLSP--ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLP-QIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCE---KESLYRLIIRCSDSGHPKQTAQQE---LIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTL--IMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDS------NVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            L AV+  +   K PL+ +   V IE+ D ND++P F +  V+++I     +        A D D+ K  + RY     A     I  T          +++  +L   + +++ + V+ASD+G PP+  T +I++ + I     N P    LS     +     + +    + A D+D+G+N  + + + + N +     F      G + + + +    +Q+L    +LI+   D G P   S++  +TI + D ND         LF     R  + EN     LV  +  H  DH     +   LI  E  F++         D    +I T+V+LD E   K +   + I  +++ +   T +++   +IV V D+NDN+P F R+   + +SE   PG+ +  I   D DE D  N +F Y+ +S +G   F +      G+L  +K       + DRE  S+    +  +D +  ++  T +       + + + D ND  P+F ++ Y   ITE+      V  L A+D+D G NG I Y I +   ++   F ++  TG L     +D E   ++E  + A+D G     S  NV V V D+NDN P  ++PT     V+ +++ + NT   + +  A D D      I +S+    P   F ++S       +  I     P   D  S+ L++  TD   P  S + +I V+V +
Sbjct:  811 LLAVIARVGTVK-PLSAQ-ATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSG-------VIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI-----NHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP----GGKLYIRKSL----LQALKGSYDLIVRATDGGVPS-FSASVPVTIYIQDSNDHR------SLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAV---------DVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGD--NAKFFYSLVSGTGMDKFFIN--SSTGELHLSK-------TLDRETTSSYNLVVKATDASNANLYSTAK-------IEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN--GNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFPT---QPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRD--SFQLVVMATDQGSPKLSTRKSITVQVTD 1470          

HSP 5 Score: 148.673 bits (374), Expect = 4.620e-36
Identity = 178/687 (25.91%), Postives = 284/687 (41.34%), Query Frame = 2
Query:  536 LPMAHDPDSSKFSINRYYFHEAS------RFFRIECTQDNTGK------IIPQ--------------LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNA----------PIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSI--QSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG-RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISI----FEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHV 2467
            L + H P   KF+++ Y  H  +      +FF +     ++GK       IPQ              L ++  L +     + L V A+D GVP  + S+ V I I D ND+            + E  SP ++   TLV H +     KD       + S    E       +HF +D  SG IT   ++D + +   +   + ++     +         A + + V D+ND  PV      FSR      + E       V  +   DAD G N +    L+       ++    N+   +          LD E  S Y L+++ +D+ +    +  ++ + V D ND  P F  S   + ++E+   G+L+  +N +D D    +NG   Y+IS      +F +E   GR  L  AK       S D E     E  +T  D            LSS+  V V++ D NDNAP+F       T+ E       VG   A+D D G N  I++ +  +S     +F+++  T  +TT + ID E +      F+  V A DQG P   +  ++ V+V+D NDN P F+ P       +A+  SS N  +M + A D D     ++TYSI  G+  G F +  + G +    +  P +   Y L I+ +D   PSR  Q  + V
Sbjct:  938 LSINHPP---KFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLV-GTLVAHALDHSRTKDI------VYSLISSE-------SHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPV------FSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLV---SGTGMDKFFINSSTGELHLS----KTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDI--GQNGLIKYSISNGNLAAMFDVESATGR--LIVAK-------SLDFETTQLYELTITAQD-------HGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSM--YSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPP------AAAAGSSLN--VMTITAEDPDRNSNGKVTYSIISGN-NGYFNLHPSTGQLQMIHQ-IPDNPTIYQLTIQASDGGQPSRQTQTVVSV 1564          

HSP 6 Score: 128.257 bits (321), Expect = 8.014e-30
Identity = 182/777 (23.42%), Postives = 312/777 (40.15%), Query Frame = 2
Query:  200 VNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPL--PMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAG--VPPKTGSINVIIRILDENDNAPI-IEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQND-MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRK-LFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKI------SIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQ 2491
            + +   S + Q+     +N  TG +  +  +DR++                     L +   L  +H  P       V + I+DIND++P F+  +   +I E E    P  L    A D D    ++  Y     +         D++  +I  L   + LD E      L + A D G     KT  +NV   +L++ DN P+ + ++   ++ E+      + R+ A  KD  +N  IS+ +    V  D  N F +D   G+I +   +D +         L+  +   G  K LS+ AT+ I VLD ND  P       FS      +I       Q+V      D D G NG V+  L    +     N     +K           KL    E+ Y + +  SDSG P Q     + + +    ++ P F  S     +  ++P         V  +D+   +NG+  Y+I +   + LF + P    GKL   K  + +L            ++L V  T+    S +         V ++I+D ND+  +F    + F + E       VG L A   D      I Y +   SS  ++ F +D  +G +TT+ ++DRE++      +++  + +A       +   A V+V V+D+NDN P F       + ++ S  S   + + ++ A+D DE    +  YS+  G     F I+S+ G +  +K        SY L++K TD  + +  +   I + V +S  Q
Sbjct:  565 ITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKS-------------------LYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENE---PPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSI--DSSTGVISTL---ASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNV--TVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAI----VSGDPTNLFLVDSTGGIIKINGDMDREEKAQY----LLAVIARVGTVKPLSAQATVNIEVLDRNDNAP------QFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIK--------LARKLTDGDETQYTVQVLASDSGSPPQ--HSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQF--FYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP---GGKLYIRKSLLQALKG---------SYDLIVRATDGGVPSFSASVP-----VTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL--ISS--ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAV---YAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQ 1260          

HSP 7 Score: 115.931 bits (289), Expect = 4.441e-26
Identity = 137/555 (24.68%), Postives = 228/555 (41.08%), Query Frame = 2
Query:  173 SMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEA--SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPII-EQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLP----QIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVN--DNSPTFGRSRIELELSENEPPGTLLTTI-----------NVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDRE----KISTIEFELTVSDTN 1765
            +M+  +G    F +   +   +    IN STG + L + +DR                  E       VV+  D     L      + I + D ND  P F      +NI+E   I S      A D D  +  + +Y       +  F +E     TG++I    V   LD E    ++LT+ A D G+ P + ++NV + +LD NDNAP+   Q   ++++E+      + R  A D+DTG N  I+F +     Q     F ++  +  IT    ID   ++++P      +L++   D G PK LS+  ++T+ V D ND  P       F   PA         S+  V  +   D D   NG+V   +I      S  N  +N      + +++ ++    +  ++Y+L I+ SD G P +  Q + +V V         PTF  +  +  ++EN+  GT + T+           N+     +D   G F+   S    K  R    EG G   S  L +Y++   D++    + S+    +TV D N
Sbjct: 1183 AMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDR------------------ETTSSYNLVVKATDASNANL-YSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESA---TGRLI----VAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYS---QTPSKTFSVNSATCEITTIAAID---LETMPAGRDSFQLVVMATDQGSPK-LSTRKSITVQVTDENDNSPG------FVSPPAAAA-----GSSLNVMTITAEDPDRNSNGKVTYSII------SGNNGYFNLHPSTGQLQMIHQIP---DNPTIYQLTIQASDGGQPSR--QTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGA--SFNLVVYAV---DKQGPSARTSSATVTITVQDVN 1677          

HSP 8 Score: 111.694 bits (278), Expect = 9.030e-25
Identity = 125/535 (23.36%), Postives = 223/535 (41.68%), Query Frame = 2
Query:  950 HFRIDQMSGVITLARQIDYDSIQSLPQIELII-TVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG---RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQY------EFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDF-NTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV---EESRQQYYNPDYK 2512
             F  +  +GVI+   +ID ++     QI L + T+    +P       ++ + V D+ND  P    +    R      I E++  N         D D G NG V    I   D+ +  ++            ++TK  LD E    Y+L I  +D G P       + + ++D ND++P F ++     ++EN  PG  +  ++  D D     NG   Y I         +F L+   G          I +  + D E  ++  F +  SD           S +  +TV +++ D NDN+P    T        +   +E    N  +  +  TD+D   N +   KI +   D +  F ++F     +  +  +DRE +  +   +   D+G P R ++  V++ V+D+NDN P F   T   +T + S  +   + ++++NA D DE     ++YSI GG+  G FQ+D   G ++ AK        S  + I   D+    ++   T+ V +    +++ ++    YK
Sbjct:   41 QFGFNSNTGVISTTARIDRETTT---QISLQLRTLNPSNQP------ISVQVQVDDINDNEPRFPTLYYTLR------IRESMDVNTTNPINTATDPDAGNNGTVDY-TIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDS--GSNGDIKYAIDWDAIQSNSIFDLDSSTGV---------IRTKQNLDFEVKNSYTFNVIASDGG-------VPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITN--GDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAF---TSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYK 536          

HSP 9 Score: 54.299 bits (129), Expect = 3.586e-7
Identity = 54/215 (25.12%), Postives = 88/215 (40.93%), Query Frame = 2
Query: 1847 APIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNV---GGISFAKKPKPTDARS---YFLLIKVTDNDHPSRSAQITIHVKV 2473
            A + + + Y F + EE+P   +VG +      +G                   F  + NTG ++T ++IDRE  +    +++     +P    I+ V V+V DINDN+P+F  PT+  +T+        NT      A D D      + Y+I  GD    F + +     G        KP D  +   Y L I  TD   P+      I++ +
Sbjct:    4 ASVSAGSSYTFHVQEEQPPGTYVGKVDGASAFEGS---------------PKQFGFNSNTGVISTTARIDRETTTQISLQLRTL---NPSNQPIS-VQVQVDDINDNEPRF--PTLY-YTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITI 196          
BLAST of Protocadherin 1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 236.884 bits (603), Expect = 1.826e-63
Identity = 215/810 (26.54%), Postives = 358/810 (44.20%), Query Frame = 2
Query:   92 KGLY-FKIDEESPANIDIGSIQQT----SCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDS--------SKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIG-YEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            +G Y F++ E S     IG +  T    S  G +          + +S+NT + S   IN STG ITL+  +D +   + M     +                   +  TP       V + + D+ND+ P F        + E            A D DS        S  S N        RF         TG+I  ++     LDRE I+ + LT+ A D  +     +  V I I DENDN P     S  +I ED+     + ++ A D+D G N  +++ +      N  N F++D  SG++++   +D ++I   P   L++   D G P+Q S TA++ + VLDVND  P       F +     EI E+   +  V  V V D D G NG +   L G   D+F++++  +          +++K  LD E  + Y+L +   D G P ++A  ++ + +I+VNDN P+F        + E+    T +  +N TD D T      FD     +G   F+++  +  G +  AK         DRE  +T  + L V     ++     +  S  +   + + D NDNAP+F+   Y  ++ E  P    V  + ATD D+G+N K++Y++   S    + F ++  TG +TTK  +DRE  + +  +V A D G P + ++A + + ++D+NDN P+F   +   +T++ +  ++  + I++V A D D     ++TYSI  G+    F+IDS  G I+           SY L I   D+  P   +   + + V +
Sbjct:  584 QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVR---------YALSDNTDVFS---INTSTGLITLKTQLDYEKKTQYMVTVTAK-------------------DGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRF---------TGEITTRV----PLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIIS---GNQGNSFQLDPRSGILSVRSTLDRETI---PSYTLVVKASDAGSPQQ-SITASIHVSVLDVNDNAP------RFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGF----------VLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLT---FDIVEGNAGSS-FKID--QSSGLISVAK-------RLDRE--TTANYTLVV-----RATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL---SVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQF---SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVAD 1300          

HSP 2 Score: 229.18 bits (583), Expect = 4.159e-61
Identity = 210/736 (28.53%), Postives = 336/736 (45.65%), Query Frame = 2
Query:  263 TGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPM----AHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQ---LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPAR-PEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQS--SENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            TG IT R P+DR+++        + ++     +++  A                  V I I D ND+ PTF +     NISE    DSP    +    A D D           + A  +  I   Q N+ ++ P+   L V+S LDRE I  + L V ASDAG P ++ + ++ + +LD NDNAP  E+ L    I+ED  V   +++++ +DKD G N  I+  L      N    F ID  +G +     +DY++  +    +L +T +D G P + S+TA + I +++VND VP  S +      PA+   I E++  N  V  +N  D+D      +  D++      S +        DQ    I    +LD E  + Y L++R +++G   ++      ++V+DVNDN+P F        L EN P G  +  +  TD DE   EN +  Y +S      F + P  G          + +    DRE  ++    +T  D  +        S S+ + + + I D NDN+P FS+++Y  T+TE       +  + A+D D G NG+++Y I   S +  N+F +D  TG +T    +DRE ++ +   + A+D G P   S A V + V+D NDN P F      ++  S  I    S  + +  V A D DE    Q+ YSI  GD    F I++  G ++  K+       +Y L I+ +D   P
Sbjct:  739 TGEITTRVPLDRETIAS----YSLTINADDGSLVRFMAA---------------TTVNISIADENDNQPTF-TGPSRFNISE----DSPTGTRVGQLTATDRDIGP--------NGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN----FTIDS-TGFVLSKTPLDYETTAAY---QLTVTARDGGSPSK-SATAQVKITIINVNDNVP--SFV-----SPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFK-------IDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDE--GENAKVTYELSVGDTSKFEVNPATG---------LVTTKRPLDREDQASYSLRVTAMDHGKP-------SQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI--ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF-----ASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA-FAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSP 1390          

