Hypoxia up-regulated protein 1

Overview
NameHypoxia up-regulated protein 1
Smed IDSMED30033090
Length (bp)3004
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hypoxia up-regulated protein 1 (SMED30033090) t-SNE clustered cells

Violin plots show distribution of expression levels for Hypoxia up-regulated protein 1 (SMED30033090) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hypoxia up-regulated protein 1 (SMED30033090) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hypoxia up-regulated protein 1 (SMED30033090) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30033090SMESG000054253.1 SmedASXL_014937SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30033090SMESG000054253.1 dd_Smed_v4_2324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033090SMESG000054253.1 dd_Smed_v4_2324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033090SMESG000054253.1 dd_Smed_v4_2324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30033090SMESG000054253.1 dd_Smed_v4_2324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033090SMESG000054253.1 dd_Smed_v4_2324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033090SMESG000054253.1 dd_Smed_v4_2324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033090SMESG000054253.1 dd_Smed_v4_2324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033090SMESG000054253.1 Contig43017uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30033090SMESG000054253.1 Contig43017uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30033090SMESG000054253.1 Contig43017newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30033090SMESG000054253.1 Contig43017newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Human
Match: HYOU1 (hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGNC:16931])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 350/839 (41.72%), Postives = 502/839 (59.83%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKP--SKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP +V + ++ER FG++A +M IK PK        L+GK  D+P V  +Q  FP +E+  D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  NTTAQ  MFYD GS +T  +IV+YQMVK KE GM    PQL I G+G+DRTLG  +  LRL+  LA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLFER   P+ +AL+SA++ +  I++VIL+GG TR+P+ QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  +S +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   + K++ ++TV   +  A       +        +    +  +P  +   + +    + V     LP E+ +  S +K+  L   D EK   EKA N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT+ E  +L K+I +T  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTR----EVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSAEEESTLTKLGNTISSLFGGGTTPDA-KENGTDTVQKPSEKA-------EAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLP-EDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 851          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Human
Match: HYOU1 (hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGNC:16931])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 350/839 (41.72%), Postives = 502/839 (59.83%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKP--SKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP +V + ++ER FG++A +M IK PK        L+GK  D+P V  +Q  FP +E+  D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  NTTAQ  MFYD GS +T  +IV+YQMVK KE GM    PQL I G+G+DRTLG  +  LRL+  LA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLFER   P+ +AL+SA++ +  I++VIL+GG TR+P+ QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  +S +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   + K++ ++TV   +  A       +        +    +  +P  +   + +    + V     LP E+ +  S +K+  L   D EK   EKA N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT+ E  +L K+I +T  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTR----EVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSAEEESTLTKLGNTISSLFGGGTTPDA-KENGTDTVQKPSEKA-------EAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLP-EDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 851          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Human
Match: HYOU1 (hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGNC:16931])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 350/839 (41.72%), Postives = 502/839 (59.83%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKP--SKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP +V + ++ER FG++A +M IK PK        L+GK  D+P V  +Q  FP +E+  D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  NTTAQ  MFYD GS +T  +IV+YQMVK KE GM    PQL I G+G+DRTLG  +  LRL+  LA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLFER   P+ +AL+SA++ +  I++VIL+GG TR+P+ QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  +S +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   + K++ ++TV   +  A       +        +    +  +P  +   + +    + V     LP E+ +  S +K+  L   D EK   EKA N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT+ E  +L K+I +T  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTR----EVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSAEEESTLTKLGNTISSLFGGGTTPDA-KENGTDTVQKPSEKA-------EAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLP-EDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 851          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Human
Match: HYOU1 (hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGNC:16931])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 350/839 (41.72%), Postives = 502/839 (59.83%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKP--SKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP +V + ++ER FG++A +M IK PK        L+GK  D+P V  +Q  FP +E+  D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  NTTAQ  MFYD GS +T  +IV+YQMVK KE GM    PQL I G+G+DRTLG  +  LRL+  LA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLFER   P+ +AL+SA++ +  I++VIL+GG TR+P+ QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  +S +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   + K++ ++TV   +  A       +        +    +  +P  +   + +    + V     LP E+ +  S +K+  L   D EK   EKA N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT+ E  +L K+I +T  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTR----EVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSAEEESTLTKLGNTISSLFGGGTTPDA-KENGTDTVQKPSEKA-------EAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLP-EDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 851          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Human
Match: HYOU1 (hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGNC:16931])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 355/899 (39.49%), Postives = 514/899 (57.17%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKP--SKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSE-------------------PQNRIETLHQNLNFITVYK------------ASSLPSEEVIEMSRKK-----------IIQLKQIDEEKAA-------------LEKAQNE-----LESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP +V + ++ER FG++A +M IK PK        L+GK  D+P V  +Q  FP +E+  D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  NTTAQ  MFYD GS +T  +IV+YQMVK KE GM    PQL I G+G+DRTLG  +  LRL+  LA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLFER   P+ +AL+SA++ +  I++VIL+GG TR+P+ QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  +S +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   + K++ ++TV  E       +S  + + +  G+ V   + +E                   P+    T  +N +     K            A +   E+  + +RK+           ++ L  + E+K A             LEK + E     LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT+ E  +L K+I +T  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTR----EVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSAEEESTLTKLGNTISSLFGGGTTPDA-KENGTDTVQEE------EESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDKSEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 913          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Celegans
Match: T24H7.2 (pep chromosome:WBcel235:II:6247311:6250841:1 gene:WBGene00020781.1 transcript:T24H7.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T24H7.2)

HSP 1 Score: 414.075 bits (1063), Expect = 5.260e-129
Identity = 287/883 (32.50%), Postives = 466/883 (52.77%), Query Frame = 2
Query:  137 VIIVLSYFSKSEC-IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN--QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMP-MKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDF---FRFKTMENKEVPHFTSRVIFDFMNYFPMK-RVLTFNKHTKNFDFNVTIG---------TQDIDK--KTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSN--------------------------TVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKI---IQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQ-GPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKI 2638
            VI++   F+ S+  +A  ++DL ++FLKI IVKPG+PM+IAL+ ES+RKTP+VV I    R F +AA+ M +++P  ++  +  LVGK+  HP  + F++   ++E+     N   + F+   ++ +TVE L AM+L NAK   E Y++   +K  +I VP YFT  ERLA+ RAA++AG  VLQL+N  TA AL++GIFRRK      Q  M YD G++ TT +IV +++VK K      + P+++++G+G+DRTLG  +   RL+ HL   F K  KP   V T  R+M K  KEA R+ +VLSAN E +AQ+E+  +D D K+KVTR +F  +  D+  RF EPI +AL  AQ+P+  I + +LMG GTR+PK QEI+ KT   +E+GK +NTDE+ A+GA++QAA +S GFKVK F +++  + P+ V F    R +  E         + +F   + +P   + ++   ++ +F   +  G          Q+I      L+ VE+  L+E     L++     +EFKGVK  F +DA GIV +   EALFE +        +  +  I +TIS LF S TEE     DDS                           T  N T  + ++   N+T  NA+  S N T+  E +  + ++ + L     Y ++ +P++  ++  ++++    + +++  E+AA+E   NELES+ F      ++  +T    + E+    D+ + +  W E+     TP +D+     EL+ ++  +  R       PE +  L ++L ++        N+  E  +F + + D L   +     W     K  +  +   +   T  D +   + L RE+   + K+
Sbjct:   10 VILLGCLFATSDGQLAAMTIDLGTQFLKIGIVKPGIPMDIALNTESRRKTPNVVMIQDGHRTFADAAIGMQVRYPHLVHGQLNDLVGKSTQHPSFELFKRRNTFFEVDDAPKNASSINFKLGGES-YTVEALTAMILANAKKFTEEYAQAAEIKDVVITVPVYFTPAERLAVERAAQMAGLTVLQLINDGTAAALSHGIFRRKEIGEKPQRLMVYDMGAAKTTATIVEFKLVKEK----YEKQPKMTVLGVGFDRTLGGIEMTNRLRDHLIEMFEKNYKPKTKVNTNRRAMTKFSKEAERLKQVLSANAEHFAQIESAHEDIDAKLKVTREDFNHLISDMESRFGEPIEQALRMAQIPIDDIDQFVLMGAGTRVPKVQEIVQKTIGTKEIGKFLNTDEAVAMGALFQAAHLSKGFKVKPFNIEEKVIFPVEVHFVSKIRDEKTEEITGEKNVVKTLFAANSVYPTHPKTISLTSYSDDFSVALKYGKIESFTKQQVQEIGSLLDNLVDVEISGLSEA----LKNRSSEESEFKGVKVSFIVDASGIVRVRRAEALFEPK--------SGLVGSIASTISGLFSSKTEEGEPTTDDSTPQSTEEKTEEKESVKVEDSTPEPEPETPVNST--SEESPKTNETEKNAS--SGNATEVKEKKKELPSIVR-LRITNKYPSAFVPNKYDVQEEKRRMEAFAEKERLASERAAVE---NELESFNFECSQYLEETEFTDYMADEEKTKLEDSVKRIRAWLEDDVTKDTPTKDFTDNLLELKNVVRSVKKRQEHDKAVPEKLKSLETLLETTFSLTTLGNNVDEEKALFKKEDRDGLKSKLDKLKIWVTDVRKHLDLKKKTDDFNFTGKDIDTKTKNLNREVDRFMKKM 867          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Celegans
Match: T14G8.3 (pep chromosome:WBcel235:X:12861237:12870025:1 gene:WBGene00011771.1 transcript:T14G8.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T14G8.3)

HSP 1 Score: 388.267 bits (996), Expect = 1.931e-119
Identity = 300/857 (35.01%), Postives = 445/857 (51.93%), Query Frame = 2
Query:  137 VIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTE----FKGVKAHFGLDAGGIVSLNYIEALFERQWNSN-------DKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLP----SEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQF-DKEIYTRCSTETERKLAIDAAQALGEWYEEQ-GPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTG--EG-KIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISI 2644
            V I   Y      +A  S+DL S+F+KI +VKPGVPM+I L++ES+RKTP+V+    DER F  AA  M    P+  Y+ +  ++ +         FQK FP+   + DE    + F + E+  + VE LLAM+L NAK + E Y++  +K  +I VP +  Q ER AI  AA IAG N+LQL+N  +A ALNYG+FRRK       + + YD G+  TT +IV Y +   ++ G   + P L  VG+G+D+TLG  +   RL+ HL   F    K SKD++T  R++ KL+KEA RV +VLSAN + YAQVE++ ++++ + KVTR E E+M +DL  R   PI  A+  AQ+    I  V+LMG GTR+PK +EIL    + +E+   +NTDE+ A+GAVYQAA +S  FKV  F V +  L P+ V+F   KT E    P    + +F   NY    RV+ F+ ++ +F  ++    QD DK  L  VE+       SG  ++ EK VT+     KGVK  F +D  GIVS+     + E+            DK E    EK    +     +  +EK +KK           AA + ++  KT        V KT+  EP+ +       +N     K +       +EE +  ++K +   +Q ++EK   E+A N LE  ++ +  +  D E Y   +TE E+K  ++    L  W+E+     T KE++  +  +L +L    + R +E    P+    +    N S  F     NLT   EG K FT  E + L+KLI  TT+W+      F     N +P +  S+     R LERE+ YL+NK+ I
Sbjct:   13 VAICCLYQPADAALAAMSIDLGSQFIKIGLVKPGVPMDIVLNKESRRKTPNVISFKNDERFFAEAAAAMSSSHPQSSYNFLLSMIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFPYKEEK-YNVETLLAMILWNAKKVTEAYADQTVKDVVITVPIFLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKTTATIVQYVLESTRKDGKD-KQPTLRTVGVGFDKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERVKQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTNDIDLVVLMGAGTRVPKVKEILKTILKDKEISNFLNTDEAIAMGAVYQAAHLSKSFKVLPFNVHEKILYPVFVNFLT-KTEEGTMKP--IRKSLFG-ENYPVPNRVMHFSSYSDDFKIDI----QDADKNPLSTVEI-------SGVKDAIEKEVTDENSVLKGVKTTFSIDLSGIVSVEKASVVVEKVPTPEEKDKYEVDKKEFDEWEKEQEELKKKEKAEKKEKEEKKKTEGEEEKNEDAAGEEKTEEKTEEVEKPVVVKKTKPVEPKAK------KINVALTIKETKTDNIDLNEEEVTAAKKVLGDFEQKEKEKHDREEAMNRLEGLLYDLAVRLEDGEEYAEYATEEEKKAILEEVAVLKLWFEDDVSLETKKEEFDEKRAKLEELTAKPNARKQERLDIPKVAEIIEDHFNRSMTFHAMALNLTQFEEGNKTFTDTELEVLTKLIESTTEWWNEKKDLFEKQAKNEDPVVKASEIAEKARDLEREVRYLVNKLKI 846          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Celegans
Match: T14G8.3 (pep chromosome:WBcel235:X:12861237:12870018:1 gene:WBGene00011771.1 transcript:T14G8.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T14G8.3)