HSP 3 Score: 204.912 bits (520), Expect = 2.171e-53
Identity = 193/691 (27.93%), Postives = 310/691 (44.86%), Query Frame = 2
Query:  434 LIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH-FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDD--FSLENIEYNNVKDQFEYKIVTKVKL-DCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDY-TISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKF---IYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            LI + D+ND++P F        + E   + S      A D D     IN    +          T D+ G I    R K   DRE  + +Q+ + A D G P ++G   V I ILD NDN P+        S+ ED  +   ++ + A DKD G N  + +     N     NH F +D ++GV+T++R +D++   S     L ++V D G P  L+ T+ L I V D+ND  PV      FS    +  + EN  +      V+  D D   NG +   +I   DD  F+++              I++  K  D E ++ Y L ++  D G P +    ++ + + DVND+SP F  S    ++ E+   G+ + T+  TDLD   +  GR +Y  IS + +  F ++         S  +R+ S    DRE   +   ++   D    S S +         V + ++D NDN+PIF +  Y F ++E       +G + ATD D   NG + Y + D ++DV   F+++ +TG +T K+++D EK + +   V A+D G P R S+  V V V D+NDN P+F   +Y       ++A +       +  V A D D     +I+YSI  G+    F +D   G I+           SY L I   D       A  T+++ + +
Sbjct:  155 LITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD---VGINARLSYSLVSGDTSYFTVDSQGVI----RTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNT----NHAFTLDAVTGVVTVSRSLDFEQRSSY---ALGLSVTDRGSPP-LTDTSHLLINVNDINDNPPV------FSPSAYQSRVKENTPAG---TQVSATDRDSSTNGALVFGIIKGNDDGVFTIDG----------STGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPR--GRLEYRLISGNVKGAFNIDA-------NSGSIRVSS--ELDRETTPSYSLQVEARDGGSTSRSSST-------RVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-NTDV---FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVA------VCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIAD 782          

HSP 4 Score: 192.2 bits (487), Expect = 1.662e-49
Identity = 184/677 (27.18%), Postives = 308/677 (45.49%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPI-SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDD--FSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYD 2272
            I+ +TGRIT+   +DR+++             S    I  K       +   P       V I + D ND+SP F S++    I E  +I S   +  A D D      N   F+      R + +      +   L VK  ++RE +  + LT+ ASD G P  T    + + + D NDN P+    S I S++E++     ++ + A D D G N ++ + +      ND   F+I+  SGVI     +D+   +   Q  L +T  D     + ++   +TI V+++ND  P       F++Q     + EN  ++  V  V+  D D    G +   ++G +D   FS+         DQ    I T   LD E  SLY + +R +D+G+P  +    + +K++D NDNSP F  S     + EN  P +    +  TD DE    N R  Y +S +    F +    G   L             DRE  ST +  +   D             +SS T+ V + D ND+ P+ + +    ++ E +P+   V  + A+D D G N ++++ +   S++ ++ FTLD  TG ++TK  +DRE+ +++  ++   D+G+P   S+A+V++ V D +DN P+F  PT  N T+S S+    +  I++V A D D
Sbjct: 1253 IDSTTGRITVVGVVDREALA------------SYNLTISAK-------DSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGS---NAQVFYS---IVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIIS---GNDEKRFKINSTSGVIMTTTPLDF---EEKSQYGLEVTATD----SKYTAKTNVTIRVINLNDITPA------FTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSI---------DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADE--GTNARITYNLSRN--DAFMIGASSGVITLAQP---------LDRENKSTYDLAIQARD-------HGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSL--LSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF-QPTEYNVTISESLPRGAS--IVQVTARDID 1852          

HSP 5 Score: 184.496 bits (467), Expect = 4.050e-47
Identity = 200/748 (26.74%), Postives = 319/748 (42.65%), Query Frame = 2
Query:  242 FIVINQSTGRITLR-RPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE-QLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
               I+ STG IT   R  DR+S   + +L  +    ++ C             HK         V+I++ D ND++P F  +  V NI E  T  +   +  A D DS   +   Y        F +      TG+I    R  + LD E    + + + A D     K  +   +I + D NDNAP     +    + ED  V   + ++ A D D G N  +S+ L    V  D ++F +D   GVI      D ++  S    ++ +  QD G P + S  AT+ I +LDVND  PV      FS       + E++     +  V   D D+G N  ++         F+  N  +    D     +     LD E+ S Y L +  +D G P  T    L++ V D+NDN P F  S  +  + EN P GT    ++ TD D +   NG   + I +           +G   ++ +   I    S D E  +   ++LTV   +R        +      V + I+D ND++P+FS + Y   I E       V  + ATD D G  G++ Y++   S +V+ +F +D N+G++   S++DRE    +  +V+ARD G   R S   V + + DINDN P F  P    +    S  SS    I +V A D D++    + Y++   D   +F I+++ G I+   +        Y + +   D   PSRS+   + V V++
Sbjct:   11 MFTIDSSTGSITTTGRKFDRESES-RYRLTVLAQDAANRC-------------HKGRTV-----VVIDVKDENDNAPEFPLNSYVFNIRE-NTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNS---KTGEI----RTVTPLDHETKDSYTMRISAFDG----KHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSL----VSGDTSYFTVDSQ-GVIRTKGAFDRETKASY---QVALRAQDGGSPSR-SGQATVEIEILDVNDNRPV------FSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYS-------FTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSS--TNGALVFGIIKGND--------DGVFTIDGSTGIISIAKSPDYENKT--RYDLTVQARDRGVPVKYDTAQ-----VTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL--ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP----YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALS--DNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDD 677          

HSP 6 Score: 56.6102 bits (135), Expect = 6.172e-8
Identity = 54/219 (24.66%), Postives = 96/219 (43.84%), Query Frame = 2
Query:  248 VINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSS-----KFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKD 886
            +I  S+G ITL +P+DR            E   + +  IQ +       +H TP       + + + DINDH P   S  +  ++ E +  ++     +A D D+       FS+     +E    F ++ T  +    +P       LDRE+ + + L +  +D G P  +   +VII ++DE+DN P  +     ++I E       I+++ A+D D
Sbjct: 1663 MIGASSGVITLAQPLDR------------ENKSTYDLAIQAR-------DHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSL---LSNEHKSVFTLDNTTGDISTKVP-------LDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 7 Score: 49.6766 bits (117), Expect = 8.055e-6
Identity = 55/178 (30.90%), Postives = 77/178 (43.26%), Query Frame = 2
Query: 1997 QNSFTLDFNTGTLTTKS-KIDREKISIFEFKVKARDQG---HPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTG 2518
            Q  FT+D +TG++TT   K DRE  S +   V A+D     H GR     VV+ V D NDN P+F      N  V    +++    +  V A D D      ITYS+  G+    F ++S  G I            SY + I   D  H +    IT+   V ++   +    YKTG
Sbjct:    9 QGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTV---VVIDVKDENDNAPEFPL----NSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGE--NKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPLITVD-DVNDNAPFFALSVYKTG 176          
BLAST of Protocadherin 1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 234.958 bits (598), Expect = 7.783e-63
Identity = 210/766 (27.42%), Postives = 350/766 (45.69%), Query Frame = 2
Query:  218 SENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNT----GKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSL-ENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEG-GDPYGLFQIDSNVGGISFAKKPKPTDARS---YFLLIKVTDNDHPSRSAQITIHVKVEESR 2485
            S+N    ++  I+Q TG IT +R +DR+ +         + H       ++KA     ++   P  +   ++ I + D+ND+ P F  +    +I E ++I        A D DS      +Y          +    DN+    G++   + V  +LDRE++  + L V A D G PP++ ++ V I +LD ND  P   +++   +I+ED  V+  +  + A D D G N  + F   E    NDMN F I++++G + + +++DY+ I       L++T QD G+P  L +  T+ I ++DVND  P       F     +  I EN    Q    V  +D DHG NG++    +  +  FS+ EN    ++K++          LD EK   +   I+  D G P +    ++ + ++D+NDN P F +      ++EN   GT +  +   D D +   N  +    S    + FR+ P           + +    +++ + +    F ++ SD            LSS++ V V++ D N +AP F +  Y   + E+      V  + ATD D G N KISY I     +    F++D  TG + T   +DREK+  + F+V A D G P   + + V + ++D+NDNDP F+ P+ E   V   I+      +++V+A D D     QI YS    GD  G F IDS  G I   +  KP D  +   Y L +  TD   P   A + + V +E+ +
Sbjct:   62 SQNLMSATYFSIDQITGVITTKRGLDREFL---------DRH-----FFRVKA-----EDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCI--------LNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFF---EIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVF---NLLVTAQDKGQPF-LYNQTTVDIALIDVNDNAP------QFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEE----------LDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPD-SGPTNVVYSIVSSSGHDRCFRINP--------QGLITLSCTLNYNTKHVYV--FSVSASD----------GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPE----FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAK-VREDIRPGGR--VIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGII---RTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVK 746          

HSP 2 Score: 188.348 bits (477), Expect = 2.896e-48
Identity = 151/501 (30.14%), Postives = 238/501 (47.50%), Query Frame = 2
Query:  824 SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGR-FDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVG----LLQATDEDQGDNGKISYKIDDFSSDVQNS--FTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSI 2305
            S+ ED  V   +  + A D D+G N +I + +          +F IDQ++GVIT  R +D    + L +    +  +D G+P  L     LTI VLDVND  P+      F R     +I E+      V  V   DAD G NG+VK  ++  + D S  +I       +    +    KLD EK   Y L ++  D G+P ++A   + + ++DVND +P F +      + E+ P   L+TT+  TD D+    NG  F   +S +    F +  + G  +++            D E I      +T  D  +  +           TV + + D NDNAP F  + ++  I    P+N  VG     +QA D+D G NG+I++      S +QN   F+++ NTG ++ K ++DREK+  F F +KARD+G P +   A + + + DINDN PKF   + E +  S +  S   T +++V A+D D +G   + YSI
Sbjct:   28 SVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDR---EFLDRHFFRVKAEDGGEP-SLEGYMDLTINVLDVNDNGPI------FERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSI------GEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQ--GSNGEVFFEIVSGNDMNFFSINRINGEVRVKQ---------KLDYEMIGVFNLLVTAQDKGQPFLYNQT-------TVDIALIDVNDNAPQFVSSHFQTMI----PENYAVGQEFYRVQAYDKDHGTNGEITF------SFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKF---SQEEYHTSIAENSRWGTSVLQVKAIDPD-SGPTNVVYSI 480          

HSP 3 Score: 181.8 bits (460), Expect = 3.843e-46
Identity = 179/665 (26.92%), Postives = 284/665 (42.71%), Query Frame = 2
Query:  545 AHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDD--FSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQ--SSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQ--ITIHVK-VEESRQQYYNPDYKT 2515
            A DPDS    + RY    +     +  T  +  +I   +  K  LDRE +  H   V A D G P   G +++ I +LD NDN PI E+ +    I ED  +   ++ + A D D+G N  + + +   N   D + F I ++SG +T+ +++D + +   P   L +  QD G P + S+T T+ I +LDVND  P       FS++     I E++  NQLV  V   D D G NG+V  +++   D   FS+  I           ++  K KLD E   ++ L++   D G P    Q  + + +IDVNDN+P F  S  +  + EN   G     +   D D     NG   ++  ++       E   G    E            DREK+    F +   D               ++ + + + D NDN P FS+ +Y  +I E       V  ++A D D G    + Y I   SS     F ++   G +T    ++     ++ F V A D       S A V V V+D N + P+F     +  + SA ++  +S  T ++ V A D D     +I+YSI    P   F +D   G I  A         +Y   +  TD+  P   A+  + IH+  V ++   +  P Y+ 
Sbjct:   44 ASDPDSGSNGMIRYSMSPSQNL--MSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCIL--NSDGDNSAFSIGEVSGAVTVMKKLDREKV---PTYTLQVQAQDQGNPPR-SATVTVKITLLDVNDCTP------QFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRI---------NGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDH--GTNGEITFSFMQNDLPFSINENTGGISIKE----------ELDREKVPKFTFGIKARDKG-------VPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVS-SSGHDRCFRIN-PQGLITLSCTLNYNTKHVYVFSVSASDGMLS---STALVYVNVTDSNTHAPEF-----KRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPE--FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEA 653          

HSP 4 Score: 179.874 bits (455), Expect = 1.365e-45
Identity = 192/671 (28.61%), Postives = 291/671 (43.37%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS----RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLI--GYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVT 2422
            V I + D+ND +P F   K V + +  E +     +      D  + S    +F   S     FF I        +I  ++RVK +LD E I    L V A D G P       V I ++D NDNAP  +       I E+  V     R++A DKD G N  I+F      +QND+  F I++ +G I++  ++D + +   P+    I  +D G P +   TA +TI +LD+ND  P       FS++     I EN +    V  V   D D G    V   +   G++  F +            +  I     L+   + +Y   +  SD G    TA   + V V D N ++P F R     E+ E+   GT + T+  TD D     N +  Y+I+    + F ++  E  G +++A        S DREK+ T  FE+T +D            L + S V +HI D NDN P+F K  YE  + E+      V  + A+D D G N +I Y     + D Q +FT+D   G + T   +DRE I  +E  V A DQG P   +   V V + D+ D+ P F  P  E   V+    +   + ++ V A   D + +  + YSI  G+   +F I+ N G I    K        Y L ++ T
Sbjct:  220 VKITLLDVNDCTPQF--SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSIN-------RINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF----MQNDL-PFSINENTGGISIKEELDREKV---PKFTFGIKARDKGVPFK-EGTAQITITLLDINDNPPK------FSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINP----------QGLITLSCTLNYNTKHVYVFSVSASD-GMLSSTAL--VYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDT--GSNAKISYSIATLVPE-FSVD--ETTGVIKTAG-------SLDREKVDTYRFEVTATDHG-------IPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFAS-NGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYE---VTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRAT 830          