HSP 1 Score: 387.111 bits (993), Expect = 4.460e-119
Identity = 297/845 (35.15%), Postives = 442/845 (52.31%), Query Frame = 2
Query:  173 CIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTE----FKGVKAHFGLDAGGIVSLNYIEALFERQWNSN-------DKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPS----EEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQF-DKEIYTRCSTETERKLAIDAAQALGEWYEEQ-GPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTG--EG-KIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISI 2644
             +A  S+DL S+F+KI +VKPGVPM+I L++ES+RKTP+V+    DER F  AA  M    P+  Y+ +  ++ +         FQK FP+   + DE    + F + E+  + VE LLAM+L NAK + E Y++  +K  +I VP +  Q ER AI  AA IAG N+LQL+N  +A ALNYG+FRRK       + + YD G+  TT +IV Y +   ++ G   + P L  VG+G+D+TLG  +   RL+ HL   F    K SKD++T  R++ KL+KEA RV +VLSAN + YAQVE++ ++++ + KVTR E E+M +DL  R   PI  A+  AQ+    I  V+LMG GTR+PK +EIL    + +E+   +NTDE+ A+GAVYQAA +S  FKV  F V +  L P+ V+F   KT E    P    + +F   NY    RV+ F+ ++ +F  ++    QD DK  L  VE+       SG  ++ EK VT+     KGVK  F +D  GIVS+     + E+            DK E    EK    +     +  +EK +KK           AA + ++  KT        V KT+  EP+ +       +N     K +   +    EE +  ++K +   +Q ++EK   E+A N LE  ++ +  +  D E Y   +TE E+K  ++    L  W+E+     T KE++  +  +L +L    + R +E    P+    +    N S  F     NLT   EG K FT  E + L+KLI  TT+W+      F     N +P +  S+     R LERE+ YL+NK+ I
Sbjct:    9 ALAAMSIDLGSQFIKIGLVKPGVPMDIVLNKESRRKTPNVISFKNDERFFAEAAAAMSSSHPQSSYNFLLSMIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFPYKEEK-YNVETLLAMILWNAKKVTEAYADQTVKDVVITVPIFLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKTTATIVQYVLESTRKDGKD-KQPTLRTVGVGFDKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERVKQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTNDIDLVVLMGAGTRVPKVKEILKTILKDKEISNFLNTDEAIAMGAVYQAAHLSKSFKVLPFNVHEKILYPVFVNFLT-KTEEGTMKP--IRKSLFG-ENYPVPNRVMHFSSYSDDFKIDI----QDADKNPLSTVEI-------SGVKDAIEKEVTDENSVLKGVKTTFSIDLSGIVSVEKASVVVEKVPTPEEKDKYEVDKKEFDEWEKEQEELKKKEKAEKKEKEEKKKTEGEEEKNEDAAGEEKTEEKTEEVEKPVVVKKTKPVEPKAK------KINVALTIKETKTDNIDLNEEEVTAAKKVLGDFEQKEKEKHDREEAMNRLEGLLYDLAVRLEDGEEYAEYATEEEKKAILEEVAVLKLWFEDDVSLETKKEEFDEKRAKLEELTAKPNARKQERLDIPKVAEIIEDHFNRSMTFHAMALNLTQFEEGNKTFTDTELEVLTKLIESTTEWWNEKKDLFEKQAKNEDPVVKASEIAEKARDLEREVRYLVNKLKI 830          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 205.682 bits (522), Expect = 7.955e-56
Identity = 143/419 (34.13%), Postives = 210/419 (50.12%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQL--AFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIA 1417
            S C A   +DL + +  + I + G  +EI  + E  + TPS V     ERL G+AA +   + P+        L+G+  D   V+   K +P+  +K  +   +       EK  F  EE+ AMVL+  K  AETY    +K  +I VP YF   +R A   AA IAG N ++++N  TA AL YG+   K         +F D G     VSI+S           + E     +     D  LG   F  R+  H  + F +  K  KD++  PR++ +L     R  + LS+++E   +V+++ +  DL  K+TRA FEE+C DLF + +EP+ KAL  A+L    I EV+L+GG TR+PK Q++L      +EL  SIN DE+ A GA  QAA +S    VK   +KD  LV +A
Sbjct:    2 SSCKA-IGIDLGTTYSCVGIYQNG-KVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFG-VKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGL--DKGIQDEKNVLIF-DLGGGTFDVSILS-----------IAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKR--KTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLS---GVKDETIKDVLLVDVA 398          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 205.682 bits (522), Expect = 7.955e-56
Identity = 143/419 (34.13%), Postives = 210/419 (50.12%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQL--AFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIA 1417
            S C A   +DL + +  + I + G  +EI  + E  + TPS V     ERL G+AA +   + P+        L+G+  D   V+   K +P+  +K  +   +       EK  F  EE+ AMVL+  K  AETY    +K  +I VP YF   +R A   AA IAG N ++++N  TA AL YG+   K         +F D G     VSI+S           + E     +     D  LG   F  R+  H  + F +  K  KD++  PR++ +L     R  + LS+++E   +V+++ +  DL  K+TRA FEE+C DLF + +EP+ KAL  A+L    I EV+L+GG TR+PK Q++L      +EL  SIN DE+ A GA  QAA +S    VK   +KD  LV +A
Sbjct:    2 SSCKA-IGIDLGTTYSCVGIYQNG-KVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFG-VKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGL--DKGIQDEKNVLIF-DLGGGTFDVSILS-----------IAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKR--KTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLS---GVKDETIKDVLLVDVA 398          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Fly
Match: CG2918 (gene:FBgn0023529 transcript:FBtr0300792)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 341/849 (40.16%), Postives = 499/849 (58.78%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMD-ENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH----SGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQN--LNFITVYKASSLPSE---------EVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTG----EGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+  A  SVDL SE++K+ +V PGVPMEIAL+RES+RKTP+++      R  G  A  +GIK P   Y  +  L+GKT+D+P+V  ++K FPYY I  D E N + F+  +   F+VEEL+A +L  AK  A+   + P+   ++ VP YF Q ER A+L AA++A   VLQL+N   AVALNYG+F R   N TAQY++FYD G+  T+ ++VSYQ+VK K+   +  NP + ++G+GYDRTLG  +  LRL+ +LA  FN LKK   DVTT PR++AKL+KEA R+  VLSAN E +AQ+EN+++D D K+ VTR + E++C+DL+ R  +P+ +AL S+ L +  I +VIL GGGTR+P+ QE  +K    QELGK++N DESA +GAVY+AA +S GFKVK FVVKDA L P+ V F R    +   V     R +F  MN +P K+V+TFNKHT +F+F V     D   K+ +  +   N+T+V        LE S+K + + KG+KA+F LD  GI     +E ++E+Q   +D +E STL K G+T+S LF    EEK D     N+   E   A +  S ++    A  +  +K Q SE   + +T  +N  +  +TV    +  S+            + S  K+  + + +E++  LE A N LE+++  V+ + D+E Y +C+T  E++  +     LGEW  E       E Y  +  +L+KL      R  E+  RPEAI  L  +++ +  FL   +NLT     E  +FTQ E D+L K+I +T  W +        +  N + ++T+ D       L+RE+ YL+NKI IWK
Sbjct:   17 SQGAAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVVFRKSDTDEFSVEELVAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTREI--NPVVQVLGVGYDRTLGGLEIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTRVPRVQET-IKAVIKQELGKNLNADESATMGAVYKAADLSAGFKVKKFVVKDATLFPLQVSFER-DPGDGAAVKQ-VKRALFALMNPYPQKKVITFNKHTDDFEFYVNYADLDRYSKEEIAALGSLNVTKVQLKQVKELLEKSKKELVDNKGIKAYFYLDDSGIFRCTGVEYVYEKQKPEDDADEDSTLSKFGSTLSKLFTKEGEEKKD-----NSEQEEAANAGEEPSKSEDNEKAKEEDASKEQKSEESTKQDTEAKNETIKLVTVKSPVTYESQTQFVVPLVGSAYDQSVAKLAAINKAEEQRVRLESAFNALEAHIIEVQQKLDEESYAKCATAEEKEKLLAECSTLGEWLYEDLEDPKAEIYEEKLAQLKKLSNVFLARHWEHEERPEAIKALKGMIDGAEKFLVTGRNLTKDTNPEKDVFTQVEIDTLDKVITETNAWLKTETAAQKKLAKNADIRLTVKDITDKMSLLDREVKYLVNKIKIWK 855          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Fly
Match: CG2918 (gene:FBgn0023529 transcript:FBtr0070411)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 341/849 (40.16%), Postives = 499/849 (58.78%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMD-ENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH----SGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQN--LNFITVYKASSLPSE---------EVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTG----EGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+  A  SVDL SE++K+ +V PGVPMEIAL+RES+RKTP+++      R  G  A  +GIK P   Y  +  L+GKT+D+P+V  ++K FPYY I  D E N + F+  +   F+VEEL+A +L  AK  A+   + P+   ++ VP YF Q ER A+L AA++A   VLQL+N   AVALNYG+F R   N TAQY++FYD G+  T+ ++VSYQ+VK K+   +  NP + ++G+GYDRTLG  +  LRL+ +LA  FN LKK   DVTT PR++AKL+KEA R+  VLSAN E +AQ+EN+++D D K+ VTR + E++C+DL+ R  +P+ +AL S+ L +  I +VIL GGGTR+P+ QE  +K    QELGK++N DESA +GAVY+AA +S GFKVK FVVKDA L P+ V F R    +   V     R +F  MN +P K+V+TFNKHT +F+F V     D   K+ +  +   N+T+V        LE S+K + + KG+KA+F LD  GI     +E ++E+Q   +D +E STL K G+T+S LF    EEK D     N+   E   A +  S ++    A  +  +K Q SE   + +T  +N  +  +TV    +  S+            + S  K+  + + +E++  LE A N LE+++  V+ + D+E Y +C+T  E++  +     LGEW  E       E Y  +  +L+KL      R  E+  RPEAI  L  +++ +  FL   +NLT     E  +FTQ E D+L K+I +T  W +        +  N + ++T+ D       L+RE+ YL+NKI IWK
Sbjct:   17 SQGAAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVVFRKSDTDEFSVEELVAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTREI--NPVVQVLGVGYDRTLGGLEIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTRVPRVQET-IKAVIKQELGKNLNADESATMGAVYKAADLSAGFKVKKFVVKDATLFPLQVSFER-DPGDGAAVKQ-VKRALFALMNPYPQKKVITFNKHTDDFEFYVNYADLDRYSKEEIAALGSLNVTKVQLKQVKELLEKSKKELVDNKGIKAYFYLDDSGIFRCTGVEYVYEKQKPEDDADEDSTLSKFGSTLSKLFTKEGEEKKD-----NSEQEEAANAGEEPSKSEDNEKAKEEDASKEQKSEESTKQDTEAKNETIKLVTVKSPVTYESQTQFVVPLVGSAYDQSVAKLAAINKAEEQRVRLESAFNALEAHIIEVQQKLDEESYAKCATAEEKEKLLAECSTLGEWLYEDLEDPKAEIYEEKLAQLKKLSNVFLARHWEHEERPEAIKALKGMIDGAEKFLVTGRNLTKDTNPEKDVFTQVEIDTLDKVITETNAWLKTETAAQKKLAKNADIRLTVKDITDKMSLLDREVKYLVNKIKIWK 855          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Fly
Match: Hsp68 (gene:FBgn0001230 transcript:FBtr0084589)

HSP 1 Score: 189.119 bits (479), Expect = 3.418e-50
Identity = 132/412 (32.04%), Postives = 203/412 (49.27%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQ-HDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQY-YMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIA 1417
             +DL + +  + + + G  +EI  + +  R TPS V     ERL G+AA N     PK        L+G+  D   +++  K +P+  I  +   +++ +       F+ EE+ +MVL   K  AE Y    +K  +I VP YF   +R A   A  IAG NVL+++N  TA AL YG+ +    N   +   + +D G     VSI++             E     +     D  LG   F  RL  H A  F +  K  KD+ + PR++ +L   A R  + LS++ E   +++ + +  D   KV+RA FEE+C DLF   +EP+ KAL+ A++    I +++L+GG TRIPK Q +L      + L  SIN DE+ A GA  QAA +S     K+  +KD  LV +A
Sbjct:    5 GIDLGTTYSCVGVFQYG-KVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDK----NLKGERNVLIFDLGGGTFDVSILTID-----------EGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKR--KYKKDLRSNPRALRRLRTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKMDKSQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGD---KSSEIKDVLLVDVA 395          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 189.504 bits (480), Expect = 3.676e-50
Identity = 123/391 (31.46%), Postives = 191/391 (48.85%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQH-DEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFI 1357
             +DL + +  + + + G  +EI  + +  R TPS V     ERL G+AA N     P         L+G+  D   V+   K +P+  +  D   ++   + DEK  F  EE+ +MVL   K  AE Y    +   +I VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++       +  + +D G     VSI+S            +++    +     D  LG   F  RL  H    F +  K  KD+TT  R++ +L     R  + LS++ +   +++++ +  D    +TRA FEE+  DLF   ++P+ KAL  A+L    I +++L+GG TRIPK Q +L      +EL KSIN DE+ A GA  QAA +
Sbjct:    8 GIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAV---GERNVLIFDLGGGTFDVSILS------------IDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKR--KHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAIL 380          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 189.504 bits (480), Expect = 3.676e-50
Identity = 123/391 (31.46%), Postives = 191/391 (48.85%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQH-DEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFI 1357
             +DL + +  + + + G  +EI  + +  R TPS V     ERL G+AA N     P         L+G+  D   V+   K +P+  +  D   ++   + DEK  F  EE+ +MVL   K  AE Y    +   +I VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++       +  + +D G     VSI+S            +++    +     D  LG   F  RL  H    F +  K  KD+TT  R++ +L     R  + LS++ +   +++++ +  D    +TRA FEE+  DLF   ++P+ KAL  A+L    I +++L+GG TRIPK Q +L      +EL KSIN DE+ A GA  QAA +
Sbjct:    8 GIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAV---GERNVLIFDLGGGTFDVSILS------------IDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKR--KHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAIL 380          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Zebrafish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 352/890 (39.55%), Postives = 514/890 (57.75%), Query Frame = 2
Query:  119 FKFWFSVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS-----------------DKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLH---------------------QNLNFITVYKASSL-------PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
               W    +V+++  S++E +A  SVDL SE++K+AIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+ + +K PK +Y  +  ++GKT D+P V ++QK FP ++++ DE    + F+  E+  +T EELL M+L  ++ +A+ ++E P+K  +I VP YF Q ER A+L+AA IAG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT +IV+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTR+EFE +C+DLF+R   P+ +AL +A++ M  I++VIL+GG TR+PK Q++LLK+   +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  M  +P ++V+TFN++  +F F +  G    + ++ +     +NLT V  SG   S +KH   E KG+KAHF +D  G++ L+ +E++FE         E STL K+GNTIS+LFG  + E S                  K+ D      ETV         K A     +     + +E Q   E+                       Q  + I+   A  L       PS E +E S+KK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++           W +E+G +   +    + +EL+KL   + FRV E    P+ ++ L+S+LN SN FL++ + +    +IFT+ E  +L K+I +T  W          +   + P +   D E     L+RE+ YLLN
Sbjct:    5 LSLWAIFCLVVAFLPSQTESVAVMSVDLGSEWMKVAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVAVKNPKVVYRFLQSILGKTADNPQVAEYQKHFPEHQLQKDEKRGTVYFKFSEEMQYTPEELLGMILNYSRTLAQDFAEQPIKDAVITVPAYFNQAERRAVLQAAHIAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNIMFYDMGSGSTTATIVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSKKDVRDNLRAMAKLLKEAQRLKTVLSANAEHTAQIEGLMDDIDFKAKVTRSEFEALCEDLFDRVPGPVKQALAAAEMSMDEIEQVILVGGATRVPKVQDVLLKSVGKEELSKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPIQVEFSRETEEEDGVKSLKH-NKRILFQRMAPYPQRKVITFNRYIDDFVFYINYGDLSFLSEQDMKVFGSQNLTTVKLSGVGSSFKKHSDAESKGIKAHFNMDESGVLILDRVESVFETIVEEK--EEESTLTKLGNTISSLFGGGSSEPSANVTEPVTDEEEVTPEAGKEQDQPEKQEETVQEKPETEEGKEAEPQAEEQKEDKEKAENQGETESEKTEKPEEKTTDEEKEADMKPKLQKKSKISADIAVELEVNDVLDPSTEDMEGSKKKLQDLTDRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEQISGRLSEASSWMDEEGYSAGTKLLKEKLSELKKLCKGMFFRVEERKKWPDRLAALDSMLNHSNIFLKSARLIPESDQIFTEVELKTLEKVINETITWKNETVAEQEKLSPTVKPVLLSKDIEAKLSLLDREVNYLLN 888          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Zebrafish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 352/890 (39.55%), Postives = 514/890 (57.75%), Query Frame = 2
Query:  119 FKFWFSVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS-----------------DKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLH---------------------QNLNFITVYKASSL-------PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
               W    +V+++  S++E +A  SVDL SE++K+AIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+ + +K PK +Y  +  ++GKT D+P V ++QK FP ++++ DE    + F+  E+  +T EELL M+L  ++ +A+ ++E P+K  +I VP YF Q ER A+L+AA IAG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT +IV+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTR+EFE +C+DLF+R   P+ +AL +A++ M  I++VIL+GG TR+PK Q++LLK+   +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  M  +P ++V+TFN++  +F F +  G    + ++ +     +NLT V  SG   S +KH   E KG+KAHF +D  G++ L+ +E++FE         E STL K+GNTIS+LFG  + E S                  K+ D      ETV         K A     +     + +E Q   E+                       Q  + I+   A  L       PS E +E S+KK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++           W +E+G +   +    + +EL+KL   + FRV E    P+ ++ L+S+LN SN FL++ + +    +IFT+ E  +L K+I +T  W          +   + P +   D E     L+RE+ YLLN
Sbjct:    5 LSLWAIFCLVVAFLPSQTESVAVMSVDLGSEWMKVAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVAVKNPKVVYRFLQSILGKTADNPQVAEYQKHFPEHQLQKDEKRGTVYFKFSEEMQYTPEELLGMILNYSRTLAQDFAEQPIKDAVITVPAYFNQAERRAVLQAAHIAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNIMFYDMGSGSTTATIVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSKKDVRDNLRAMAKLLKEAQRLKTVLSANAEHTAQIEGLMDDIDFKAKVTRSEFEALCEDLFDRVPGPVKQALAAAEMSMDEIEQVILVGGATRVPKVQDVLLKSVGKEELSKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPIQVEFSRETEEEDGVKSLKH-NKRILFQRMAPYPQRKVITFNRYIDDFVFYINYGDLSFLSEQDMKVFGSQNLTTVKLSGVGSSFKKHSDAESKGIKAHFNMDESGVLILDRVESVFETIVEEK--EEESTLTKLGNTISSLFGGGSSEPSANVTEPVTDEEEVTPEAGKEQDQPEKQEETVQEKPETEEGKEAEPQAEEQKEDKEKAENQGETESEKTEKPEEKTTDEEKEADMKPKLQKKSKISADIAVELEVNDVLDPSTEDMEGSKKKLQDLTDRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEQISGRLSEASSWMDEEGYSAGTKLLKEKLSELKKLCKGMFFRVEERKKWPDRLAALDSMLNHSNIFLKSARLIPESDQIFTEVELKTLEKVINETITWKNETVAEQEKLSPTVKPVLLSKDIEAKLSLLDREVNYLLN 888          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Zebrafish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 352/890 (39.55%), Postives = 514/890 (57.75%), Query Frame = 2
Query:  119 FKFWFSVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS-----------------DKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLH---------------------QNLNFITVYKASSL-------PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
               W    +V+++  S++E +A  SVDL SE++K+AIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+ + +K PK +Y  +  ++GKT D+P V ++QK FP ++++ DE    + F+  E+  +T EELL M+L  ++ +A+ ++E P+K  +I VP YF Q ER A+L+AA IAG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT +IV+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTR+EFE +C+DLF+R   P+ +AL +A++ M  I++VIL+GG TR+PK Q++LLK+   +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  M  +P ++V+TFN++  +F F +  G    + ++ +     +NLT V  SG   S +KH   E KG+KAHF +D  G++ L+ +E++FE         E STL K+GNTIS+LFG  + E S                  K+ D      ETV         K A     +     + +E Q   E+                       Q  + I+   A  L       PS E +E S+KK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++           W +E+G +   +    + +EL+KL   + FRV E    P+ ++ L+S+LN SN FL++ + +    +IFT+ E  +L K+I +T  W          +   + P +   D E     L+RE+ YLLN
Sbjct:   28 LSLWAIFCLVVAFLPSQTESVAVMSVDLGSEWMKVAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVAVKNPKVVYRFLQSILGKTADNPQVAEYQKHFPEHQLQKDEKRGTVYFKFSEEMQYTPEELLGMILNYSRTLAQDFAEQPIKDAVITVPAYFNQAERRAVLQAAHIAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNIMFYDMGSGSTTATIVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSKKDVRDNLRAMAKLLKEAQRLKTVLSANAEHTAQIEGLMDDIDFKAKVTRSEFEALCEDLFDRVPGPVKQALAAAEMSMDEIEQVILVGGATRVPKVQDVLLKSVGKEELSKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPIQVEFSRETEEEDGVKSLKH-NKRILFQRMAPYPQRKVITFNRYIDDFVFYINYGDLSFLSEQDMKVFGSQNLTTVKLSGVGSSFKKHSDAESKGIKAHFNMDESGVLILDRVESVFETIVEEK--EEESTLTKLGNTISSLFGGGSSEPSANVTEPVTDEEEVTPEAGKEQDQPEKQEETVQEKPETEEGKEAEPQAEEQKEDKEKAENQGETESEKTEKPEEKTTDEEKEADMKPKLQKKSKISADIAVELEVNDVLDPSTEDMEGSKKKLQDLTDRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEQISGRLSEASSWMDEEGYSAGTKLLKEKLSELKKLCKGMFFRVEERKKWPDRLAALDSMLNHSNIFLKSARLIPESDQIFTEVELKTLEKVINETITWKNETVAEQEKLSPTVKPVLLSKDIEAKLSLLDREVNYLLN 911          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Zebrafish
Match: hsph1 (heat shock 105/110 protein 1 [Source:ZFIN;Acc:ZDB-GENE-120410-4])