HSP 5 Score: 166.777 bits (421), Expect = 1.708e-41
Identity = 195/783 (24.90%), Postives = 334/783 (42.66%), Query Frame = 2
Query:  110 IDEESPANIDIGSIQQTSCGGSMEMVQGST--VNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNH---FRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKK----PKPTDARSYFLLIKVTDN 2428
            I E+ P N  + +++ T C       QGS   V F  VS N   ++F  IN+  G + +++ +D +                   +I +  ++    +   P       V I + D+ND++P F S      I E   +        A+D D        + F +    F I    +NTG I     +K  LDRE++ +    + A D GVP K G+  + I +LD NDN P   Q     SI E++     +++++A D D+G   ++       ++ +   H   FRI+   G+ITL+  ++Y++       + +           LSSTA + + V D N   P       F R+    E+ E+      V  V   D D G N ++   +     +FS+         D+    I T   LD EK   YR  +  +D G P+  A+  + + + DVNDN P F +   E ++ E+  PG  +  ++ +D D    +N +  Y+ + +G         +G   ++S +  I +L   DRE I   E+ELTV  T++ +  G          V V ++D  D+ P+F K  YE T+ E+ P    V  ++A  +D      + Y I     +    F ++ NTG + T  K+D E  S  E+++  R    P  ++   V+V + DINDN      P +E   ++ ++Q  +     +     YD    +++T+ +  G+      +++  G +S  KK     KP + +     I VTD 
Sbjct:  243 IREDVPVNQLVTTVRATDCD------QGSNGEVFFEIVSGND--MNFFSINRINGEVRVKQKLDYE-------------------MIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSI---NENTGGI----SIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVY------SIVSSSGHDRCFRINP-QGLITLSCTLNYNT-------KHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPE------FKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSV---------DETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDAD--IGKNAQIIYSFASNGDG-------QGTFTIDSTQGIIRTLKPLDRETIP--EYELTVVATDQGTPPGQASVK-----VKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSI--VRGNSPQVFDINPNTGAIQTLMKLDYETQS--EYRLTVRATLSP-FFTETTVMVYLKDINDNT-----PVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASKPANIK-----IAVTDG 931          
BLAST of Protocadherin 1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 206.453 bits (524), Expect = 7.198e-54
Identity = 209/687 (30.42%), Postives = 310/687 (45.12%), Query Frame = 2
Query:  419 KDCNVLIEITDINDHSPTFF---SDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSR---LDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI-----SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTL----IMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTD 2425
            K   VL+ + D+ND+SP+F    S K+V+  ++    D    L +A D D    S   Y          F++   +D  G +   L V +    +DRE +  + L + ASD G P   G + + I + D NDN P    +S   +I E+  V   I+++ A DKD G N  I + ++  +    +  F I   +GVI    ++DY++ +S     +++  +D G   QLSS+A + I VLDVND  PVI +           ++ EN      VA V+V DAD G NG+V   L G +  FS+   +++ + D  E  I     LD E    + L   C D G P +T ++   + V DVND +P F R   E  + EN    TL+  +N  D D     N    YTI     S S    F ++P  G          I + T  DRE+I  +   + V D            LS + +VIV++ D NDN P F+++ Y  ++ E  P    V  L A D D G+N  I Y I          F LD   G +T    +D E  S + F+V A D G  GR   A V V ++D+NDN P F          S S++  ENT     I ++ A+D D        + IE G+   +F +D + G I+ AK        +Y L +K  D
Sbjct:   40 KSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDK---DFRQKL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAI--FGIHPTTGVIVNNVRLDYEAKRSY---LIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLG---GSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSM---KFDVLND--ESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDF--GSNSELVYTIANTTESRSYLHWFAIDPSSG---------MITTATDLDREQIPQVVLTVLVHDRGSP-------PLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSI----LTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVF-------DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGS-GLITLAKLLDRETQDNYLLTVKAVD 677          

HSP 2 Score: 191.815 bits (486), Expect = 2.942e-49
Identity = 181/600 (30.17%), Postives = 273/600 (45.50%), Query Frame = 2
Query:  659 LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYED--DFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENG----RFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDED-QGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQ-GHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE--NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTD 2425
            L ++S +D E+I    LTV A D G PP  G  NV I ++D NDN+P     S  + + EDT + H    +   D D+G    +SF L    + N    F +D  +G ++L + IDY +  S     L +  QD G P + SSTA L + V+DVND  PV      F        +LE    +  +  V   D D G NG++        D   F L N            KI  K KLD E    Y L +   D G P++++  ++ V V DVNDN+P F ++     + ENEP  T L  ++ +D DE    NG    RFD  +++     F ++  +  GK+ ++++        DRE  ++  F +  +D          +       V V ++D ND +P FSK +Y  T+ E+ P    +  L ATD+D QG N  I+Y I         +F+L+  TG LT  S +DRE        V A D+ G+    +I  + + V D+NDN P FI     N T   ++       +++  V A+D D+    ++ Y I  G+  G F+I+   G IS  +         Y L +  TD
Sbjct:  759 LYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSL----LSNPGTLFNLDSNTGALSLTKLIDYGN--SARSYTLPVQAQDGGSPPR-SSTAMLELKVVDVNDYSPV------FGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN----------GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDE--GSNGHVTYRFDTQVAQ-----FIVD--KQTGKITTSQV-------LDREAKASYVFSIVATDGGSSPRVDKTQ-------VTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI----VAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFI-----NETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATD 1303          

HSP 3 Score: 189.504 bits (480), Expect = 1.369e-48
Identity = 196/693 (28.28%), Postives = 305/693 (44.01%), Query Frame = 2
Query:  431 VLIEITDINDHSPTFFSDKVV---INISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGEN-ELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGR--KLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLI----MKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKK-PKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            V IE+ D+ND++P       +     ++E  TI +        D DS K             +F ++    N   II    V   LDRE      L  +  D G PP+T   +  I + D ND AP  ++ +    + E+  V+  +  + A D+D G N EL+         ++ ++ F ID  SG+IT A  +D + I   PQ+ L + V D G P  LS   ++ + + D ND  P       F++      + EN  S   V  +   D D G N  +   ++     F L         D  +  +     LD E +S Y   +  +D G   ++    + V + D+NDN P F  S   +E  EN   G  +  +   D D       RF   I E G   ++F    V+G G +  AKL        DRE  +   + LTV     K++ G  +   + + V + + D ND  PIFSK +Y FTI E       +G + A   D+G N ++ Y I   ++D   +  L  +TGTL  +S++D EKI      V+A+D+G P  +  ANV + V DINDN P+F       ++ S  ++  E+T I      V+  D D     ++++S+   +P  LF +DSN G +S  K       ARSY L ++  D   P RS+   + +KV
Sbjct:  265 VRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESII---AVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQI---PQVVLTVLVHDRGSPP-LSDNCSVIVNLTDSNDNDP------YFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFL---------DPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRF---IIEQGNADEVFS---VDGSGLITLAKL-------LDRE--TQDNYLLTV-----KAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTD---NIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF-------NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLL-SNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKV 902          

HSP 4 Score: 181.415 bits (459), Expect = 4.952e-46
Identity = 207/788 (26.27%), Postives = 340/788 (43.15%), Query Frame = 2
Query:  125 PANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPK-----TGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDL-IGYE-DDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGG-DPYGLFQIDSNVGGI-SFAKKPKPTDARSYFLLIKVTDNDHPSRSAQI 2455
            P  + IGS+         +      V +  V+ NT       IN++TG I+  R +D     E      + +  +     Q K   QL              V I + D ND+ PTF  + ++  I E   I++      AHD DS   S   Y     S    F+I      TG I    +    +DREEISE+ L V A+D     +     T ++ +II+  D NDNAP     +   + ED   +  +  I A D DTG+   + + +  P    D   F +D  +GV+ L   +DY+ +   PQ  L I+  D G P  L+S     ++V+DVND  P       F+R      + EN  +   V  V  +D D G N ++   +  G E D FS+         D+    IVT   LD EK+  Y L +  +   +P + +   + + V+D NDN P F    + L++ EN  P  L+ T+ V DLD  +  N +  Y+I             +G   +  +   + + T  DRE  ++ +  +   D             ++ + + + I+D+NDN P+F ++ Y  TI+E  P    +  L A+D+D G NG I Y +   S+D    +++D  TG + + ++ +      + F   A+DQG   + +I  V +K+ D N++ P+F     E H    +  S+  T++   +A D D++   ++TY ++   +   LF ++SN G + + A    P   R    +I       P R   I
Sbjct: 1234 PEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTD--GTFKINETTGVISTLRALD----FEVTNRYVLRVSATDMGKKQQKTSYQL--------------VTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINS---ETGLI----QTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSP----DTGKFSLDLKTGVLKLIGSLDYEDV---PQYTLHISATDLGSPP-LTSYQLFNVVVVDVNDNPP------EFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSI---------DKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENS-PARLIYTLTVQDLDYGN--NTKVLYSIMSGN--------TDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPP-------YYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTL---SNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDA-DTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGI 1947          

HSP 5 Score: 180.259 bits (456), Expect = 1.025e-45
Identity = 211/808 (26.11%), Postives = 350/808 (43.32%), Query Frame = 2
Query:  104 FKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS-RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVI-IRILDENDNAPI-IEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYK-----IVTKVKLDCEKESLYRLIIRCSDSGHPKQ-----TAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENT---LIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            F + E  P    +G++   S   S E   G  V + F   +TQ+  FIV ++ TG+IT  + +DR++               +  +  + A     D   +P   K   V + + D+ND SP F  +K  + ++E   + S     +A D D    + +  Y   A  + F +        ++   L + S LDRE    H L V+ASD G      +I  I I +LD NDN P+ I + +  ++ E   +   +  + A D D G+N  + + +   N       F+I++ +GVI+  R +D++      +  L ++  D GK +Q +S   +TI V D ND  P       F + P    I EN+  N  V  +  HD D GLN ++               I+  + +  F+       I T   +D E+ S Y L +R +D    +Q     TA  ++I++  D+NDN+P F  SR    + E+EP    +T+I  T LD    + G  +Y I       F L+       L++  L++  + S D E +      ++ +D     ++           V  +        P F++  +  T++E KP    V  + A D D G N +++Y I   S    + F++D ++G + T S +DREK   +   V A    +P R S  +V + V D NDN PKFI P +       +++  EN+   LI  +   D D     ++ YSI  G+  G F I  + G +S   K       SY L ++  D   P  +A   I + +E+
Sbjct: 1023 FFVKENEPVATYLGAV---SASDSDEGSNGH-VTYRF---DTQVAQFIV-DKQTGKITTSQVLDREA--------------KASYVFSIVAT----DGGSSPRVDK-TQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLN-------QVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTD---GTFKINETTGVISTLRALDFEVTN---RYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPT------FDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRI------------WYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKF-VSRNLTYVMEDEPFNFQVTSI--TALDPDTGQGGNVEYRIVSPDTGKFSLD-------LKTGVLKL--IGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDN-------PPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIP--SGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVV-------TLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIED 1742          

HSP 6 Score: 174.481 bits (441), Expect = 6.546e-44
Identity = 186/676 (27.51%), Postives = 293/676 (43.34%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQ-SNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELI-VKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGR---YSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSE--NTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHP 2437
            +++ D+ND+SP F +     ++ E    DS     +A D DS +     Y F   S+    +    N GKI     +KS+LDRE+I E+ L VIA D G P ++ S +V + + D NDN P  +Q S    +KE+  V  ++  + A D D G N  +++       Q     F +D+ +G IT ++ +D ++  S       I   D G   ++  T  +T+IV DVND  P       FS+      + E+L   + L+  +   D   G N  +   ++     FSL  +            ++T V  LD E    + L +  SD G  +       I + V+DVNDN P F        + E  P G+++  +   D D+ D  NG+  Y I             +G  K+      I +L + D E  +     ++ +D  +K    +++       V ++++D NDN P F K      I E  P N  V  ++A D+D G N +I Y ID  S   +  F ++  TG + T   IDRE+IS +  KV+A DQ    +   Y+ A + + + D+NDN PKF+   +        +   E  N  +  + ALD D      + Y I   D  G F +D   G +         D   Y L I  TD   P
Sbjct:  900 LKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFD--SKVDTSKFGLRNGGKIF----IKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ-----FIVDKQTGKITTSQVLDREAKASY---VFSIVATDGGSSPRVDKTQ-VTVIVRDVNDCSP------KFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVT----------GVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGD--NGKVRYKIVNGN--------TDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQL------VTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTID--SQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNL------TYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDT-GKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSP 1519          

HSP 7 Score: 172.17 bits (435), Expect = 3.493e-43
Identity = 209/755 (27.68%), Postives = 335/755 (44.37%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR--FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVI-IRILDENDNAPIIEQLSPI--SIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKV-----KLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQ--SSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            +NQ TG +TL  P+DR+     +      LH     +   K   Q L+     +T  + NVL    D+ND+ P F ++     + E   I S     +A D D       RY     +    F+I    + T  +I  LR    LD E  + + L V A+D G   +  S  ++ I + D NDN P  ++ +PI   I E+  ++ ++  I+A D D+G N  I + +     Q+   HF+I+  +G+I     ID + I     +++  T Q   +  +L +TATL II+ D+ND  P        SR      ++E+   N  V  +   D D G  G V+  ++  +               +F   + T V      LD E    Y L I  +D G P  T+ Q   V V+DVNDN P F R      +SEN+P GT  + + VT  D     N    Y+I  SG ++ +    +  G + +  +        DREK  T  + LTV  T       ++    SS++V +++ DRNDN P F        + E  P  L +  L   D D G+N K+ Y I   S +   +FT+  +TG L+T +K+DRE  + ++  V+A+D   P   + AN+ + + D NDN P F     +    S++I   +   T I+ + A D D      I Y++   D YG++ IDS  G +  A + + +  + Y       D     + A + + +K+E+
Sbjct: 1168 LNQVTGVLTLVSPLDREVTHRHI------LH----VVASDKGGNQSLET----ITYIEINVL----DVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKI----NETTGVISTLRA---LDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDK-NPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDS---QSPRAHFKINSETGLIQTTHPIDREEISEY-SLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAP-----KFVSRNLTY--VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPD-------------TGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGT--SVVKVTAYDRDSGSNAELTYSI-PSGVEMDKFSIDKHSGLIVTNSI-------LDREKKDT--YFLTVHATG-----VSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARL-IYTLTVQDLDYGNNTKVLYSI--MSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVF-----QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLS-NDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIED 1846          