HSP 1 Score: 204.912 bits (520), Expect = 5.573e-54
Identity = 211/843 (25.03%), Postives = 377/843 (44.72%), Query Frame = 2
Query:  146 VLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN---QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRK--AFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANN-EIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSN---TVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQN----RIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNK 2635
            +L+  S+   +A    D+  +   IA+VK G  +E   +  + R TPSV+      R  GNAA N  I  P         L  +     VV+  + + PY  + +++     Q+ +  D++  F++E++ AM+L   K IAE   +  +   +I +P +FT  ER ++L AA+IAG N L+LMN +TAVALNYGI++      +   +   F D G SA  VSI ++   KVK            ++   +D  LG   F  RL  H    F    K   DV +  R++ +L +E  ++ K++S+N+ E+   +E  +DDKD+  ++ RA+FEEMC DL ER    + KA+E A + +  I  V ++GG TRIP  +   + +   +++  ++N DE+ A G   Q A +SP F+V+ F + D    PI++  +  +  E K     +   IF   +  P  +++TF ++ K F           DK +L F E K + E     ++  E        VK      +G +   +    L  R       ++ S + +I   + +   S   +  DK ++ N   +V  E +       + K  +     S+N    S P +    +++  H  L     +    LP + +   + ++   ++Q D ++     A+N +E  V+  + + +    T  + +  +  + +       W  ++G    K+ YI R  E+ KL   ++ R RE   RP     L++ + S    +E+ KN +         + D +   + DT  W      + + +  +  P I  +  +   + L    G +++K
Sbjct:   53 LLAVPSRVRDMAVVGFDVGFQNCCIAVVKSG-GIETVSNEFTDRCTPSVISFGSKNRAIGNAAKNQMITNPSSTVFHFKRLHSRLYHDKVVQAEKANLPYDLVPLNDGKVGVQVMYL-DQEHHFSIEQISAMLLTKLKDIAEANLQKKVLECVISIPSFFTDSERRSVLDAAKIAGLNCLKLMNDSTAVALNYGIYKEDLPGSDENPKIVAFVDLGHSAFQVSICAFNRGKVK------------VLSTAFDPYLGGKDFDQRLVDHFCAEFK--SKYMMDVKSKTRALLRLTQECEKLKKLMSSNSTELSLNIECFIDDKDVCGRMNRAKFEEMCADLIERVKFTLMKAVEQAGVRLQDISAVEIVGGATRIPAVK-AQISSFFRRDVSTTLNADEAVARGCALQCAMLSPAFRVREFSITDVIPFPISLS-WSSEADEGK-----SCHEIFSRNHPCPSAKMITFYRN-KPFILEAFYS----DKSSLPFPEAK-IGEYKVQNIQPQENREKAKVKVKVEVNR-SGVVSVSSAAVVLRVR-------SDESEITEINEDVDSHDASDDTDVQDKTEEVNIELSVNKENLPTAQCPPMEKEQNQRETLSMNGEVNSHPPHAKKAKMKVKHVVLPMEETFN-QQLPKDRLSAYTEQENKMIQQ-DRQEKERNNAKNAVEENVYYFRHKLEGSYQTFLNAQEHQAFS-ELLNGTENWLYDEGADQDKQTYINRLAEIHKLGLPVENRYRESIRRPRMFEELSAKIQSYMTIVEDYKNGSESYCHIDAMDMDKVRVCVKDTQVWMTNIQDSQDKLTPDQEPAIHSTQIQKKLQTLNNVCGEIVSK 855          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 191.815 bits (486), Expect = 6.418e-51
Identity = 122/391 (31.20%), Postives = 197/391 (50.38%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQH-DEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFI 1357
             +DL + +  + + + G  +EI  + +  R TPS V     ERL G+AA N     P         L+G+  D PVV+   K + +  +      ++A +H  E   F  EE+ +MVL   K IAE Y    +   +I VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ + K   ++ +  + +D G     VSI++            +E+    +     D  LG   F  R+  H    F +  K  KD++   R++ +L     R  + LS++++   +++++ +  D    +TRA FEE+C DLF   ++P+ KAL+ A++    I +++L+GG TRIPK Q++L      +EL KSIN DE+ A GA  QAA +
Sbjct:   10 GIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFKVVSDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGK---SSERNVLIFDLGGGTFDVSILT------------IEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKR--KHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGIDFYTSITRARFEELCSDLFRGTLDPVEKALKDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAIL 382          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Xenopus
Match: pawr (PRKC, apoptosis, WT1, regulator [Source:Xenbase;Acc:XB-GENE-987162])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 350/845 (41.42%), Postives = 521/845 (61.66%), Query Frame = 2
Query:  158 FSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLF--GSSTEEKSDKKDDSNTVT-----NETVA-ANDTQSINKTASNATGDSVNKTQTSEP--QNRIETL--HQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETER-KLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNK 2635
            F ++  +A  SVD+ SE++KIAIVKPGVPMEI L++ES+RKTP  + + ++ERLFG++A+ M +K PK  +     L+GK  D+P VK F+  FP Y++  DE+ + + F+  E+  ++ EELL M+L  ++ +AE ++E P+K  +I VP +F Q ER A+L+AA+++   VLQL+N NTAVALNYG+FRRK  N TAQ  MFY+ GS +T  +IV+YQ VK K+ GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+M+KL KEA+RV  +LSANN+  AQ+E ++DD D K KVTR E E++C DLF R   P+  AL SA++ M  I +VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  +  +P ++V+TFN++T NF F++  G    +    L      NLT V  +G  ES +K    E KG+KAHF +D  G+++L+ +EA+FE   +   + E STL K+GNTIS+LF  GSS  E  +   DS  V+      +T++   + Q   K  ++A    V+  + + P  Q  ++ +   Q LN I  +      SEE ++ + KK+  L + D  K   EKA N LE+++F  + + +++ + + ST  +R +++   +QA   W EE+G A   ++   + +EL+K+   + F+V E    P+ ++ L+S+LN S+ FL++ + +  + +IFT  E  +L KLI DT  W          + L   P +   D E    AL+RE+ YLLNK
Sbjct:    4 FCETSSVAVMSVDMGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAIALKENERLFGDSALGMAVKNPKVTFRYFQDLLGKRADNPHVKAFEARFPEYQLVKDEHRETVLFKLSEELTYSPEELLGMMLNYSRSLAEEFAEQPVKDVVITVPAFFNQAERRAVLQAAQLSDLKVLQLINDNTAVALNYGVFRRKDINATAQNIMFYEMGSRSTICTIVTYQSVKTKDSGM---QPQLQIRGVGFDRTLGGIEMDLRLRDHLAKLFNEQKKSKKDVRENQRAMSKLLKEANRVKTILSANNDHMAQIEGLMDDIDFKAKVTRQELEDLCADLFNRVSAPVQHALSSAEMKMEEIDQVILVGGATRVPKVQELLLKVVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAAIFPIQVEFTREVEEEDHSKSLKH-NKRILFQRLAPYPQRKVITFNRYTDNFAFSINYGDLSYLGPDDLKVFGSLNLTTVKLNGVGESFQKRSDYESKGIKAHFNMDESGLLTLDRVEAVFETVVDEKPEQE-STLTKLGNTISSLFGGGSSVPETKENATDSVQVSYLFAFMKTISEEKEKQETGKEEASAKAPEVDAKKHTAPKKQKLVDDIGVEQTLNDIPDF------SEEELKKASKKLQDLTERDLNKHEREKAANSLEAFIFETQDKLNQDEFKQVSTTEQREEISAKLSQA-STWLEEEGYAAITKELKDKLSELKKICKALFFKVEERRKWPDRLAALDSLLNHSSIFLKSARMIPEDDQIFTDVELGTLEKLISDTWTWKNETLAEQAKLSLTEKPVLLSKDIEMKIGALDREVQYLLNK 836          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Xenopus
Match: pawr (PRKC, apoptosis, WT1, regulator [Source:Xenbase;Acc:XB-GENE-987162])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 348/834 (41.73%), Postives = 516/834 (61.87%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLF--GSSTEEKSDKKDDSNTVT-----NETVAANDTQSINKTASNATGDSVNKTQTSEP--QNRIETL--HQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETER-KLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNK 2635
            SVD+ SE++KIAIVKPGVPMEI L++ES+RKTP  + + ++ERLFG++A+ M +K PK  +     L+GK  D+P VK F+  FP Y++  DE+ + + F+  E+  ++ EELL M+L  ++ +AE ++E P+K  +I VP +F Q ER A+L+AA+++   VLQL+N NTAVALNYG+FRRK  N TAQ  MFY+ GS +T  +IV+YQ VK K+ GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+M+KL KEA+RV  +LSANN+  AQ+E ++DD D K KVTR E E++C DLF R   P+  AL SA++ M  I +VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  +  +P ++V+TFN++T NF F++  G    +    L      NLT V  +G  ES +K    E KG+KAHF +D  G+++L+ +EA+FE   +   + E STL K+GNTIS+LF  GSS  E  +   DS  V+      +T++  + Q   K  ++A    V+  + + P  Q  ++ +   Q LN I  +      SEE ++ + KK+  L + D  K   EKA N LE+++F  + + +++ + + ST  +R +++   +QA   W EE+G A   ++   + +EL+K+   + F+V E    P+ ++ L+S+LN S+ FL++ + +  + +IFT  E  +L KLI DT  W          + L   P +   D E    AL+RE+ YLLNK
Sbjct:    2 SVDMGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAIALKENERLFGDSALGMAVKNPKVTFRYFQDLLGKRADNPHVKAFEARFPEYQLVKDEHRETVLFKLSEELTYSPEELLGMMLNYSRSLAEEFAEQPVKDVVITVPAFFNQAERRAVLQAAQLSDLKVLQLINDNTAVALNYGVFRRKDINATAQNIMFYEMGSRSTICTIVTYQSVKTKDSGM---QPQLQIRGVGFDRTLGGIEMDLRLRDHLAKLFNEQKKSKKDVRENQRAMSKLLKEANRVKTILSANNDHMAQIEGLMDDIDFKAKVTRQELEDLCADLFNRVSAPVQHALSSAEMKMEEIDQVILVGGATRVPKVQELLLKVVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAAIFPIQVEFTREVEEEDHSKSLKH-NKRILFQRLAPYPQRKVITFNRYTDNFAFSINYGDLSYLGPDDLKVFGSLNLTTVKLNGVGESFQKRSDYESKGIKAHFNMDESGLLTLDRVEAVFETVVDEKPEQE-STLTKLGNTISSLFGGGSSVPETKENATDSVQVSYLFAFMKTISEKEKQETGKEEASAKAPEVDAKKHTAPKKQKLVDDIGVEQTLNDIPDF------SEEELKKASKKLQDLTERDLNKHEREKAANSLEAFIFETQDKLNQDEFKQVSTTEQREEISAKLSQA-STWLEEEGYAAITKELKDKLSELKKICKALFFKVEERRKWPDRLAALDSLLNHSSIFLKSARMIPEDDQIFTDVELGTLEKLISDTWTWKNETLAEQAKLSLTEKPVLLSKDIEMKIGALDREVQYLLNK 823          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Xenopus
Match: pawr (PRKC, apoptosis, WT1, regulator [Source:Xenbase;Acc:XB-GENE-987162])

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 349/841 (41.50%), Postives = 519/841 (61.71%), Query Frame = 2
Query:  170 ECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLF--GSSTEEKSDKKDDSNTVT-----NETVA-ANDTQSINKTASNATGDSVNKTQTSEP--QNRIETL--HQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETER-KLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNK 2635
            + +A  SVD+ SE++KIAIVKPGVPMEI L++ES+RKTP  + + ++ERLFG++A+ M +K PK  +     L+GK  D+P VK F+  FP Y++  DE+ + + F+  E+  ++ EELL M+L  ++ +AE ++E P+K  +I VP +F Q ER A+L+AA+++   VLQL+N NTAVALNYG+FRRK  N TAQ  MFY+ GS +T  +IV+YQ VK K+ GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+M+KL KEA+RV  +LSANN+  AQ+E ++DD D K KVTR E E++C DLF R   P+  AL SA++ M  I +VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  +  +P ++V+TFN++T NF F++  G    +    L      NLT V  +G  ES +K    E KG+KAHF +D  G+++L+ +EA+FE   +   + E STL K+GNTIS+LF  GSS  E  +   DS  V+      +T++   + Q   K  ++A    V+  + + P  Q  ++ +   Q LN I  +      SEE ++ + KK+  L + D  K   EKA N LE+++F  + + +++ + + ST  +R +++   +QA   W EE+G A   ++   + +EL+K+   + F+V E    P+ ++ L+S+LN S+ FL++ + +  + +IFT  E  +L KLI DT  W          + L   P +   D E    AL+RE+ YLLNK
Sbjct:   20 QSVAVMSVDMGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAIALKENERLFGDSALGMAVKNPKVTFRYFQDLLGKRADNPHVKAFEARFPEYQLVKDEHRETVLFKLSEELTYSPEELLGMMLNYSRSLAEEFAEQPVKDVVITVPAFFNQAERRAVLQAAQLSDLKVLQLINDNTAVALNYGVFRRKDINATAQNIMFYEMGSRSTICTIVTYQSVKTKDSGM---QPQLQIRGVGFDRTLGGIEMDLRLRDHLAKLFNEQKKSKKDVRENQRAMSKLLKEANRVKTILSANNDHMAQIEGLMDDIDFKAKVTRQELEDLCADLFNRVSAPVQHALSSAEMKMEEIDQVILVGGATRVPKVQELLLKVVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAAIFPIQVEFTREVEEEDHSKSLKH-NKRILFQRLAPYPQRKVITFNRYTDNFAFSINYGDLSYLGPDDLKVFGSLNLTTVKLNGVGESFQKRSDYESKGIKAHFNMDESGLLTLDRVEAVFETVVDEKPEQE-STLTKLGNTISSLFGGGSSVPETKENATDSVQVSYLFAFMKTISEEKEKQETGKEEASAKAPEVDAKKHTAPKKQKLVDDIGVEQTLNDIPDF------SEEELKKASKKLQDLTERDLNKHEREKAANSLEAFIFETQDKLNQDEFKQVSTTEQREEISAKLSQA-STWLEEEGYAAITKELKDKLSELKKICKALFFKVEERRKWPDRLAALDSLLNHSSIFLKSARMIPEDDQIFTDVELGTLEKLISDTWTWKNETLAEQAKLSLTEKPVLLSKDIEMKIGALDREVQYLLNK 848          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Xenopus
Match: pawr (PRKC, apoptosis, WT1, regulator [Source:Xenbase;Acc:XB-GENE-987162])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 349/840 (41.55%), Postives = 518/840 (61.67%), Query Frame = 2
Query:  173 CIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLF--GSSTEEKSDKKDDSNTVT-----NETVA-ANDTQSINKTASNATGDSVNKTQTSEP--QNRIETL--HQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETER-KLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNK 2635
             +A  SVD+ SE++KIAIVKPGVPMEI L++ES+RKTP  + + ++ERLFG++A+ M +K PK  +     L+GK  D+P VK F+  FP Y++  DE+ + + F+  E+  ++ EELL M+L  ++ +AE ++E P+K  +I VP +F Q ER A+L+AA+++   VLQL+N NTAVALNYG+FRRK  N TAQ  MFY+ GS +T  +IV+YQ VK K+ GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+M+KL KEA+RV  +LSANN+  AQ+E ++DD D K KVTR E E++C DLF R   P+  AL SA++ M  I +VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  +  +P ++V+TFN++T NF F++  G    +    L      NLT V  +G  ES +K    E KG+KAHF +D  G+++L+ +EA+FE   +   + E STL K+GNTIS+LF  GSS  E  +   DS  V+      +T++   + Q   K  ++A    V+  + + P  Q  ++ +   Q LN I  +      SEE ++ + KK+  L + D  K   EKA N LE+++F  + + +++ + + ST  +R +++   +QA   W EE+G A   ++   + +EL+K+   + F+V E    P+ ++ L+S+LN S+ FL++ + +  + +IFT  E  +L KLI DT  W          + L   P +   D E    AL+RE+ YLLNK
Sbjct:    3 SVAVMSVDMGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAIALKENERLFGDSALGMAVKNPKVTFRYFQDLLGKRADNPHVKAFEARFPEYQLVKDEHRETVLFKLSEELTYSPEELLGMMLNYSRSLAEEFAEQPVKDVVITVPAFFNQAERRAVLQAAQLSDLKVLQLINDNTAVALNYGVFRRKDINATAQNIMFYEMGSRSTICTIVTYQSVKTKDSGM---QPQLQIRGVGFDRTLGGIEMDLRLRDHLAKLFNEQKKSKKDVRENQRAMSKLLKEANRVKTILSANNDHMAQIEGLMDDIDFKAKVTRQELEDLCADLFNRVSAPVQHALSSAEMKMEEIDQVILVGGATRVPKVQELLLKVVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAAIFPIQVEFTREVEEEDHSKSLKH-NKRILFQRLAPYPQRKVITFNRYTDNFAFSINYGDLSYLGPDDLKVFGSLNLTTVKLNGVGESFQKRSDYESKGIKAHFNMDESGLLTLDRVEAVFETVVDEKPEQE-STLTKLGNTISSLFGGGSSVPETKENATDSVQVSYLFAFMKTISEEKEKQETGKEEASAKAPEVDAKKHTAPKKQKLVDDIGVEQTLNDIPDF------SEEELKKASKKLQDLTERDLNKHEREKAANSLEAFIFETQDKLNQDEFKQVSTTEQREEISAKLSQA-STWLEEEGYAAITKELKDKLSELKKICKALFFKVEERRKWPDRLAALDSLLNHSSIFLKSARMIPEDDQIFTDVELGTLEKLISDTWTWKNETLAEQAKLSLTEKPVLLSKDIEMKIGALDREVQYLLNK 830          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Xenopus
Match: pawr (PRKC, apoptosis, WT1, regulator [Source:Xenbase;Acc:XB-GENE-987162])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 350/892 (39.24%), Postives = 525/892 (58.86%), Query Frame = 2
Query:  131 FSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVT--------------NETVAANDTQ--------------------------------SINKTASNATGDSVNKTQTSEP--QNRIETL--HQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETER-KLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNK 2635
            F++ ++    S +E +A  SVD+ SE++KIAIVKPGVPMEI L++ES+RKTP  + + ++ERLFG++A+ M +K PK  +     L+GK  D+P VK F+  FP Y++  DE+ + + F+  E+  ++ EELL M+L  ++ +AE ++E P+K  +I VP +F Q ER A+L+AA+++   VLQL+N NTAVALNYG+FRRK  N TAQ  MFY+ GS +T  +IV+YQ VK K+ GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+M+KL KEA+RV  +LSANN+  AQ+E ++DD D K KVTR E E++C DLF R   P+  AL SA++ M  I +VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  +  +P ++V+TFN++T NF F++  G    +    L      NLT V  +G  ES +K    E KG+KAHF +D  G+++L+ +EA+FE   +   + E STL K+GNTIS+LFG  +     K++ +++V                E+  A D Q                                   K  ++A    V+  + + P  Q  ++ +   Q LN I  +      SEE ++ + KK+  L + D  K   EKA N LE+++F  + + +++ + + ST  +R +++   +QA   W EE+G A   ++   + +EL+K+   + F+V E    P+ ++ L+S+LN S+ FL++ + +  + +IFT  E  +L KLI DT  W          + L   P +   D E    AL+RE+ YLLNK
Sbjct:   18 FTMFLLALLSSNTESVAVMSVDMGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAIALKENERLFGDSALGMAVKNPKVTFRYFQDLLGKRADNPHVKAFEARFPEYQLVKDEHRETVLFKLSEELTYSPEELLGMMLNYSRSLAEEFAEQPVKDVVITVPAFFNQAERRAVLQAAQLSDLKVLQLINDNTAVALNYGVFRRKDINATAQNIMFYEMGSRSTICTIVTYQSVKTKDSGM---QPQLQIRGVGFDRTLGGIEMDLRLRDHLAKLFNEQKKSKKDVRENQRAMSKLLKEANRVKTILSANNDHMAQIEGLMDDIDFKAKVTRQELEDLCADLFNRVSAPVQHALSSAEMKMEEIDQVILVGGATRVPKVQELLLKVVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAAIFPIQVEFTREVEEEDHSKSLKH-NKRILFQRLAPYPQRKVITFNRYTDNFAFSINYGDLSYLGPDDLKVFGSLNLTTVKLNGVGESFQKRSDYESKGIKAHFNMDESGLLTLDRVEAVFETVVDEKPEQE-STLTKLGNTISSLFGGGSSVPETKENATDSVQEEDEVPTEPTKEEEQESADAADKQKDKEKGTTATNEEEEGKKEEEKSEPQEEKEKQETGKEEASAKAPEVDAKKHTAPKKQKLVDDIGVEQTLNDIPDF------SEEELKKASKKLQDLTERDLNKHEREKAANSLEAFIFETQDKLNQDEFKQVSTTEQREEISAKLSQA-STWLEEEGYAAITKELKDKLSELKKICKALFFKVEERRKWPDRLAALDSLLNHSSIFLKSARMIPEDDQIFTDVELGTLEKLISDTWTWKNETLAEQAKLSLTEKPVLLSKDIEMKIGALDREVQYLLNK 897          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Mouse
Match: Hyou1 (hypoxia up-regulated 1 [Source:MGI Symbol;Acc:MGI:108030])

HSP 1 Score: 506.523 bits (1303), Expect = 4.705e-163
Identity = 280/584 (47.95%), Postives = 387/584 (66.27%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKK--PSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNE 1885
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP  V + ++ER  G++A  M IK PK        L+GK  D+P V  ++  FP +E+ +D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  N+TAQ  MFYD GS +T  +IV+YQ VK KE GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLF+R   P+ +AL+SA++ +  I++VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  ES +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   SD K++      E
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELIVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNVMFYDMGSGSTVCTIVTYQTVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGATRVPKVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTR----EVEEEPGLRSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSPEEESTLTKLGNTISSLFGGGT--SSDAKENGTDAVQE 603          