HSP 8 Score: 157.532 bits (397), Expect = 1.092e-38
Identity = 162/618 (26.21%), Postives = 261/618 (42.23%), Query Frame = 2
Query:  437 IEITDINDHSPTFFSDKVVINISEAETIDSPHPLP--MAHDPDSS---KFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDH----------------------------HIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLN-GQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFS-KTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFK--VKARDQGHPGRYSIANVVVKVSDINDNDPKF 2179
            I + D ND+SP F    ++  ++E      P  +    A D DS    K + + +  +EA   F I+ T   TG+I         LDRE  +   L +  +D+G+PPK+ +  V + + D NDN P+ + LS ++I+EDT                                 I+R+ A D+D+G N  I +    P   +D   ++ID  +GVI+  R ID     S  QI   +   D G P Q +      II  +   E+P       F + P      EN      V  V V D   GL  G++          +++EN  Y  +  +     V K  LD E +  + L++   D   P +  +  + + V DVND  P FG+S    + SE  P GT++  +NV+  D+    NGR  + I     K        G   ++     I +  + D E I T    +  +D            + +  +V + + D NDN P+F      +  + E  P N  +  + ATD D G N ++S+ +       Q  F +D  +G LTT    D E  +++++   +KA D G+P   S   ++V V+D ++ DP F
Sbjct: 2055 INVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAG-VFTIDST---TGEIT----TAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSF--PITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIP--VQAMDQGVPPQRALVYVRIIITREPKFELP-----SYFGKVP------ENAMMGTSVLTVRVTDNAAGLPLGRIS---------YNIENSNYFRIGQRSGVISVNK-PLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIV--VNVSAADKDSGANGRVWFAIQSGDDK--------GSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSP-------PMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTV--IGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF 2620          

HSP 9 Score: 155.992 bits (393), Expect = 3.273e-38
Identity = 167/647 (25.81%), Postives = 287/647 (44.36%), Query Frame = 2
Query:  677 LDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPIS-IKEDT--LVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVP-------------------VISIIDLFSRQPARPEILENLQSNQ----LVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKI-------VTKVKLDCE-KESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGIS--FAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDY 2509
            LD E     +L ++A+  G     G + + I ++D NDN+P     + ++ + EDT       ++++ A D D+G N  +++ +      N+   F ID  +G IT A+ +D ++  S    +L+I   D G P + S+   + ++V D+ND  P                   V S++   + + +R  +  NL+S       +  V+  D D G N Q+K         F + N       DQ +YKI         +  +D   ++S  ++ ++  D G P Q A   + V++I   +  P F       ++ EN   GT + T+ VTD +      GR  Y I  S    FR+          S  + +     ++ ++     F L VS  +      T  S      V +++ D ND  P+F ++ Y    +E  P    V  + A D+D G NG++ + I   S D + SF +D  TG + T+  +D E I      V+A D+G P  ++  +V ++V D+NDN P F  P   +  V  ++    N+ + ++NA D D     ++++++ GG   GLF ID   G ++       + T    Y L IK TD  +P  S+ ITI V V +  +  Y+P +
Sbjct: 2025 LDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIW---TGNEAGVFTIDSTTGEITTAKLLDRETTASF---DLVIRGTDSGIPPK-STNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESR--LTYNLKSASTPGIAILRVSATDQDSGSNAQIKYS-------FPITN------SDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRAL--VYVRIIITRE--PKFELPSYFGKVPENAMMGTSVLTVRVTD-NAAGLPLGRISYNIENS--NYFRI-------GQRSGVISVNKPLDYETKR----RFLLVVSAID-----DTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQ--SGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLP--LNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDE--YDPSF 2620          

HSP 10 Score: 147.902 bits (372), Expect = 1.018e-35
Identity = 178/721 (24.69%), Postives = 304/721 (42.16%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKI-----IPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHG--KPKQLSSTATLTIIVLDVNDEVP----VISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDE--DQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFA 2368
            IN  TG I    PIDR+ +              SE  ++++A  Q               ++I+  D+ND++P F S  +   + E E  +       A DPD+ +     Y                +TGK         L++   LD E++ ++ L + A+D G PP T S  +   ++ + ++ P      L   ++ E+      ++++ A D+D+G N  +++ +       +M+ F ID+ SG+I     +D +   +       +TV   G   P ++SST+ + I V+D ND  P     +  + +    PAR           L+  + V D D+G N +V   ++    D +           +   ++ T  KLD E ++ Y+L ++  D   P  TA   + + + D NDN P F +S     +SE  PPGT +  +N+T  D+    NG   YT+S     ++ ++   G          +YS   F+        F     D  +               V + I+D+N++AP F+KT YE  I      +  V ++ ATD   D+  NGK++Y++DD S +  + F ++ NTG++ T +             + A D G P       V + + +I D+ P+F+  T     VS    S   + I  V A    +A   Q+TYSI  G+    F +D   G IS A
Sbjct: 1380 INSETGLIQTTHPIDREEI--------------SEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEY-----------RIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLT-SYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPS---GVEMDKFSIDKHSGLIVTNSILDREKKDTY-----FLTVHATGVSYPFRVSSTS-VRINVMDRNDNPPKFISPVVTLKVPENSPAR-----------LIYTLTVQDLDYGNNTKVLYSIMSGNTDGAF-------TIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSI--LNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTG---------IVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVP-------VRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDD-SKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPAR--VSIPENSKVGSYITTVRARASSDA---QVTYSIISGNKGRAFYVDPFTGVISVA 2020          

HSP 11 Score: 133.65 bits (335), Expect = 1.975e-31
Identity = 161/627 (25.68%), Postives = 269/627 (42.90%), Query Frame = 2
Query:  659 LRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP---ISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRI--------DQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELI-VKVIDVNDNSP------TFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDF--SSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            +  K+ LDRE++S + LT++  +   PPK  S  V++ + D NDN+P   + +    +  + D      +I   A D D G N   S+ +   NV    N F++        D  + ++  A  I  D  + L    L I+  D G P        L+I V D ND  P       FS       I EN+     +  V+  D D G N +++  +  + D  ++  I            IV  V+LD E +  Y ++++  D G   Q +   ++ ++V+DVNDN+P      T G S    +++EN   GT +  ++V+D D    +NG  + T+ E G   F +     +  + + +  I    S DRE       +    D      +             +++ D ND AP F +  YE  + E    N  V ++ A D+D G N ++ Y I +   S    + F +D ++G +TT + +DRE+I      V   D+G P      +V+V ++D NDNDP F      ++  S    S   + ++++ A D D    + I YSI    P   F +D   G ++ ++        SY   +  TD     RS   T+HV + +
Sbjct:   14 ITTKTVLDREKVSAYNLTIV--EFSTPPK--SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI---AVDSDFGSNSTQSYTIVSGNVG---NVFKLISKRDTDGDLYADLVVNASSIGVDR-ERLDSYVLNISASDGGNPAN-HGFLRLSITVEDTNDNKP------EFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIH------PTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGS---YQVTENATIGTQVARVSVSDADS--GKNGEVNVTL-EGGDGYFSM-----KFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFR-------INVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYF---NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSIL--TPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTD 591          

HSP 12 Score: 129.028 bits (323), Expect = 5.969e-30
Identity = 160/628 (25.48%), Postives = 263/628 (41.88%), Query Frame = 2
Query:  251 INQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS----RFFRIECTQDNTGK------IIP-----QLRVKSRLDREEISEH------------QLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPIS-IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRI----ELELSENEPPGTLLTTINVTDLDETDKENGRFDYT-ISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTL 2035
            I+ +TG IT  + +DR                  E       V++  D+   P    +C V + +TD+ND+ P  F     +NI E     +     +A D D  K S   Y    AS       R+  T  ++G         P     Q+  K   D   IS              Q+ V A D GVPP+   + V I I  E    P  E  S    + E+ ++   ++ +   D   G    +       N++N  N+FRI Q SGVI++ + +DY++ +   +  L+++  D   P +      + I V DVNDE PV      F +     +  E +    +V  V+  D D G NG+V   +   +D  S          D+    I T+  LD E    + + +R +D G P       + ++V+D+NDN P F   R+    ++++ EN P  + L  IN TD D     N R  +T I  +G+ LF ++   G          + +  +FD E  +  ++ LT+     K+       LSS+ T+IV++ D ++  P F++  Y+F +        FVG + ATD D GD G++ +    F +   N+  ++  TG +
Sbjct: 2119 IDSTTGEITTAKLLDR------------------ETTASFDLVIRGTDS-GIPPKSTNCQVKVVVTDLNDNPP-LFDPLSEVNIREDTRTGAVVTSVVATDTD--KESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAG----LPLGRISYNIENS-NYFRIGQRSGVISVNKPLDYETKR---RFLLVVSAIDDTAPSK-PVRVPVYINVSDVNDEKPV------FGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSF-------AIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVF---RVPGPNDVQVLENLPLNSRLYEINATDRDS--GANARLSFTVIGGTGQGLFLIDKFSGW---------LTTNITFDYENTAVYQYSLTI-----KATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFV---FYNPTSNALKMNATTGII 2676          

HSP 13 Score: 120.939 bits (302), Expect = 1.685e-27
Identity = 181/791 (22.88%), Postives = 323/791 (40.83%), Query Frame = 2
Query:  224 NTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSP--ISIKEDTLVDHHIIRIEAKDKDTGE--NELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIE--LIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTI---SESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIF---------------------------SKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKID-REKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAG--KNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEE 2479
            NT++L  I+   + G  T+ R     S   K+     E   S +  +Q K +         P      N+ I I D ND+ P F        ISE     +      A D DS   S     +  ++  + +      TG +    R ++ + +E    +    IA D G  PK   + V I+I D+N++AP   + +P  + I  +T     +  + A D DT +  N  +++ L +   +N  + F ++  +G +  +         + PQ    L I  +DHG P  L     + I++ ++ D+ P        ++ PAR  I EN   +++ +Y+    A    + QV   +I      +     +  V       + +   LD E    +RL +  +  G         L + VID NDNSP F  S +  +L+E+         + VT  D     NG+  Y+I   +E+G  +F ++     G++ +AKL        DRE  +T  F+L +  T+      +         V V + D NDN P+F                            +++  + +       + +  + ATD+D G N +I Y     +SD Q  + +D +TG ++ +  ID R + S  +  V+A DQG P + ++  V + ++     +PKF  P+        ++     T ++ V   D + AG    +I+Y+IE  +    F+I    G IS  K       R + L++   D+  PS+  ++ +++ V +
Sbjct: 1677 NTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDR---ETKASYQLSVQAKDITP-------PYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSG--SNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQE----YNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTK-TPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDS--KNSTSLFVVESNTGSVRTSA-----GFSNPPQGRHALYIIAEDHGSPP-LRGYGIVQIVIGNIQDDPP-----RFLNQTPARVSIPEN---SKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGV-----ISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAG--VFTIDSTT--GEITTAKL-------LDRE--TTASFDLVIRGTDSGIPPKSTNCQ-----VKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSD-QIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMG---TSVLTVRVTD-NAAGLPLGRISYNIENSN---YFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSD 2399          

HSP 14 Score: 80.4925 bits (197), Expect = 3.635e-15
Identity = 95/401 (23.69%), Postives = 157/401 (39.15%), Query Frame = 2
Query: 1349 VTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG--RKLFRLEPVEG----RGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQY---EFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQ--SSENTLIMKVNALDYDEAGKNQITYSI----EGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQ--YYN 2500
             + + +D E+   Y L I  SD G+P       L + V D NDN P F        + EN   GT +  ++ +D D     N    Y+I      + +F + P  G      +L+    R Y +     +K S+ +                     SS+ V + + D NDN P+   +      + +TE       V  +  +D D G NG+++  ++         F +  +   +     +DRE    F  K    D+G P R +  +  + V D+ND  PKF     + HT    +   ++ NTL+  VNA+D D    +++ Y+I    E       F ID + G I+ A            L + V D   P  S   ++ V + +S     Y+N
Sbjct:  125 ASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDI--GTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLS-------------------SSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF-----DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFN 499          
BLAST of Protocadherin 1 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 186.037 bits (471), Expect = 1.693e-47
Identity = 205/770 (26.62%), Postives = 341/770 (44.29%), Query Frame = 2
Query:  101 YFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDP---DSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITL-ARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVK-DQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTL----IMKVNALDYD-EAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKP 2377
            Y  + E +   I IG +  T     +  +        F S N     F V ++STG I +  P+DR+                +  I+ + A   ++   +   TQ    V I +TD+ D  P F S  + + +SE  +I +      A D    D+  +SI      +    F I+        +  ++R  + LDRE +++++L V A D+ V   +  + V++++ D NDN P+       I   E++     I++++A D D G+N  + + +    V+N  ++  ++ ++GVI+L + Q+D +  +        I   D G P + SSTA++ I ++D+ND  PV +  D ++       + EN  +   V  V   D D G N ++          + L  + Y     D     I T+  L+ E+   Y L +R  DS    +     +I+ V D ND+ P F +S     + E+   G  +  +  TD D  D  N R  Y IS     L           +      I + ++ DRE+ ++    +T  D           +L S+++V++ I+D NDN P+FSK+ Y  T+ E       V  + ATD D+G NG+ +YKI   + D  + F +D NTG +T K+K+D EK S++   V A+D G P       V + VSD++DN P F       H    S +  EN      ++ VNA D D EA   ++ Y IE G+   +F I    G I+    P
Sbjct: 1095 YVNVSESASRGIVIGRVTATDRDEGINAII-------FYSSNGAEAKFYV-SRSTGDIIVDSPLDREF--------------KNVYILNVTA-ANIVAGAQDTTTQ----VHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIAN---GDPYGLFTID-------NVTGEIRTVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSI----VENVTDYVTVNAITGVISLGSSQLDREVEEYF---NFTIRATDSGVPSK-SSTASVAIKLVDINDNSPVFNNTDYYAY------VRENQPAGTPVLVVTASDKDVGTNAKLS---------YVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDIND--NARVRYYISSGNTSLMF--------SVNETTGIISTTSTLDREQNASYTLIITAKD-------HGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKIT--AGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVF-------HKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTP 1777          

HSP 2 Score: 185.652 bits (470), Expect = 2.326e-47
Identity = 193/703 (27.45%), Postives = 312/703 (44.38%), Query Frame = 2
Query:  443 ITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI----IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKV------KLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQ--ITIHVK-VEESRQQYYNPDY 2509
            IT IND SP F      +N+SE+ +         A D D    +I  Y  + A   F +  +   TG II    V S LDRE  + + L V A++     +  +  V I + D  D+ P     S  + + E+  +  ++ +I A DKD G+    S    +P        F ID ++G I    ++D +++    Q EL +  +D      +S    + + V DVND  PV S+    I+ +   P    IL+          V   DAD G N  V   ++              NV D      +T V      +LD E E  +   IR +DSG P +++   + +K++D+NDNSP F  +     + EN+P GT +  +  +D D     N +  Y +S      F ++P  G          I +    +RE+  +    L   D+  ++  GT R       VI+ + D ND+ P F+++ Y F++ E+      VG +  TDED  DN ++ Y I   S +    F+++  TG ++T S +DRE+ + +   + A+D G P   S  +V++ + D+NDN P F   ++ N T+  S+     T +++V A D DE    Q TY I  GD   +F ID+N G I+   K        Y L +   D   P  +    + IHV  V+++   ++ P Y
Sbjct: 1079 ITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRS---TGDII----VDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDP-----YGLFTIDNVTGEIRTVAELDRENVT---QYELFVQAKD--SVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQ----------VKAIDADIGDNAAVLYSIV-------------ENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDV--GTNAKLSYVLSGVLYTRFAIDPDTG---------NITTREPLNREETGSYTLTLRAVDSAIRAREGTTR-------VIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYIS--SGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLF-SKSVYNVTLRESV--FLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRY 1718          

HSP 3 Score: 182.185 bits (461), Expect = 2.203e-46
Identity = 176/600 (29.33%), Postives = 271/600 (45.17%), Query Frame = 2
Query:  407 PLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPD---SSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKP--QNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYP 2188
            P      +V I++ DIND+SP F +      + E +   +P  +  A D D   ++K S    Y      + R     D TG I      +  L+REE   + LT+ A D+ +  + G+  VII + D ND+ P   Q     S++ED  V H + R+   D+D  +N  + +++   N       F +++ +G+I+    +D +   S     LIIT +DHG P  L S  ++ I + DVND  P      LFS+      + E++     V  V   D D G NGQ    +   + D    ++ Y +        I  K KLD EK SLY L +   D G P  T    + + V DV+DN+P F + R   EL EN   G  + T+N TD+D  +  + R  Y I ESG         E  G +    L        +RE  +   +EL V+  +R +++     + +  TV+    D NDNAP F    Y  ++ E+     +  +  ++A D D+G++G+I + I   S +    F +D  TG LT    +DRE  S +   V A D+G P   S   V + V D+NDN P    P
Sbjct: 1377 PSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLS----YVLSGVLYTRFAIDPD-TGNIT----TREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSL---MFSVNETTGIISTTSTLDREQNASY---TLIITAKDHGIPA-LESNTSVMITIEDVNDNKP------LFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTD----DVFYIDANTGL---ITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDID-AEASHKRVYYRI-ESGNTDSMFLIGEQSGVI---TLNCTPSGCLNRE--THARYELQVAAISRVNLTEQKSLVPAVITVL----DVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTI--VSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTP 1934          

HSP 4 Score: 157.918 bits (398), Expect = 7.017e-39
Identity = 167/629 (26.55%), Postives = 282/629 (44.83%), Query Frame = 2
Query:  425 CNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSS---KFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPIS--IKEDTLVDHHIIR-IEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLA-RQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARP------EILENLQS-NQLVAYVNVHDADHGLNGQVKCDLIGYEDDF-SLENIEYN-NVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHP---KQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXX--XXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHP-GRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLI 2245
              V + + D+ND+ P F       +I+E     +      A D DS    + S N     +   F        N   ++   R    LDRE I+ + LTV A D GV  +   + + + +LDENDN P I     I+  I E       ++  I A D D G N  +++ +   +     + F ++  +G + ++   +D +   S    +LII V D+G P   +ST T+ + +LDVND  P       F   PA+        + E   + N+ +  +N  D D   NG+V   L G E  F  L+ +    +V+ + + +   ++  + + +  + L I  +D   P   +++A   + + V D NDNSP F     E  LSE   PG+ +  ++ TD D                         +E +GK+      IY++T  D  +   +E  +   + ++K+       +     + V++++ D NDN P+F++++Y   + E  P    V  + A+D DQG NGKI+YK+ + + D  ++F+++  TG +T    IDRE +  F   V+A DQG P  R + A VV+ V D NDN P+F +   E      S   S  T++
Sbjct:  478 ATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHF------SINGSGLVTTAR---ELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD-----SRFTLNSATGRLQISPTGLDRELKDSY---DLIINVTDNGSPPNTNST-TVHVTILDVNDNTPA------FDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRE-SPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQD-------------------------LEYKGKV------IYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKD--DAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV 1048          

HSP 5 Score: 149.828 bits (377), Expect = 2.483e-36
Identity = 187/778 (24.04%), Postives = 330/778 (42.42%), Query Frame = 2
Query:  191 GSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPM----AHDPDSSKFSINRYYFHE-ASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPIS-IKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRK-LFRLEPVEG----RGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDED-QGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSK----IDREKISIFEFKVKARDQGH-PGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKV 2473
            G T+++     N        I+  TG I     +DR+++ +             E  +Q K  V L+ +           V++++ D+ND+ P F      I   E    +SP    +    A D D    +   Y   E  + +  +      TG I       S+LDRE       T+ A+D+GVP K+ + +V I+++D NDN+P+       + ++E+      ++ + A DKD G N  +S+ L           F ID  +G IT    ++ +   S     L +   D    +    T  + I V D ND VP       F++      + E+++    V  V   D D   N +V+  +       S  N       ++    I T   LD E+ + Y LII   D G P   +   +++ + DVNDN P F +S   + L E+    T +  +  TD DE    NG+F Y I+      +F ++   G    + KL+  K  +Y+LT    + + T                      + +  V +H+ D +DNAP+F K +Y   + E   +   V  + ATD D +  + ++ Y+I+  S +  + F +   +G +T        ++RE  + +E +V A  + +   + S+   V+ V D+NDN P+F   +     +  +   ++ T I+ V A D DE    +I ++I  G+  G+FQ+D+  G ++  +     D   Y L++   D   P+ S+ +T+++ V
Sbjct: 1222 GDTISYSIA--NGDPYGLFTIDNVTGEIRTVAELDRENVTQY------------ELFVQAKDSVNLVSDL--------LKVVVQVEDVNDNPPVFSMPGYTIEYWE----ESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAI---TGVISLG---SSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVL----YTRFAIDPDTGNITTREPLNREETGSY---TLTLRAVDSAI-RAREGTTRVIITVTDANDHVP------QFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYI-------SSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDE--GANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLT-VSAQDLGTPPL-------------------TGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIE--SGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDAT-ILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITV 1921          

HSP 6 Score: 132.494 bits (332), Expect = 4.763e-31
Identity = 195/829 (23.52%), Postives = 339/829 (40.89%), Query Frame = 2
Query:  194 STVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHE-----ASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDY----------------------DSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTIS--ESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQN-----LFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTL-TTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKF-IYPTIENHTVSASIQSSENTL---IMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAK---KPKPTDARS------YFLLIKVTDNDHP---SRSAQITIHVKVEESRQ---QYYNPDYKT 2515
            S V + F +       F  +N   G +TL  P+D +     M +   E                   +   P  +    V+IE+TDI+D  P F     +  I E   I S      A D D     IN    +E     +   F I+    NTG I     V   +D E+    ++TV AS+   P    ++ V++ ++D NDN P  ++ +    ++ED  +   ++  + +  D  +N +    L    V  D + F ID  SG + + + +DY                      D      + +++ T  D    ++ S+ A++T+ +++VND  P      +F++      + E +     +A +   DAD G  G +  +L G +  +   N       D         +  D  ++  + L+++    G  ++ A   + V + DVNDN P F       +++EN P GT++  +  TD D    ENGR  + IS  + G        + G G + +A+         DRE I+T  + LTVS  +    S           + V++ D NDN P  +      TIT    +      + +  + A D D G NG+++Y +    S   + FTL+  TG L  + + +DRE    ++  +   D G P   +   V V + D+NDN P F   P     T   ++     T+   ++ +NA D D     ++ YS+  GD +G F++D   G +S  K   +  P  +R+      + L I  TD   P    +SA + + + V ++     Q+ + +Y+T
Sbjct:   79 SQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAE-------------------DLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGD---VGINNPILYEIISGNSDGVFTIDS---NTGVIT----VNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHL-VGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETD--TSEKFSANASVTLTLINVNDNKP------MFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVN------ADNGTISAAQILDYDTLRQYQFSLVVK-DGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDS--GENGRLSFNISAGDDGGHF----SINGSGLVTTAR-------ELDRETIAT--YTLTVSAYDHGVSSRHKHVQ-----LTVNVLDENDNTPQITDG---LTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM----SGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLS-GDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYET 834          

HSP 7 Score: 107.842 bits (268), Expect = 1.562e-23
Identity = 118/472 (25.00%), Postives = 202/472 (42.80%), Query Frame = 2
Query:  395 NHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF--HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITL-ARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQ--SNQLVAYVNVHDADHGLNGQVKCDLIGYEDD--FSLENIEYNNVKDQFEYKIVTKVK-LDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFG--------RSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEG--RGKL-----ESAKLRIYSLTSFDREKISTIE 1738
            +H  P  + + +V+I I D+ND+ P F      + + E+  + +     +A DPD        Y     +    F I+    NTG I     +K++LD E+ S + LTV A D G PP TG+  V I + D +DNAP+  +      + E+    HH+I + A D D   +    ++  E    + M  F I + SGVITL        + ++  + EL +         +  S     I VLDVND  P       F  +     +LE+    ++  +  V   D D G +G++   ++   ++  F ++N          +  ++T+ + LD E  S Y L++   D G P  ++   + + V+D+NDN P             R    + EN   G  +  +   DL   D +N  + Y  +   +K F L    G  R ++     +S+   +Y   S D+  I+T++
Sbjct: 1582 DHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDA---NTGLIT----IKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSM--FLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAP------RFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDN----------KTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDL---DTKNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASNDKLNITTLQ 2025          

HSP 8 Score: 78.1814 bits (191), Expect = 1.762e-14
Identity = 58/183 (31.69%), Postives = 86/183 (46.99%), Query Frame = 2
Query: 1826 IKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFI----YPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGIS 2362
            + D NDNAP+F++  Y   I E       +  + A D D G N ++ YK  + ++     F+L+   G LT    +D E    +   V A D G P   S   V+++V+DI+D  P+F+       IE +T   S        ++ V A D D    N I Y I  G+  G+F IDSN G I+
Sbjct:   36 VDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGST-------VVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVIT 211          

HSP 9 Score: 74.3294 bits (181), Expect = 2.912e-13
Identity = 118/492 (23.98%), Postives = 196/492 (39.84%), Query Frame = 2
Query: 1022 LPQI-----ELIITVQDHGKPKQLSSTAT--LTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDD----FSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEG----RGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEK--PQNLFVGLLQATDEDQGDN-GKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEF-----------------------KVKARDQGHPGRYSI-ANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAK 2371
            +PQ+     E  + V+D      L+   +    +IV D ND  PV      F+ QP   +I EN +    +  ++  DAD G N QV+             FSL ++           ++     LD E    Y L++   D G PK  ++  +I++V D++D  P F +S    E+ EN P G+ + T+   D D     N      IS +   +F ++   G     G +++ K  ++ +T    E          V D N  +      ++   +           N P F ++ Y F + E+   P  +    LQ TD D+     ++ Y +    SD    F +D  +GTL     +D EK   F F                       KV A +     ++S  A+V + + ++NDN P F   +  N+T+   I  +  T I  + A D D      +TY + GG     F ++++ G IS A+
Sbjct:    1 MPQLIQDNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPV------FTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNG---------ELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGD-VGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASE----------VPDPNSNTTVTVVVTVVDVND----------NRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSD---KFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSY-NYTMDEEI--TPGTHIADITATDADLGTFGALTYELRGGQA-AYFSVNADNGTISAAQ 449          