HSP 2 Score: 91.2781 bits (225), Expect = 4.480e-18
Identity = 77/270 (28.52%), Postives = 121/270 (44.81%), Query Frame = 2
Query: 1841 EKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            EK D+K+  +    E    N+        +    +   K + +  Q  +E +   L    V     LP +E+   S +K+ +L   D EK   EKA N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    ++FT+ E  +L K+I DT  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:  650 EKPDEKESGDK--PEAQKPNEKGQAGPEGAAPAPEEDKKPKPARKQKMVEEIGVEL---AVLDLPDLPEDELAR-SVQKLEELTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATSTWLEDEGFGATTVMLKDKLAELRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGARLIPEMDQVFTEVEMTTLEKVINDTWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 913          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Mouse
Match: Hyou1 (hypoxia up-regulated 1 [Source:MGI Symbol;Acc:MGI:108030])

HSP 1 Score: 506.523 bits (1303), Expect = 4.705e-163
Identity = 280/584 (47.95%), Postives = 387/584 (66.27%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKK--PSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNE 1885
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP  V + ++ER  G++A  M IK PK        L+GK  D+P V  ++  FP +E+ +D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  N+TAQ  MFYD GS +T  +IV+YQ VK KE GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLF+R   P+ +AL+SA++ +  I++VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  ES +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   SD K++      E
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELIVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNVMFYDMGSGSTVCTIVTYQTVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGATRVPKVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTR----EVEEEPGLRSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSPEEESTLTKLGNTISSLFGGGT--SSDAKENGTDAVQE 603          

HSP 2 Score: 91.2781 bits (225), Expect = 4.480e-18
Identity = 77/270 (28.52%), Postives = 121/270 (44.81%), Query Frame = 2
Query: 1841 EKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            EK D+K+  +    E    N+        +    +   K + +  Q  +E +   L    V     LP +E+   S +K+ +L   D EK   EKA N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    ++FT+ E  +L K+I DT  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:  650 EKPDEKESGDK--PEAQKPNEKGQAGPEGAAPAPEEDKKPKPARKQKMVEEIGVEL---AVLDLPDLPEDELAR-SVQKLEELTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATSTWLEDEGFGATTVMLKDKLAELRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGARLIPEMDQVFTEVEMTTLEKVINDTWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 913          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Mouse
Match: Hyou1 (hypoxia up-regulated 1 [Source:MGI Symbol;Acc:MGI:108030])

HSP 1 Score: 506.523 bits (1303), Expect = 4.705e-163
Identity = 280/584 (47.95%), Postives = 387/584 (66.27%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKK--PSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNE 1885
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP  V + ++ER  G++A  M IK PK        L+GK  D+P V  ++  FP +E+ +D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  N+TAQ  MFYD GS +T  +IV+YQ VK KE GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLF+R   P+ +AL+SA++ +  I++VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  ES +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   SD K++      E
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELIVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNVMFYDMGSGSTVCTIVTYQTVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGATRVPKVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTR----EVEEEPGLRSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSPEEESTLTKLGNTISSLFGGGT--SSDAKENGTDAVQE 603          

HSP 2 Score: 91.2781 bits (225), Expect = 4.480e-18
Identity = 77/270 (28.52%), Postives = 121/270 (44.81%), Query Frame = 2
Query: 1841 EKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            EK D+K+  +    E    N+        +    +   K + +  Q  +E +   L    V     LP +E+   S +K+ +L   D EK   EKA N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    ++FT+ E  +L K+I DT  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:  650 EKPDEKESGDK--PEAQKPNEKGQAGPEGAAPAPEEDKKPKPARKQKMVEEIGVEL---AVLDLPDLPEDELAR-SVQKLEELTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATSTWLEDEGFGATTVMLKDKLAELRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGARLIPEMDQVFTEVEMTTLEKVINDTWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 913          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Mouse
Match: Hspa4l (heat shock protein 4 like [Source:MGI Symbol;Acc:MGI:107422])

HSP 1 Score: 204.527 bits (519), Expect = 4.443e-54
Identity = 206/821 (25.09%), Postives = 376/821 (45.80%), Query Frame = 2
Query:  176 IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN---QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRR--KAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSAN-NEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKD-DSNTVTNETVAANDT--QSINKTASNATGDSVNKTQTSEPQNRI-ETLHQN-LNFITVYKASSLPSE-------EVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDF 2584
            ++   +DL      IA+ + G  +E   +  S R TP+ + +    R  GNAA +  +   +   H    L G++ D P+V+  +   PY   KM   +   ++ +  +E+  F +E++  M+L   K  +E   + P+   +I +P +FT  ER +++ AA++AG N L+LMN  TAVAL YGI+++   + +   +  +F D G SA  VS+ ++   K+K            ++   +D  LG   F   L  +    F    K   +V    R++ +LY+E  ++ K++SAN +++   +E  ++D D+  K+ RA+FE++C  L  R   P+   ++ A L    I  + ++GG TRIP  +E + +   ++++  ++N DE+ A G   Q A +SP FKV+ F + D  LVP +V   R+KT   +         +F   +  P  +V+TF+K      F +     ++ +       + N T + + + +S      +   VK    ++  GI S+    ++ E+Q    D N+A+   +          S  +E  DK   D     ++   A  T  + I+ T + A      K   S+ Q+RI +T+ +  +  I +   SSL  +         IE   K I+Q K +++E+     A+N +E YV+  + +    +Y +  T  +        +    W  E+G   PK+ Y+ R  EL+K    I  +  E+  RP+A++ L   +      +E  +N          AE + + K I D+  W  +     N + L  +P + +S+ 
Sbjct:    1 MSVVGIDLGFLNCYIAVARSG-GIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSTGVKVRYLEEERP-FAIEQVTGMLLAKLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPSLDEKPRNVVFIDMGHSAYQVSVCAFNKGKLK------------VLATTFDPYLGGRNFDEALVDYFCDEFK--TKYKINVKENSRALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKSVMDQANLQREDINSIEIVGGATRIPAVKEQVTRFF-LKDISTTLNADEAVARGCALQCAILSPAFKVREFSITD--LVPYSVT-LRWKTSFEEGTGECE---VFSKNHPAPFSKVITFHKKEP---FELEAFYTNLHEVPYPDPRIGNFT-IQNVFPQSD----GDSSKVKVKVRINIHGIFSVASA-SVIEKQNLEGDHNDAAMETEAPK-------SEGKEDVDKMQVDQEEGGHQKCHAEHTPEEEIDHTGAKA------KAPPSDKQDRINQTIKKGKIKSIDLPIQSSLYRQLTQDLLNSYIENEGKMIMQDK-LEKER---NDAKNAVEEYVYDFRDKLGT-VYEKFITPEDMNKLSAMLEDTENWLYEEGEDQPKQVYVDRLQELKKYGQPIQMKYVEHEERPKALNDLGKKIQLVLKVIEAHRNKDERYDHLDPAEMERVEKYISDSMNWLNSKMNAQNKLSLTQDPVVKVSEI 771          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Mouse
Match: Hspa4l (heat shock protein 4 like [Source:MGI Symbol;Acc:MGI:107422])

HSP 1 Score: 204.527 bits (519), Expect = 4.443e-54
Identity = 206/821 (25.09%), Postives = 376/821 (45.80%), Query Frame = 2
Query:  176 IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN---QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRR--KAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSAN-NEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKD-DSNTVTNETVAANDT--QSINKTASNATGDSVNKTQTSEPQNRI-ETLHQN-LNFITVYKASSLPSE-------EVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDF 2584
            ++   +DL      IA+ + G  +E   +  S R TP+ + +    R  GNAA +  +   +   H    L G++ D P+V+  +   PY   KM   +   ++ +  +E+  F +E++  M+L   K  +E   + P+   +I +P +FT  ER +++ AA++AG N L+LMN  TAVAL YGI+++   + +   +  +F D G SA  VS+ ++   K+K            ++   +D  LG   F   L  +    F    K   +V    R++ +LY+E  ++ K++SAN +++   +E  ++D D+  K+ RA+FE++C  L  R   P+   ++ A L    I  + ++GG TRIP  +E + +   ++++  ++N DE+ A G   Q A +SP FKV+ F + D  LVP +V   R+KT   +         +F   +  P  +V+TF+K      F +     ++ +       + N T + + + +S      +   VK    ++  GI S+    ++ E+Q    D N+A+   +          S  +E  DK   D     ++   A  T  + I+ T + A      K   S+ Q+RI +T+ +  +  I +   SSL  +         IE   K I+Q K +++E+     A+N +E YV+  + +    +Y +  T  +        +    W  E+G   PK+ Y+ R  EL+K    I  +  E+  RP+A++ L   +      +E  +N          AE + + K I D+  W  +     N + L  +P + +S+ 
Sbjct:    1 MSVVGIDLGFLNCYIAVARSG-GIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSTGVKVRYLEEERP-FAIEQVTGMLLAKLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPSLDEKPRNVVFIDMGHSAYQVSVCAFNKGKLK------------VLATTFDPYLGGRNFDEALVDYFCDEFK--TKYKINVKENSRALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKSVMDQANLQREDINSIEIVGGATRIPAVKEQVTRFF-LKDISTTLNADEAVARGCALQCAILSPAFKVREFSITD--LVPYSVT-LRWKTSFEEGTGECE---VFSKNHPAPFSKVITFHKKEP---FELEAFYTNLHEVPYPDPRIGNFT-IQNVFPQSD----GDSSKVKVKVRINIHGIFSVASA-SVIEKQNLEGDHNDAAMETEAPK-------SEGKEDVDKMQVDQEEGGHQKCHAEHTPEEEIDHTGAKA------KAPPSDKQDRINQTIKKGKIKSIDLPIQSSLYRQLTQDLLNSYIENEGKMIMQDK-LEKER---NDAKNAVEEYVYDFRDKLGT-VYEKFITPEDMNKLSAMLEDTENWLYEEGEDQPKQVYVDRLQELKKYGQPIQMKYVEHEERPKALNDLGKKIQLVLKVIEAHRNKDERYDHLDPAEMERVEKYISDSMNWLNSKMNAQNKLSLTQDPVVKVSEI 771          
BLAST of Hypoxia up-regulated protein 1 vs. UniProt/SwissProt
Match: sp|Q7ZUW2|HYOU1_DANRE (Hypoxia up-regulated protein 1 OS=Danio rerio OX=7955 GN=hyou1 PE=2 SV=1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 352/890 (39.55%), Postives = 512/890 (57.53%), Query Frame = 2
Query:  119 FKFWFSVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS-----------------DKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLH---------------------QNLNFITVYKASSL-------PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
               W    +V+++  S++E +A  SVDL SE++K+AIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+ + +K PK +Y  +  ++GKT D+P V ++QK FP ++++ DE    + F+  E+  +T EELL M+L  ++ +A+ ++E P+K  +I VP YF Q ER A+L+AA IAG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT +IV+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTR+EFE +C+DLF+R   P+ +AL +A++ M  I++VIL+GG TR+PK Q++LLK+   +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  M  +P ++V+TFN++  +F F +  G    + ++ +     +NLT V  SG   S +KH   E KG+KAHF +D  G++ L+ +E++FE         E STL K+GNTIS+LFG  + E S                  K+ D      ETV         K A     +     + +E Q   E+                       Q  + I+   A  L       PS E +E S+KK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++           W +E+G     +    + +EL+KL   + FRV E    P+ ++ L+S+LN SN FL++ + +    +IFT  E  +L K+I +T  W          +   + P +   D E     L+RE+ YLLN
Sbjct:    5 LSLWAIFCLVVAFLPSQTESVAVMSVDLGSEWMKVAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVAVKNPKVVYRFLQSILGKTADNPQVAEYQKHFPEHQLQKDEKRGTVYFKFSEEMQYTPEELLGMILNYSRTLAQDFAEQPIKDAVITVPAYFNQAERRAVLQAAHIAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNIMFYDMGSGSTTATIVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSKKDVRDNLRAMAKLLKEAQRLKTVLSANAEHTAQIEGLMDDIDFKAKVTRSEFEALCEDLFDRVPGPVKQALAAAEMSMDEIEQVILVGGATRVPKVQDVLLKSVGKEELSKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPIQVEFSRETEEEDGVKSLKH-NKRILFQRMAPYPQRKVITFNRYIDDFVFYINYGDLSFLSEQDMKVFGSQNLTTVKLSGVGSSFKKHSDAESKGIKAHFNMDESGVLILDRVESVFETIVEEK--EEESTLTKLGNTISSLFGGGSSEPSANVTEPVTDEEEVTPEAGKEQDQPEKQEETVQEKPETEEGKEAEPQAEEQKEDKEKAENQGETESEKTEKPEEKTTDEEKEADMKPKLQKKSKISADIAVELEVNDVLDPSAEDMEGSKKKLQDLTDRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEQISGRLSVASSWMDEEGYRAGTKLLKEKLSELKKLCKGMFFRVEERKKWPDRLAALDSMLNHSNIFLKSARLIPESDQIFTDVELKTLEKVINETITWKNETVAEQEKLSPTVKPVLLSKDIEAKLSLLDREVNYLLN 888          
BLAST of Hypoxia up-regulated protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y4L1|HYOU1_HUMAN (Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 355/899 (39.49%), Postives = 514/899 (57.17%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKP--SKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSE-------------------PQNRIETLHQNLNFITVYK------------ASSLPSEEVIEMSRKK-----------IIQLKQIDEEKAA-------------LEKAQNE-----LESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP +V + ++ER FG++A +M IK PK        L+GK  D+P V  +Q  FP +E+  D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  NTTAQ  MFYD GS +T  +IV+YQMVK KE GM    PQL I G+G+DRTLG  +  LRL+  LA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLFER   P+ +AL+SA++ +  I++VIL+GG TR+P+ QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  +S +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   + K++ ++TV  E       +S  + + +  G+ V   + +E                   P+    T  +N +     K            A +   E+  + +RK+           ++ L  + E+K A             LEK + E     LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT+ E  +L K+I +T  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTR----EVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSAEEESTLTKLGNTISSLFGGGTTPDA-KENGTDTVQEE------EESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDKSEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 913          
BLAST of Hypoxia up-regulated protein 1 vs. UniProt/SwissProt
Match: sp|Q60432|HYOU1_CRIGR (Hypoxia up-regulated protein 1 OS=Cricetulus griseus OX=10029 GN=HYOU1 PE=2 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 6.068e-180
Identity = 367/954 (38.47%), Postives = 533/954 (55.87%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKK--PSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFG--------------------SSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGD------------SVNKTQTSEPQNRIETLHQNLNFITVYKASSLPS------EEV-IEMSRKKIIQLKQIDEEKAA-------------LEK-----AQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWKXXXXXXXXXXXXDNQXXXXXXXXXXXXXDNQSKSESAKDAGKKDEPKPSL-PDENDTT 2821
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP  V + ++ER  G++A  M IK PK        L+GK  D+P V  ++  FP +E+ +D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  N+TAQ  MFYD GS  T  +IV+YQ VK KE GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ ++   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR E EE+C DLFER   P+ +AL+SA++ +  I++VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P  +V+TFN+++ +F+F++  G    +  + L     +NLT V   G  ES +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG                    S TE   D+  +   +  ET A  +  S         GD            S  K++  +P+ + ++  + +      +    P+      EE+ +E++   ++ L  + E++ A             LEK     A N LE+++F  + +  +  Y   STE +R+       A   W E++G          +  EL+KL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT+ E  +L K+I DT  W  A       +     P +   D E    AL+RE+ YLLNK    K       +  P D   ++ E   ++   D + K      AG+ +E KP L PD+ +TT
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRDRFPEHELNIDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNVMFYDMGSGTTVCTIVTYQTVKTKEAGM---QPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRRGQKAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVESEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPKVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTR----EVEEEPGVRSLKHNKRVLFSRMGPYPQGKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESLKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSPEEESTLTKLGNTISSLFGGGTSSDAKENGTDAVQEEEESPTEGSKDEPGEQGDLKEETEAPVEDTS-QPPPPEPKGDAAPEGEKPDEKESGGKSEAQKPEEKGQSGPEGVPPAPEEEKKQKPARKQKMVEEIGVELA---VLDLPDLPEDELARSVKKLEDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATSTWLEDEGFGATTVMLKEKLAELKKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGARLIPEMDQIFTEVEMTTLEKVINDTWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK------PRPRPKDKNGTRTEPPLNATAGDQEEK--VIPPAGQPEEAKPILEPDKEETT 963          
BLAST of Hypoxia up-regulated protein 1 vs. UniProt/SwissProt
Match: sp|Q63617|HYOU1_RAT (Hypoxia up-regulated protein 1 OS=Rattus norvegicus OX=10116 GN=Hyou1 PE=1 SV=1)