HSP 10 Score: 62.003 bits (149), Expect = 1.761e-9
Identity = 57/192 (29.69%), Postives = 83/192 (43.23%), Query Frame = 2
Query:  443 ITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASR----FFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQID 1003
            + D ND++P F     +  I+E   + +      A D DS   S  +Y F  A+     FF +            +L +   LD E    + L VIA D GVP       VII + D +D  P  ++      I+E+T +   ++ +EA+D D G N  I   L E    N    F ID  +GVIT+   ID
Sbjct:   36 VDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNG-------ELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPI---LYEIISGNSDGVFTIDSNTGVITVNGSID 217          
BLAST of Protocadherin 1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 293.123 bits (749), Expect = 4.695e-83
Identity = 236/811 (29.10%), Postives = 373/811 (45.99%), Query Frame = 2
Query:   80 GMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG--RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            G     + +++ EE P N  IGS+             G   + H          ++ ++  TG I T   PIDR+++ +     C  L +   C ++ + +V  LL N    L +      IE+ DIND++P F    + I++ E   + +   +P+A D DS +  +  Y      +A+  F ++   D  GK+ PQL V   LDRE    + LT+ A D G P +     + + + D NDN+P  E  S    + E++ V H +++++A D D G N  I + L +  V       RID+ +G+I +   +D + I SL      +  +D G P+  SS   +TI V D ND  P + I  I L +       I E++     VA V V D D G N  V C + G +  F L     +   ++ +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V DVNDNSP F  +  E++ +E   PG  +  +  TD D     N    Y I      + LF ++P  G          + + T  DRE     EF +T +D       GT        TV++ + D NDN P F  + Y F++ E  P    VG++   D D+G+N  +   ++         F +   TGT+ +    DREK S + F++KA D G P R S   V + V D NDNDP    P+  +    + + +S ++ +  V A D D      + +SI GG+PY LF+I  + G I+ AK+        + L+++V+D   P R A   +H+ V E+
Sbjct:   18 GPAKGSILYRVQEEQPPNTLIGSLAAD---------HGLPDSGHLYKLEVGA-PYLRVDGKTGDIFTTEIPIDRETLRD-----CRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEG----RIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKL-PQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQ-AVDPVPKLLRIDRTTGIIYVKGPLDREEINSL---SFYVVARDKG-PQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG-DVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADS--GTNAELFYNIVGDSYIKGLFEIDPNTGE---------VKARTPLDREHKERYEFRVTAADKGSPVHKGTA-------TVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDG----GKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPV-ASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNET 779          
BLAST of Protocadherin 1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 294.278 bits (752), Expect = 2.893e-82
Identity = 236/811 (29.10%), Postives = 373/811 (45.99%), Query Frame = 2
Query:   80 GMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLK-AVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG--RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            G     + +++ EE P N  IGS+             G   + H          ++ ++  TG I T   PIDR+++ +     C  L +   C ++ + +V  LL N    L +      IE+ DIND++P F    + I++ E   + +   +P+A D DS +  +  Y      +A+  F ++   D  GK+ PQL V   LDRE    + LT+ A D G P +     + + + D NDN+P  E  S    + E++ V H +++++A D D G N  I + L +  V       RID+ +G+I +   +D + I SL      +  +D G P+  SS   +TI V D ND  P + I  I L +       I E++     VA V V D D G N  V C + G +  F L     +   ++ +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V DVNDNSP F  +  E++ +E   PG  +  +  TD D     N    Y I      + LF ++P  G          + + T  DRE     EF +T +D       GT        TV++ + D NDN P F  + Y F++ E  P    VG++   D D+G+N  +   ++         F +   TGT+ +    DREK S + F++KA D G P R S   V + V D NDNDP    P+  +    + + +S ++ +  V A D D      + +SI GG+PY LF+I  + G I+ AK+        + L+++V+D   P R A   +H+ V E+
Sbjct:   95 GPAKGSILYRVQEEQPPNTLIGSLAAD---------HGLPDSGHLYKLEVGA-PYLRVDGKTGDIFTTEIPIDRETLRD-----CRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEG----RIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKL-PQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQ-AVDPVPKLLRIDRTTGIIYVKGPLDREEINSL---SFYVVARDKG-PQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG-DVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADS--GTNAELFYNIVGDSYIKGLFEIDPNTGE---------VKARTPLDREHKERYEFRVTAADKGSPVHKGTA-------TVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDG----GKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPV-ASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNET 856          
BLAST of Protocadherin 1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 291.197 bits (744), Expect = 7.324e-82
Identity = 237/828 (28.62%), Postives = 399/828 (48.19%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQTSCGGSMEMVQGST-VNFHFVSENTQILSFIVINQSTGRITL-RRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRY------------------------YFHEA---SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENI-EYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            L +++ EE PA++ +G++        + MV GS  V F   S +     F  I+  TG +T   + IDR    EK++ C + +   +EC I  +  V ++   ++ +   +  V+I   DIND++P+F S  + +++ E   I + + LP A D D  +  I RY                         F E    S  F ++      G+  PQL +K  LDRE+   ++LT+   D G PP++    + + I D NDN P  E+ +    + E++     I++++A D D G N  I +       ++     R+D+ +G +++  +ID + +    Q+   +  +D G+P ++   AT+ + + D ND VP I I  I     +     + E++  +  +A V V D D G NG V C ++G +  F L+   E    +++ +Y + T   LD E    Y ++I   DSG P  T+   L+VKV D NDN P F ++ +++   EN  PG  +TT+  TD D    +N    Y++  S   +F ++        +S  +R+   T+ DRE+    EF++   D           +L  S+TV+V + D+NDN P F +  + F + E    N  VG++   D D+G N ++      F  + +  F+++  TGT+ +    DRE+ + + F+VKA D G P R + A V + V D NDN P   +P   ++T+     S+  T++  V A D D      + YSI GG+P+ LF+ID   G IS   K +      + L+++VTDN  PS+S    +HV V E+
Sbjct:   30 LRYRLAEEGPADVRVGNV-----AADLGMVAGSREVTFTLESGS----EFFKIDNITGELTTNEKRIDR----EKLQQCQM-IFDENECFIDFE--VSVIGPAQSWVDLFEGKVII--LDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREEVS---QLRFTVMARDRGQPPKMDK-ATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVG-DVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADS--GKNAEISYSLDSSVNGIFSIDS-------DSGDIRVN--TNLDREQKERYEFKVIAKDKG-------INTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGL----FIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPP-SSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNET 810          

HSP 2 Score: 80.1073 bits (196), Expect = 9.781e-15
Identity = 98/390 (25.13%), Postives = 173/390 (44.36%), Query Frame = 2
Query:  338 LHQSS----ECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEA-SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVIS--IIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNS 1483
            LH S+    E   +   V+  +D+    LT  + ++L+++ D ND+ P F  + V ++  E            A D DS K +   Y    + +  F I+    ++G I    RV + LDRE+   ++  VIA D G+    GS  V++ + D+NDN P  ++ +    +KE+   +  +  +   D D G+N  +  F++E      +        +G  T+   + +D  Q       +  V D G P + S+TAT+++ V+D ND  P ++  I   ++  P    +        +V  V   D D G+N  +   +IG  + F L  I      D     I    KL+ +   L+RL+++ +D+G P Q+    + V V +   NS
Sbjct:  455 LHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNN-SLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDS---DSGDI----RVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIE-----NETG--TIFSTLSFDREQKTTYTFRVKAV-DGGDPPR-SATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTV------RTVVRTVIATDTDTGINADLNYSIIG-GNPFRLFEI------DGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNETLSNS 814          
BLAST of Protocadherin 1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 291.197 bits (744), Expect = 1.726e-81
Identity = 237/828 (28.62%), Postives = 399/828 (48.19%), Query Frame = 2
Query:   98 LYFKIDEESPANIDIGSIQQTSCGGSMEMVQGST-VNFHFVSENTQILSFIVINQSTGRITL-RRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRY------------------------YFHEA---SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQ-LSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENI-EYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            L +++ EE PA++ +G++        + MV GS  V F   S +     F  I+  TG +T   + IDR    EK++ C + +   +EC I  +  V ++   ++ +   +  V+I   DIND++P+F S  + +++ E   I + + LP A D D  +  I RY                         F E    S  F ++      G+  PQL +K  LDRE+   ++LT+   D G PP++    + + I D NDN P  E+ +    + E++     I++++A D D G N  I +       ++     R+D+ +G +++  +ID + +    Q+   +  +D G+P ++   AT+ + + D ND VP I I  I     +     + E++  +  +A V V D D G NG V C ++G +  F L+   E    +++ +Y + T   LD E    Y ++I   DSG P  T+   L+VKV D NDN P F ++ +++   EN  PG  +TT+  TD D    +N    Y++  S   +F ++        +S  +R+   T+ DRE+    EF++   D           +L  S+TV+V + D+NDN P F +  + F + E    N  VG++   D D+G N ++      F  + +  F+++  TGT+ +    DRE+ + + F+VKA D G P R + A V + V D NDN P   +P   ++T+     S+  T++  V A D D      + YSI GG+P+ LF+ID   G IS   K +      + L+++VTDN  PS+S    +HV V E+
Sbjct:   30 LRYRLAEEGPADVRVGNV-----AADLGMVAGSREVTFTLESGS----EFFKIDNITGELTTNEKRIDR----EKLQQCQM-IFDENECFIDFE--VSVIGPAQSWVDLFEGKVII--LDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREEVS---QLRFTVMARDRGQPPKMDK-ATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVG-DVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADS--GKNAEISYSLDSSVNGIFSIDS-------DSGDIRVN--TNLDREQKERYEFKVIAKDKG-------INTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGL----FIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPP-SSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNET 810          

HSP 2 Score: 80.4925 bits (197), Expect = 7.970e-15
Identity = 100/390 (25.64%), Postives = 176/390 (45.13%), Query Frame = 2
Query:  338 LHQSS----ECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEA-SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP-IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVIS--IIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNS 1483
            LH S+    E   +   V+  +D+    LT  + ++L+++ D ND+ P F  + V ++  E            A D DS K +   Y    + +  F I+    ++G I    RV + LDRE+   ++  VIA D G+    GS  V++ + D+NDN P  ++ +    +KE+   +  +  +   D D G+N  +  F++E     +   F I+  +G  T+   + +D  Q       +  V D G P + S+TAT+++ V+D ND  P ++  I   ++  P    +        +V  V   D D G+N  +   +IG  + F L  I      D     I    KL+ +   L+RL+++ +D+G P Q+    + V V +   NS
Sbjct:  455 LHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNN-SLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDS---DSGDI----RVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEE-----EEEIFSIENETG--TIFSTLSFDREQKTTYTFRVKAV-DGGDPPR-SATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTV------RTVVRTVIATDTDTGINADLNYSIIG-GNPFRLFEI------DGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNETLSNS 814          
BLAST of Protocadherin 1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 288.886 bits (738), Expect = 2.530e-81
Identity = 243/833 (29.17%), Postives = 392/833 (47.06%), Query Frame = 2
Query:   29 FKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQ----TSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRI-TLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKT-PLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFH---EASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPN--VQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISI--IDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISES-GRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEES 2482
            +  L LL + L+ +    + +  +Y K+ EE P N  IGS+         G   ++  GS               ++ ++  TG I T   PIDR+++ +     C  L +  +C ++ +  V + D  K   L  +    +IE+ DIND++P F S  + ++I E     +   +P+A D DS    +  Y      +A++ F ++  +D   KI PQ+ V   LDRE+   + L +   D G PP+  S  + I + D+NDNAP  E+      + E++   H ++++ A D DTG N  I + L + +  VQ      RID+ +G+I +   +D +    L   +  +  +D G P   SS A +TI + D ND  P I I  I L   Q     I E++     VA V V D D G N  V C + G +  F L     +    + +Y + T   LD E+   YR+ I   DSG+P  ++   L V+V D+NDN+P+F  + +E+  +E+  PG  +  +  TD D     N    Y+I ES    LF +    G       ++R+ +    DRE +   EF +  +D           S + ++ V+++++DRNDN P F  + Y F++ E  P    VG++  +D D+G+N +++     F       F +   TGT+ +    DREK S + F++KA D G P R S   V + V D NDN P    P   ++T      S  +T +  V A D D     ++ Y+I GG+P+GLFQI  N G I  A+         + L+++V+D   P R     +HV V E+
Sbjct:   20 WGCLVLLTIVLM-VPCGAVPSNNIY-KLSEEQPPNTLIGSLAADLGLPDSGHLYKLEVGS--------------PYLRVDSKTGEIYTTEIPIDRETLSD-----CRNLFEDDKCFLEFE--VSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKI-PQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQR---LLRIDRSTGIIYVKGLVDREEDNLL---KFYVVARDRG-PNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAG-DVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADS--GVNAELVYSIIESSAASLFEINSNTG-------EIRVRN--QLDREDVERYEFGVAAADKG-------VPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTL----FVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYT-HLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNET 797          

HSP 2 Score: 148.673 bits (374), Expect = 6.688e-36
Identity = 169/622 (27.17%), Postives = 264/622 (42.44%), Query Frame = 2
Query:  380 VQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS----RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIE---------QLSPISIKEDTLVDHHIIRIEAKDKDTGENELIS--------FFLKEPN-VQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEI--LENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSK-TQYEFT-ITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDN 2167
            ++++D  K P       + I +TD ND++P F  ++    + E            A+D D+       Y  H+AS    R  RI+ +   TG I     VK  +DREE +  +  V+A D G   K+    V I I D+NDNAP IE         Q    +I ED  +   +  ++  D+D GEN +++        F L+  +   ND       Q + ++   R  DY       +IE++    D G P  LSST +L + V D+ND  P  S        PA  E+   E+ Q    V  V   DAD G+N ++   +I      SL  I  N        +I  + +LD E    Y   +  +D G P +T    +++ V D NDN P F  S     ++EN PP   +  + V+D D+             E+ +    +EP  G+  +++    I S  SFDREK ST  F L   D      S           V +++ D NDNAP  +K     +T +    P +  V +++A D D G N ++ Y I     +    F +  N+G +        +   +    V+  D+G P R++ A V V V++  +N
Sbjct:  233 IRVVDGGKPPRASSAL-LRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRS---TGIIY----VKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDY-------RIEIVAV--DSGNPA-LSSTNSLKVQVTDINDNTPSFS--------PALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSII-ESSAASLFEINSNT------GEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADK------------GENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYV-------GVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTIT--GGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          
BLAST of Protocadherin 1 vs. Planmine SMEST
Match: SMESG000042589.1 (SMESG000042589.1)

HSP 1 Score: 2174.44 bits (5633), Expect = 0.000e+0
Identity = 1113/1114 (99.91%), Postives = 1113/1114 (99.91%), Query Frame = 2
Query:   11 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNXXXXXXXXXXXXXXXGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMTTNPNSYSIYFDSGKKPMFGTMKTNSNHDSNMSLNYRMVPAEKYQDLISDPNQGAYSGLAFYRKNTNLCGYNDQTIXXXXXXXXXXXXXXXXXXXXFSPEQLRTPKPGDNIYQKISANIELPTAKTRKPIIDDQILSTHDDAPSFLSSYGISEQESQPRALNSRYQTLNSTGKSKTINSATLDIVDNMYSDSNNATIDNVNVTPKK 3352
            MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIEC QDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKSISGTWRSLSSSSTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNILLIICLIIISAALAGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMTTNPNSYSIYFDSGKKPMFGTMKTNSNHDSNMSLNYRMVPAEKYQDLISDPNQGAYSGLAFYRKNTNLCGYNDQTINLINNNNNANNNSNNCENYNFSPEQLRTPKPGDNIYQKISANIELPTAKTRKPIIDDQILSTHDDAPSFLSSYGISEQESQPRALNSRYQTLNSTGKSKTINSATLDIVDNMYSDSNNATIDNVNVTPKK
Sbjct:    1 MDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECIQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKSISGTWRSLSSSSTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNILLIICLIIISAALAGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMTTNPNSYSIYFDSGKKPMFGTMKTNSNHDSNMSLNYRMVPAEKYQDLISDPNQGAYSGLAFYRKNTNLCGYNDQTINLINNNNNANNNSNNCENYNFSPEQLRTPKPGDNIYQKISANIELPTAKTRKPIIDDQILSTHDDAPSFLSSYGISEQESQPRALNSRYQTLNSTGKSKTINSATLDIVDNMYSDSNNATIDNVNVTPKK 1114          
BLAST of Protocadherin 1 vs. Planmine SMEST
Match: SMESG000042589.1 (SMESG000042589.1)

HSP 1 Score: 2122.44 bits (5498), Expect = 0.000e+0
Identity = 1089/1090 (99.91%), Postives = 1089/1090 (99.91%), Query Frame = 2
Query:   83 MKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNXXXXXXXXXXXXXXXGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMTTNPNSYSIYFDSGKKPMFGTMKTNSNHDSNMSLNYRMVPAEKYQDLISDPNQGAYSGLAFYRKNTNLCGYNDQTIXXXXXXXXXXXXXXXXXXXXFSPEQLRTPKPGDNIYQKISANIELPTAKTRKPIIDDQILSTHDDAPSFLSSYGISEQESQPRALNSRYQTLNSTGKSKTINSATLDIVDNMYSDSNNATIDNVNVTPKK 3352
            MKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIEC QDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKSISGTWRSLSSSSTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNILLIICLIIISAALAGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMTTNPNSYSIYFDSGKKPMFGTMKTNSNHDSNMSLNYRMVPAEKYQDLISDPNQGAYSGLAFYRKNTNLCGYNDQTINLINNNNNANNNSNNCENYNFSPEQLRTPKPGDNIYQKISANIELPTAKTRKPIIDDQILSTHDDAPSFLSSYGISEQESQPRALNSRYQTLNSTGKSKTINSATLDIVDNMYSDSNNATIDNVNVTPKK
Sbjct:    1 MKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECIQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKSISGTWRSLSSSSTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNILLIICLIIISAALAGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMTTNPNSYSIYFDSGKKPMFGTMKTNSNHDSNMSLNYRMVPAEKYQDLISDPNQGAYSGLAFYRKNTNLCGYNDQTINLINNNNNANNNSNNCENYNFSPEQLRTPKPGDNIYQKISANIELPTAKTRKPIIDDQILSTHDDAPSFLSSYGISEQESQPRALNSRYQTLNSTGKSKTINSATLDIVDNMYSDSNNATIDNVNVTPKK 1090          
BLAST of Protocadherin 1 vs. Planmine SMEST
Match: SMESG000022552.1 (SMESG000022552.1)

HSP 1 Score: 370.163 bits (949), Expect = 1.760e-110
Identity = 268/800 (33.50%), Postives = 414/800 (51.75%), Query Frame = 2
Query:   59 LLAIQVYGMKNKGLYFKIDEESPANIDIGSIQQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELH-QSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEASRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKE--PNVQNDMNHFRIDQMSGVITLARQIDYDSI-QSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYED-DFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPS 2440
            +L I +         F+I EE P    IG++ Q   G S    Q +   +  ++   +IL    I++  G +  +  IDRD +C +  LCC  +  QSSEC I  +  +Q   + KT +  K   + + + DIND++P F      I I E+ T+ +   LP+A D D  K SI +Y F + +  FR+  T      I P+L +   LDRE +SE+QLT+ A D+G PP+ G   + + I D NDN PII Q S  I I +       I  ++A DKD+G N ++ + +    P ++ +   F ID  +G I L ++++Y+++ +S+ QI L I V D G    L+ST T+TI + D+N+E P+I++  +      +P I EN  S QL+A+V+V D D   NGQV C + G       LE  + +N   + E+KI T   LD E+++   + I C D G P +T+ + + + VID NDN P F  + + +++ EN P  +++  +NVTD DE              +  +  +L+P          K  IY+    DRE    I   +   D        T         ++V I D+NDN P FSK  YEF + E +   + +  + A D D+  NG+++Y++    +    +F +D N G L TK ++DREK + +EF+V A D G     S ANV V V DINDN PKFIYP+ EN + + SI ++++T ++KV A D DE     I Y I  G+  GLFQ++   G +  A+  +  DA +YF+ I+  DN  PS
Sbjct:   10 ILVINLSNCSQIDYTFRIQEELPMKHLIGNLNQN--GISTNHFQYT---YKIIARKPEILELFTISEIEGDLRTKVKIDRDILCSRKSLCCTAISTQSSECEINFRVFLQ---SRKTTIASKYFRIQVVVEDINDNAPKFPRASEQIMIPESATLGTIKYLPLATDDDIGKNSIQKYSFEKDTSNFRL-VTVSIADIIYPRLELIENLDRESVSEYQLTLCAHDSGKPPRKGCTVIHVVIEDSNDNPPIIIQRSLVIKITQSIPPGKVIGTVKATDKDSGRNSILIYQISNLVPIIKKN---FEIDSSTGEIKLLQKLNYETMGKSVNQILLPIDVMDSGL-SPLTSTGTVTIYIQDMNNESPIITVTYIQDNNLNKPIINENRPSGQLIAFVHVIDTDQNENGQVDCTIKGSTKFRLILEPEQRDN--QEKEFKIETTQPLDREEQANIEITIVCKDKGTPPKTSNKAVKIVVIDENDNYPVFYPNPVVIKILENLPVNSVVAMLNVTDADENPTGTLPVTCQFESNDNEYLKLDP---------DKCIIYTRQLIDREVTDKINTNIVAIDKGYPPKKTTAH-------IVVEIIDQNDNRPTFSKKIYEFHVKENQ-DPMVIAKIIAQDSDENYNGQVTYQLSFHDNAAHVAFGIDSNVGNLHTKIRLDREKRADYEFEVIAMDNGPIKLASSANVRVIVDDINDNTPKFIYPSQENQSHTYSIYNTKSTPLIKVTATDLDEGVNKDIIYEIIDGNRNGLFQLNPTSGQLYLARDLELGDAGTYFITIEAKDNGDPS 777          