HSP 1 Score: 552.362 bits (1422), Expect = 8.265e-180
Identity = 353/894 (39.49%), Postives = 508/894 (56.82%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKK--PSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTS-----RVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTA---------------------SNATGDSVNKTQT-SEPQNRIETLHQNLNFITVYKASSLPS----EEVIEMSRKK-----------IIQLKQIDEEKAA-------------LEKAQNE-----LESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWK 2650
            S+ +A  SVDL SE +K+AIVKPGVPMEI L++ES+RKTP  V + ++ER  G++A  M IK PK        L+GK  D+P V  ++  FP +E+ +D   Q + FQ   +  F+ EE+L MVL  ++ +AE ++E P+K  +I VP +F Q ER A+L+AAR+AG  VLQL+N NTA AL+YG+FRRK  N+TAQ  MFYD GS +T  +IV+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ +K   +KDV   PR+MAKL +EA+R+  VLSAN +  AQ+E ++DD D K KVTR EFEE+C DLF+R   P+ +AL+SA++ +  I++VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK FVV+DA + PI V+F R    E +E P   S     RV+F  M  +P ++V+TFN+++ +F+F++  G    +  + L     +NLT V   G  ES +K+   E KG+KAHF LD  G++SL+ +E++FE     +   E STL K+GNTIS+LFG  T   SD K++      E   +    S ++ A                     S   GD+  + +T  E ++  ++  Q  N         +P     E+  + +RK+           ++ L  + E++ A             LEK + E     LE+++F  + +  +  Y   STE +R+       A   W E++G          +  ELRKL   + FRV E    PE +S L+++LN S+ FL+  + +    +IFT  E  +L K+I DT  W  A       +     P +   D E    AL+RE+ YLLNK    K
Sbjct:   30 SDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELNVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNIMFYDMGSGSTVCTIVTYQTVKTKEAGT---QPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGPTRVPKVQEVLLKPVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTR----EVEEEPGLRSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSPEEESTLTKLGNTISSLFGGGT--SSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEAPMEDTSQPPPSEPKGDAAREGETPDEKESGDKSEAQKPNEKGQAGPEGVPPAPEEEKKQKPARKQKMVEEIGVELAVLDLPDLPEDELAHSVQKLEDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATSTWLEDEGFGATTVMLKDKLAELRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGARLIPEMDQIFTDVEMTTLEKVINDTWTWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTK 913          
BLAST of Hypoxia up-regulated protein 1 vs. UniProt/SwissProt
Match: sp|Q0VA61|HYOU1_XENTR (Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus tropicalis OX=8364 GN=hyou1 PE=2 SV=2)

HSP 1 Score: 508.834 bits (1309), Expect = 1.396e-167
Identity = 275/591 (46.53%), Postives = 394/591 (66.67%), Query Frame = 2
Query:  131 FSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHVT-EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNE 1885
            F++ ++    S +E +A  SVD+ SE++KIAIVKPGVPMEI L++ES+RKTP  + + ++ERLFG++A+ M +K PK  +     L+GK  D+P VK F+  FP Y++  DE+ + + F+  E+  ++ EELL M+L  ++ +AE ++E P+K  +I VP +F Q ER A+L+AA+++   VLQL+N NTAVALNYG+FRRK  N TAQ  MFY+ GS +T  +IV+YQ VK K+ GM    PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK  KDV    R+M+KL KEA+RV  +LSANN+  AQ+E ++DD D K KVTR E E++C DLF R   P+  AL SA++ M  I +VIL+GG TR+PK QE+LLK    +ELGK+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + PI V+F R    E+  K + H   R++F  +  +P ++V+TFN++T NF F++  G    +    L      NLT V  +G  ES +K    E KG+KAHF +D  G+++L+ +EA+FE   +   + E STL K+GNTIS+LFG  +     K++ +++V  E
Sbjct:    8 FTMFLLALLSSNTESVAVMSVDMGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAIALKENERLFGDSALGMAVKNPKVTFRYFQDLLGKRADNPHVKAFEARFPEYQLVKDEHRETVLFKLSEELTYSPEELLGMMLNYSRSLAEEFAEQPVKDVVITVPAFFNQAERRAVLQAAQLSDLKVLQLINDNTAVALNYGVFRRKDINATAQNIMFYEMGSRSTICTIVTYQSVKTKDSGM---QPQLQIRGVGFDRTLGGIEMDLRLRDHLAKLFNEQKKSKKDVRENQRAMSKLLKEANRVKTILSANNDHMAQIEGLMDDIDFKAKVTRQELEDLCADLFNRVSAPVQHALSSAEMKMEEIDQVILVGGATRVPKVQELLLKVVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAAIFPIQVEFTREVEEEDHSKSLKH-NKRILFQRLAPYPQRKVITFNRYTDNFAFSINYGDLSYLGPDDLKVFGSLNLTTVKLNGVGESFQKRSDYESKGIKAHFNMDESGLLTLDRVEAVFETVVDEKPEQE-STLTKLGNTISSLFGGGSSVPETKENATDSVQEE 593          
BLAST of Hypoxia up-regulated protein 1 vs. TrEMBL
Match: A0A267FLJ4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034201g1 PE=4 SV=1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 407/887 (45.89%), Postives = 559/887 (63.02%), Query Frame = 2
Query:  119 FKFWFSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN-KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGT---------QDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFE--RQWNSND----KNEASTLEKIGNTISNLFGSS-TEEKSD------------KKDDSNTVTNETVAANDTQSINKT--------ASNATGD-------SVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIW 2647
             K   +++++ S   +S+ IAT ++DL SEF+KIAIVKPGVPMEIAL+RESQRKTP VV +  DER  G+ A++M +KFP+  +  I  L+G++L+ P VK FQ+ FPYY++  D    L F        TVEE+LAM+LENA+  A+ +++ P+K  +I VPPYF+Q ERLA+LRAA  AG  VLQLMNSN AVALN+GIFR K+FN TAQYYMFYD GSS+T  ++VSYQ+ +++E GM  E+PQL ++G+GYD TLGAS FILRL+ HLA  FN  K   KD+T   R+MAKL+KEA RV +VLSAN E+YAQ+E+V +DKD KVKVTR E E +C DLFER   PI  AL  AQ+ M  IKEV+LMGGGTR PK Q  LLK T   ELGKSINTDE+AALGAVYQAA +SPGF+VK FVVKDA L P+AVD   FKT E+ KE+     R++F+  N++P ++V+TFNKHT++FDF+V   +         + +    L    +K + +    Y     +     KGVKAHF +D  GIV L+  EA FE   Q   +D    K E S   KIG ++ +LFGSS  ++K+D            K+D S+   ++     + +   KT        AS A+GD       + NK++++    + E   +++ F+   K    PS+   + SR  I +L++ +E K  LEKA+NELE+++F  K +     Y +CSTE+ER+  ++   A  +WY+EQG  T +E +  +  EL+ ++GD+  RVRE   RP+A   L  +LN +  F + ++N+TG+G +FTQAE ++L  LI DT  W +A     +   L   P + + D      ALEREI YLL KI  +
Sbjct:    4 MKIIITILLLASVIYRSDAIATMAIDLGSEFMKIAIVKPGVPMEIALNRESQRKTPVVVGMRNDERQIGDPALSMAVKFPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEGVLTFTTVNNKKLTVEEILAMLLENAQETAQKFADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFNKTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKLSKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESALNMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVD---FKTAEDGKEI----KRLLFNLGNHYPQRKVMTFNKHTQDFDFSVGYTSLNHLNEFQQKALGDPLLYKFSLKGVAQAIGKY---DGQPGASSKGVKAHFRMDDNGIVHLDRAEAQFEILPQAAGSDGEAKKEEGSAFAKIGESLGSLFGSSEADKKADEASGAEKQQAKSKEDSSSKPADKDSTKTNAEPGEKTGDSTAAGNASKASGDKAAQSNNNTNKSESAATPAKPELRRESIEFVVADKTLVHPSDASQQKSRSTIQELRKREEAKRQLEKARNELEAFIFESKDRLSSADYEKCSTESERQGYMEKLSAAQDWYDEQGMDTTQEQFAAKTAELKAMLGDLTLRVREMLERPKAFKLLKDMLNHTRTFWDTMQNMTGDGNVFTQAEYNTLGNLINDTEDWQKARQLEVDGQDLTKEPLVRVEDIRLKMSALEREISYLLGKIKYY 880          
BLAST of Hypoxia up-regulated protein 1 vs. TrEMBL
Match: A0A267G9A3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028204g1 PE=4 SV=1)