HSP 2 Score: 76.2554 bits (186), Expect = 1.154e-13
Identity = 115/465 (24.73%), Postives = 192/465 (41.29%), Query Frame = 2
Query: 1253 GQVKCDLIGYEDDFSLENIE-YNNVKDQFEYKIVTKV-------------KLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESG---RKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYE------FTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDD-------FSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPT------IENHTVSASIQSSENTLIMKVNALDYDE--AGKNQITYSIEGGDPYGLF--------------------QIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQI-TIHVK 2470
            G +K   +  +DD    +I+ Y+  KD   +++VT                LD E  S Y+L +   DSG P +     + V + D NDN P   +  + ++++++ PPG ++ T+  TD D     N    Y IS      +K F ++   G  KL   KL   ++     + ++ I   + V D+           L+S+ TV ++I+D N+ +PI + T  +        I E +P    +  +   D DQ +NG++   I            + +++   +F    + T   +DRE+ +  E  +  +D+G P + S   V + V D NDN P F YP       +EN  V        N+++  +N  D DE   G   +T   E  D   L                     +I++N+  I     PK T A     +I   DN  P+ S +I   HVK
Sbjct:  157 GTIKYLPLATDDDIGKNSIQKYSFEKDTSNFRLVTVSIADIIYPRLELIENLDRESVSEYQLTLCAHDSGKPPRKGCTVIHVVIEDSNDNPPIIIQRSLVIKITQSIPPGKVIGTVKATDKDS--GRNSILIYQISNLVPIIKKNFEIDSSTGEIKLLQ-KLNYETMG----KSVNQILLPIDVMDSG-------LSPLTSTGTVTIYIQDMNNESPIITVTYIQDNNLNKPIINENRPSGQLIAFVHVIDTDQNENGQVDCTIKGSTKFRLILEPEQRDNQEKEFK---IETTQPLDREEQANIEITIVCKDKGTPPKTSNKAVKIVVIDENDNYPVF-YPNPVVIKILENLPV--------NSVVAMLNVTDADENPTGTLPVTCQFESNDNEYLKLDPDKCIIYTRQLIDREVTDKINTNIVAIDKGYPPKKTTAHIVVEIIDQNDN-RPTFSKKIYEFHVK 594          
BLAST of Protocadherin 1 vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 306.22 bits (783), Expect = 1.570e-87
Identity = 249/791 (31.48%), Postives = 394/791 (49.81%), Query Frame = 2
Query:  236 LSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREK----ISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQN---SFTLDFNTGTLTTKSKIDREKISIFEFKVKARD-QGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTV-SASIQSSENTLIMKVNALDYDEA--GKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSN 2566
            + ++ ++ + G++  +R IDRDS+C +++LCC      S  +       Q       P+  K    LI I D NDH P F      ++ISE+  + +   LP+A D DS K+S+  Y F   S    F +E TQ    K+   LR+K+RLDRE+  ++ LT+ A D G P  TG + V I +LD NDN P+ E     + +KE  ++   I ++ A D+D GEN  I + L       D   FR+D++SG + +   +DY+  Q   + +LIIT ++   P   ++TATLT+ V+++NDE PVI  +D F+       I E   +   V  V V D D G+ G+V+C L  + + F L            +YKI T+ +LD E  S Y L I C D G P  +A   + V ++D NDN P      I   +SEN+PPGT++T I+ TD D  D  NG+  Y+I+++         V     ++S    I +L   DRE     ++ ++  +TVSD+            SS  ++ + I D NDNAP F ++ + F++TE +     +G ++ +D D+   G +   I    S+ +    S T + N   L T   +DRE++  +E  + A D  G+    + A V V V DINDN P FI+P   N T+     +     L++  +A D D    G  ++ +SI   +   LF ID + G I   ++   +D   +F++IKV D+  P  S++  I +K+++       P Y+  K  G   D S SE+ +
Sbjct:   64 IEYLHLDSNNGKLFAKRKIDRDSLCSEIELCCKSDIICSVSVSVAMTAAQPSSKLSDPIIGK---FLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKFISKSDLSIFSLE-TQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKL-------DSGMFRVDELSGSVYMISPLDYEKDQ---EYKLIITARNR-IPGVNTATATLTVNVININDEKPVI-FVDYFNNW-QHASISEYETAPAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQ------NSPGQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSI-FHVSENKPPGTIVTKIDATDKD--DGLNGKLTYSITDAQNL------VSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTP-------KQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYRLGQIEVSDPDE--TGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSI-NSNSNNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKIQDI------PIYENDK--GNKYDQSKSEFQD 804          
BLAST of Protocadherin 1 vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 305.834 bits (782), Expect = 2.053e-87
Identity = 249/798 (31.20%), Postives = 397/798 (49.75%), Query Frame = 2
Query:  236 LSFIVINQSTGRITLRRPIDRDSMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEAS--RFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAPIIEQLS-PISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREK----ISTIEFELTVSDTNRKXXXXXXXXXXXXXTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQN---SFTLDFNTGTLTTKSKIDREKISIFEFKVKARD-QGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTV-SASIQSSENTLIMKVNALDYDEA--GKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLN 2587
            + ++ ++ + G++  +R IDRDS+C +++LCC      S  +       Q       P+  K    LI I D NDH P F      ++ISE+  + +   LP+A D DS K+S+  Y F   S    F +E TQ    K+   LR+K+RLDRE+  ++ LT+ A D G P  TG + V I +LD NDN P+ E     + +KE  ++   I ++ A D+D GEN  I + L       D   FR+D++SG + +   +DY+  Q   + +LIIT ++   P   ++TATLT+ V+++NDE PVI  +D F+       I E   +   V  V V D D G+ G+V+C L  + + F L            +YKI T+ +LD E  S Y L I C D G P  +A   + V ++D NDN P      I   +SEN+PPGT++T I+ TD D  D  NG+  Y+I+++         V     ++S    I +L   DRE     ++ ++  +TVSD+            SS  ++ + I D NDNAP F ++ + F++TE +     +G ++ +D D+   G +   I    S+ +    S T + N   L T   +DRE++  +E  + A D  G+    + A V V V DINDN P FI+P   N T+     +     L++  +A D D    G  ++ +SI   +   LF ID + G I   ++   +D   +F++IKV D+  P  S++  I +K+++       P Y+  K  G   D S SE+ + +  + +
Sbjct:   59 IEYLHLDSNNGKLFAKRKIDRDSLCSEIELCCKSDIICSVSVSVAMTAAQPSSKLSDPIIGK---FLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKFISKSDLSIFSLE-TQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKL-------DSGMFRVDELSGSVYMISPLDYEKDQ---EYKLIITARNR-IPGVNTATATLTVNVININDEKPVI-FVDYFNNW-QHASISEYETAPAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQ------NSPGQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSI-FHVSENKPPGTIVTKIDATDKD--DGLNGKLTYSITDAQNL------VSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTP-------KQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYRLGQIEVSDPDE--TGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSI-NSNSNNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKIQDI------PIYENDK--GNKYDQSKSEFQDGNGNIFS 806          
The following BLAST results are available for this feature:
BLAST of Protocadherin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11.274e-9229.70protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11.793e-9129.83protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH93.415e-8028.29protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.584e-7928.29protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH92.003e-7928.29protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.882e-4728.31FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.739e-4025.56CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
fmi-11.689e-3826.66FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-43.977e-3627.11Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-11.677e-3527.42Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft1.282e-7030.47gene:FBgn0001075 transcript:FBtr0077478[more]
stan8.925e-6429.04gene:FBgn0024836 transcript:FBtr0304899[more]
stan8.925e-6429.04gene:FBgn0024836 transcript:FBtr0300578[more]
stan9.249e-6429.04gene:FBgn0024836 transcript:FBtr0303223[more]
stan9.249e-6429.04gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.281e-8629.65protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.228e-8529.65protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CT030123.15.818e-8129.16protocadherin 1b [Source:NCBI gene;Acc:572016][more]
pcdh7a7.410e-8127.58protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
CT030123.18.320e-8129.32protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh171.134e-8229.33protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.715e-8229.33protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.764e-8229.33protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.259e-8229.33protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.044e-8129.33protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh14.334e-9229.79protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh14.334e-9229.79protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh14.923e-8631.14protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh93.461e-8128.54protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh11x7.958e-8129.86protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN6.120e-9229.70Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9HC56|PCDH9_HUMAN2.259e-7828.29Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q71M42|PC11X_PANTR4.807e-7729.69Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA4.986e-7729.69Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6KEQ9|PC11X_PIG1.263e-7628.95Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
back to top
BLAST of Protocadherin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087W1P71.899e-11231.01Protocadherin 1 OS=Echinococcus multilocularis OX=... [more]
A0A158QF932.881e-10932.22Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068WRC21.064e-10631.44Protocadherin 1 OS=Echinococcus granulosus OX=6210... [more]
A0A5K3F9P22.880e-10632.04Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QVX93.027e-10532.04Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a4.077e-8429.17protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b5.949e-8428.92protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1a2.027e-8329.26protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh7a4.977e-8127.81protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
pcdh117.893e-7929.02protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh113.507e-7829.32protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.19.977e-7027.30pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.12.137e-6127.46protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.15.894e-5726.11pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.13.984e-5327.81pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354129.380e-7530.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461891.826e-6326.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482377.783e-6327.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404707.198e-5430.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.693e-4726.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a4.695e-8329.10protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.893e-8229.10protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh7b7.324e-8228.62protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b1.726e-8128.62protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh1b2.530e-8129.17protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
back to top
BLAST of Protocadherin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042589.10.000e+099.91SMESG000042589.1[more]
SMESG000042589.10.000e+099.91SMESG000042589.1[more]
SMESG000022552.11.760e-11033.50SMESG000022552.1[more]
SMESG000059376.11.570e-8731.48SMESG000059376.1[more]
SMESG000059376.12.053e-8731.20SMESG000059376.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033095 ID=SMED30033095|Name=Protocadherin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3428bp
ATTCAATAAAATGGATTTTAATAGTTATTTTAAAGTATTATGTTTATTGG
AGGTTTTTCTATTAGCTATCCAAGTTTATGGAATGAAAAATAAAGGACTA
TATTTTAAAATTGATGAAGAATCACCAGCTAATATAGATATTGGATCTAT
TCAACAAACAAGTTGTGGCGGATCAATGGAAATGGTTCAAGGAAGTACGG
TCAATTTTCATTTTGTCAGTGAAAATACACAGATTCTATCTTTCATCGTT
ATCAATCAATCAACGGGTCGAATAACTCTTCGTCGGCCAATTGATAGGGA
TTCTATGTGTGAAAAAATGAAACTGTGTTGCGTGGAATTACATCAATCTT
CCGAATGTATTATTCAATTAAAGGCTGTTGTGCAATTATTGGACAATCAC
AAAACGCCTCTTACCCAGAAAGACTGTAATGTTCTAATCGAAATCACCGA
TATTAATGATCACAGTCCTACATTTTTCTCCGATAAAGTAGTGATTAACA
TTTCCGAAGCGGAAACAATTGATTCACCGCATCCATTACCAATGGCTCAT
GATCCAGATTCATCAAAGTTTTCTATTAATCGATATTATTTTCATGAAGC
TTCAAGGTTTTTTCGAATTGAATGCACTCAAGATAATACTGGAAAGATTA
TCCCTCAACTTCGGGTTAAATCTCGTTTAGATAGAGAAGAAATAAGCGAA
CATCAATTAACAGTGATAGCTTCCGATGCTGGGGTCCCACCAAAAACAGG
AAGCATAAATGTAATCATTAGAATTCTAGATGAGAATGACAATGCCCCAA
TTATTGAACAGCTTTCCCCGATTTCAATCAAAGAAGACACATTGGTTGAT
CACCATATTATTAGAATCGAAGCAAAGGATAAAGATACTGGTGAAAATGA
ACTGATTTCATTTTTCCTTAAAGAACCGAATGTACAAAATGATATGAATC
ATTTTAGAATTGATCAAATGAGTGGAGTTATTACATTGGCCCGTCAAATT
GATTATGATTCAATCCAATCGCTACCGCAAATTGAACTGATTATAACAGT
TCAAGATCATGGTAAACCAAAACAGCTCTCAAGCACTGCAACATTAACCA
TAATTGTTCTTGATGTCAATGACGAAGTGCCAGTTATTTCTATAATTGAT
TTGTTTAGTCGTCAGCCAGCTCGACCTGAAATTCTAGAAAACCTTCAATC
AAATCAATTAGTCGCTTATGTCAATGTTCACGACGCCGATCATGGATTGA
ACGGCCAGGTGAAATGTGATCTGATTGGATATGAAGATGATTTCAGTTTG
GAGAATATCGAATACAACAATGTCAAAGATCAATTTGAATACAAAATCGT
TACAAAAGTCAAACTGGATTGTGAAAAAGAATCTCTTTATAGATTGATAA
TACGATGCTCTGATTCCGGGCATCCTAAGCAGACGGCCCAACAAGAATTA
ATTGTCAAAGTGATCGATGTCAACGATAACAGTCCGACATTTGGTAGATC
AAGAATTGAACTAGAGTTATCAGAAAATGAACCACCTGGAACATTATTAA
CCACAATAAACGTAACAGATTTAGATGAAACTGACAAAGAAAATGGACGG
TTTGATTATACAATCAGTGAAAGTGGTCGTAAACTTTTCCGACTAGAACC
AGTTGAAGGAAGAGGAAAATTGGAAAGTGCAAAACTTAGAATTTATTCTC
TCACTAGTTTCGATAGAGAGAAAATTTCTACAATTGAATTTGAATTGACT
GTCAGTGACACTAACAGAAAATCCATTTCTGGCACTTGGAGATCATTGTC
TTCATCGTCAACAGTAATCGTCCATATTAAAGATAGAAATGATAACGCTC
CAATATTCTCTAAAACCCAATATGAATTTACAATCACAGAAGAAAAACCT
CAGAATCTTTTTGTCGGCTTATTGCAGGCCACAGATGAAGATCAAGGAGA
CAATGGAAAAATCAGCTATAAAATTGATGATTTCTCGTCGGATGTTCAGA
ACAGTTTCACTTTGGATTTCAACACAGGAACTTTGACAACGAAATCAAAA
ATTGATAGGGAAAAAATTTCAATTTTTGAATTTAAAGTCAAAGCTCGAGA
TCAGGGTCATCCAGGTAGATACAGCATTGCTAATGTAGTTGTCAAAGTTA
GCGATATAAATGACAATGATCCGAAATTTATTTATCCAACAATTGAAAAT
CACACAGTTTCAGCATCTATTCAAAGCTCTGAGAATACATTGATCATGAA
AGTAAATGCCCTTGATTATGACGAAGCTGGTAAAAATCAAATTACATATT
CTATTGAAGGTGGAGATCCATATGGACTATTTCAAATAGATTCGAACGTT
GGTGGAATAAGCTTCGCTAAAAAACCCAAACCAACAGATGCTAGATCATA
TTTTTTATTAATAAAAGTTACTGATAATGATCATCCATCTAGATCTGCTC
AAATCACAATTCATGTTAAAGTCGAAGAATCTCGACAGCAATATTATAAT
CCCGATTATAAAACTGGTAAAGAAAATGGACAAATCGAAGACAGCTCTTG
GTCTGAGTATTCAAACAATAGCAAAATGGTTCTCAATCGAAATATTTTGC
TCATCATATGCTTGATTATAATTTCTGCCGCTTTGGCTGGAGTTCTGTTA
ATGCTTATTATGTGTTTAAAACGACGGCCGTCTCAAACTGTGAGGAAATC
TGATTTACCCGAGAGCGTGTCAAGAAAGCAAATGACGACAAATCCAAATA
GCTACTCAATTTATTTTGATTCCGGTAAAAAACCAATGTTTGGCACAATG
AAAACGAACTCGAATCATGACAGCAATATGTCCTTGAATTACAGAATGGT
TCCTGCAGAAAAATATCAAGATTTGATTTCTGATCCCAATCAAGGAGCCT
ATTCGGGACTTGCATTTTACAGAAAGAACACCAACCTCTGTGGATACAAC
GATCAAACAATTAATTTAATAAATAATAATAATAATGCTAATAATAATTC
AAACAATTGTGAAAATTACAATTTCAGTCCTGAACAGTTGCGGACTCCGA
AACCTGGAGATAATATTTATCAGAAAATTAGCGCTAATATCGAACTGCCA
ACGGCGAAAACAAGAAAACCAATAATAGATGATCAAATTTTATCCACCCA
TGACGATGCCCCCAGCTTTCTCTCAAGTTATGGCATCAGTGAACAGGAGT
CCCAGCCAAGGGCGCTAAACAGCAGATATCAAACCTTAAACAGCACTGGC
AAATCAAAAACGATAAATTCCGCAACTCTTGATATTGTTGACAATATGTA
TTCAGATTCCAACAATGCCACTATTGATAACGTAAATGTTACCCCAAAAA
AGTCTTTTATTGCTTCATCTTTTGTGTAAATTATTTTTTAATTGAATCTA
AATAATTAGACTAGTCTGATAAAGCGAT
back to top

protein sequence of SMED30033095-orf-1

>SMED30033095-orf-1 ID=SMED30033095-orf-1|Name=SMED30033095-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1126bp
FNKMDFNSYFKVLCLLEVFLLAIQVYGMKNKGLYFKIDEESPANIDIGSI
QQTSCGGSMEMVQGSTVNFHFVSENTQILSFIVINQSTGRITLRRPIDRD
SMCEKMKLCCVELHQSSECIIQLKAVVQLLDNHKTPLTQKDCNVLIEITD
INDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYFHEA
SRFFRIECTQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTG
SINVIIRILDENDNAPIIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENE
LISFFLKEPNVQNDMNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITV
QDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQS
NQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIV
TKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRS
RIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEP
VEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKSISGTWRSLS
SSSTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGD
NGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSKIDREKISIFEFKVKARD
QGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMK
VNALDYDEAGKNQITYSIEGGDPYGLFQIDSNVGGISFAKKPKPTDARSY
FLLIKVTDNDHPSRSAQITIHVKVEESRQQYYNPDYKTGKENGQIEDSSW
SEYSNNSKMVLNRNILLIICLIIISAALAGVLLMLIMCLKRRPSQTVRKS
DLPESVSRKQMTTNPNSYSIYFDSGKKPMFGTMKTNSNHDSNMSLNYRMV
PAEKYQDLISDPNQGAYSGLAFYRKNTNLCGYNDQTINLINNNNNANNNS
NNCENYNFSPEQLRTPKPGDNIYQKISANIELPTAKTRKPIIDDQILSTH
DDAPSFLSSYGISEQESQPRALNSRYQTLNSTGKSKTINSATLDIVDNMY
SDSNNATIDNVNVTPKKSFIASSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 385..414
score: 26.96
coord: 80..99
score: 27.1
coord: 674..700
score: 29.76
coord: 708..725
score: 41.98
coord: 598..617
score: 45.29
coord: 617..630
score: 34.04
coord: 462..474
score: 30.24
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 289..377
e-value: 3.0E-20
score: 83.3
coord: 56..156
e-value: 0.39
score: 8.0
coord: 407..495
e-value: 1.1E-15
score: 68.1
coord: 180..266
e-value: 3.1E-16
score: 69.9
coord: 519..617
e-value: 1.1E-12
score: 58.2
coord: 751..826
e-value: 1.4E-4
score: 31.2
coord: 641..724
e-value: 1.8E-25
score: 100.6
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 274..370
e-value: 2.0E-16
score: 60.2
coord: 393..487
e-value: 9.8E-11
score: 42.0
coord: 504..609
e-value: 9.7E-10
score: 38.8
coord: 624..716
e-value: 1.2E-19
score: 70.6
coord: 165..259
e-value: 9.3E-10
score: 38.8
coord: 740..825
e-value: 4.0E-10
score: 40.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 724..825
e-value: 6.3E-18
score: 67.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 156..265
e-value: 3.1E-21
score: 78.0
coord: 615..723
e-value: 1.5E-32
score: 114.4
coord: 266..375
e-value: 2.5E-25
score: 91.1
coord: 493..614
e-value: 5.4E-22
score: 80.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 376..492
e-value: 3.8E-21
score: 77.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 32..155
e-value: 2.9E-10
score: 42.6
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 598..1004
coord: 35..590
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 620..726
score: 27.65
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 386..497
score: 18.88
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 29..158
score: 12.633
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 182..268
score: 17.697
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 498..619
score: 21.402
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 730..836
score: 15.943
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 268..379
score: 22.739
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 502..615
e-value: 4.29595E-19
score: 81.2057
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 34..154
e-value: 2.05213E-6
score: 45.3822
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 623..722
e-value: 1.75373E-29
score: 110.866
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 393..493
e-value: 2.97718E-18
score: 78.8945
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 274..374
e-value: 2.32502E-26
score: 102.007
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 743..825
e-value: 1.21766E-15
score: 71.5757
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 164..264
e-value: 9.44623E-19
score: 80.4353
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 867..889
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 66..113
e-value: 1.0E-4
score: 22.1
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 714..724
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 485..495
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 607..617
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 256..266
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 490..611
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 607..731
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 262..371
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 146..272
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 714..828
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 385..497