HSP 1 Score: 739.569 bits (1908), Expect = 0.000e+0
Identity = 407/887 (45.89%), Postives = 559/887 (63.02%), Query Frame = 2
Query:  119 FKFWFSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN-KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGT---------QDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFE--RQWNSND----KNEASTLEKIGNTISNLFGSS-TEEKSD------------KKDDSNTVTNETVAANDTQSINKT--------ASNATGD-------SVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIW 2647
             K   +++++ S   +S+ IAT ++DL SEF+KIAIVKPGVPMEIAL+RESQRKTP VV +  DER  G+ A++M +KFP+  +  I  L+G++L+ P VK FQ+ FPYY++  D    L F        TVEE+LAM+LENA+  A+ +++ P+K  +I VPPYF+Q ERLA+LRAA  AG  VLQLMNSN AVALN+GIFR K+FN TAQYYMFYD GSS+T  ++VSYQ+ +++E GM  E+PQL ++G+GYD TLGAS FILRL+ HLA  FN  K   KD+T   R+MAKL+KEA RV +VLSAN E+YAQ+E+V +DKD KVKVTR E E +C DLFER   PI  AL  AQ+ M  IKEV+LMGGGTR PK Q  LLK T   ELGKSINTDE+AALGAVYQAA +SPGF+VK FVVKDA L P+AVD   FKT E+ KE+     R++F+  N++P ++V+TFNKHT++FDF+V   +         + +    L    +K + +    Y     +     KGVKAHF +D  GIV L+  EA FE   Q   +D    K E S   KIG ++ +LFGSS  ++K+D            K+D S+   ++     + +   KT        AS A+GD       + NK++++    + E   +++ F+   K    PS+   + SR  I +L++ +E K  LEKA+NELE+++F  K +     Y +CSTE+ER+  ++   A  +WY+EQG  T +E +  +  EL+ ++GD+  RVRE   RP+A   L  +LN +  F + ++N+TG+G +FTQAE ++L  LI DT  W +A     +   L   P + + D      ALEREI YLL KI  +
Sbjct:    4 MKIIITILLLASVIYRSDAIATMAIDLGSEFMKIAIVKPGVPMEIALNRESQRKTPVVVGMRNDERQIGDPALSMAVKFPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEGVLTFTTVNNKKLTVEEILAMLLENAQETAQKFADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFNKTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKLSKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESALNMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVD---FKTAEDGKEI----KRLLFNLGNHYPQRKVMTFNKHTQDFDFSVGYTSLNHLNEFQQKALGDPLLYKFSLKGVAQAIGKY---DGQPGASSKGVKAHFRMDDNGIVHLDRAEAQFEILPQAAGSDGEAKKEEGSAFAKIGESLGSLFGSSEADKKADEASGADKQQAKSKEDSSSKPADKDSTKTNAEPGEKTGDSTAAGNASKASGDKAAQSNNNTNKSESAATPAKPELRRESIEFVVADKTLVHPSDASQQKSRSTIQELRKREEAKRQLEKARNELEAFIFESKDRLSSADYEKCSTESERQGYMEKLSAAQDWYDEQGMDTTQEQFAAKTAELKAMLGDLTLRVREMLERPKAFKLLKDMLNHTRTFWDTMQNMTGDGNVFTQAEYNTLGNLINDTEDWQKARQLEVDGQDLTKEPLVRVEDIRLKMSALEREISYLLGKIKYY 880          
BLAST of Hypoxia up-regulated protein 1 vs. TrEMBL
Match: A0A267DVT4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013664g1 PE=4 SV=1)

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 406/887 (45.77%), Postives = 559/887 (63.02%), Query Frame = 2
Query:  119 FKFWFSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN-KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGT---------QDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFE--RQWNSND----KNEASTLEKIGNTISNLFGSS-TEEKSD------------KKDDSNTVTNETVAANDTQSINKT--------ASNATGD-------SVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIW 2647
             K   +++++ S   +S+ IAT ++DL SEF+KIAIVKPGVPMEIAL+RESQRKTP VV +  DER  G+ A++M +KFP+  +  I  L+G++L+ P VK FQ+ FPYY++  D    L F        TVEE+LAM+LENA+  A+ +++ P+K  +I VPPYF+Q ERLA+LRAA  AG  VLQLMNSN AVALN+GIFR K+FN TAQYYMFYD GSS+T  ++VSYQ+ +++E GM  E+PQL ++G+GYD TLGAS FILRL+ HLA  FN  K   KD+T   R+MAKL+KEA RV +VLSAN E+YAQ+E+V +DKD KVKVTR E E +C DLFER   PI  AL  AQ+ M  IKEV+LMGGGTR PK Q  LLK T   ELGKSINTDE+AALGAVYQAA +SPGF+VK FVVKDA L P+AVD   FKT E+ KE+     R++F+  N++P ++V+TFNKHT++FDF+V   +         + +    L    +K + +    Y     +     KGVKAHF +D  GIV L+  EA FE   Q   +D    K E S   KIG ++ +LFGSS  ++K+D            K+D S+   ++     + +   KT        AS A+GD       + NK++++    + E   +++ F+   K    PS+   + SR  I +L++ ++ K  LEKA+NELE+++F  K +     Y +CSTE+ER+  ++   A  +WY+EQG  T +E +  +  EL+ ++GD+  RVRE   RP+A   L  +LN +  F + ++N+TG+G +FTQAE ++L  LI DT  W +A     +   L   P + + D      ALEREI YLL KI  +
Sbjct:    4 MKIIITILLLASVIYRSDAIATMAIDLGSEFMKIAIVKPGVPMEIALNRESQRKTPVVVGMRNDERQIGDPALSMAVKFPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEGVLTFTTVNNKKLTVEEILAMLLENAQETAQKFADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFNKTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKLSKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESALNMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVD---FKTAEDGKEI----KRLLFNLGNHYPQRKVMTFNKHTQDFDFSVGYTSLNHLNEFQQKALGDPLLYKFSLKGVAQAIGKY---DGQPGASSKGVKAHFRMDDNGIVHLDRAEAQFEILPQAAGSDGEAKKEEGSAFAKIGESLGSLFGSSEADKKADEASGADKQQEKSKEDSSSKPADKDSTKTNAEPGEKTGDSTASGNASKASGDKAAQSNNNTNKSESAATPAKPELRRESIEFVVADKTLVHPSDASQQKSRSTIQELRKREDAKRQLEKARNELEAFIFESKDRLSSADYEKCSTESERQGYMEKLSAAQDWYDEQGMDTTQEQFAAKTAELKAMLGDLTLRVREMLERPKAFKLLKDMLNHTRTFWDTMQNMTGDGNVFTQAEYNTLGNLINDTEDWQKARQLEVDGQDLTKEPLVRVEDIRLKMSALEREISYLLGKIKYY 880          
BLAST of Hypoxia up-regulated protein 1 vs. TrEMBL
Match: A0A1I8ISK3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 405/868 (46.66%), Postives = 550/868 (63.36%), Query Frame = 2
Query:  167 SECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN-KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGT---------QDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFE--RQWNSND----KNEASTLEKIGNTISNLFGSS-TEEKSD------------KKDDSNTVTNETVAANDTQSINKT--------ASNATGD-------SVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKI 2638
            S+ IAT ++DL SEF+KIAIVKPGVPMEIAL+RESQRKTP VV +  DER  G+ A++M +KFP+  +  I  L+G++L+ P VK FQ+ FPYY++  D    L F        TVEE+LAM+LENA+  A+ +++ P+K  +I VPPYF+Q ERLA+LRAA  AG  VLQLMNSN AVALN+GIFR K+FN TAQYYMFYD GSS+T  ++VSYQ+ +++E GM  E+PQL ++G+GYD TLGAS FILRL+ HLA  FN  K   KD+T   R+MAKL+KEA RV +VLSAN E+YAQ+E+V +DKD KVKVTR E E +C DLFER   PI  AL  AQ+ M  IKEV+LMGGGTR PK Q  LLK T   ELGKSINTDE+AALGAVYQAA +SPGF+VK FVVKDA L P+AVD   FKT E+ KE+     R++F+  N++P ++V+TFNKHT++FDF+V   +         + +    L    +K + +    Y     +     KGVKAHF +D  GIV L+  EA FE   Q   +D    K E S   KIG ++ +LFGSS  ++K+D            K+D S+   ++     + +   KT        AS A+GD       + NK++++    + E   +++ F+   K    PS+   + SR  I +L++ +E K  LEKA+NELE+++F  K +     Y +CSTE+ER+  ++   A  +WY+EQG  T +E +  +  EL+ ++GD+  RVRE   RP+A   L  +LN +  F + ++N+TG+G +FTQAE ++L  LI DT  W +A     +   L   P + + D      ALEREI YLL KI
Sbjct:  389 SDAIATMAIDLGSEFMKIAIVKPGVPMEIALNRESQRKTPVVVGMRNDERQIGDPALSMAVKFPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEGVLTFTTVNNKKLTVEEILAMLLENAQETAQKFADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFNKTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKLSKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESALNMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVD---FKTAEDGKEI----KRLLFNLGNHYPQRKVMTFNKHTQDFDFSVGYTSLNHLNEFQQKALGDPLLYKFSLKGVAQAIGKY---DGQPGASSKGVKAHFRMDDNGIVHLDRAEAQFEILPQAAGSDGEAKKEEGSAFAKIGESLGSLFGSSEADKKADEASGAEKQQAKSKEDSSSKPADKDSTKTNAEPGEKTGDSTAAGNASKASGDKAAQSNNNTNKSESAATPAKPELRRESIEFVVADKTLVHPSDASQQKSRSTIQELRKREEAKRQLEKARNELEAFIFESKDRLSSADYEKCSTESERQGYMEKLSAAQDWYDEQGMDTTQEQFAAKTAELKAMLGDLTLRVREMLERPKAFKLLKDMLNHTRTFWDTMQNMTGDGNVFTQAEYNTLGNLINDTEDWQKARQLEVDGQDLTKEPLVRVEDIRLKMSALEREISYLLGKI 1246          
BLAST of Hypoxia up-regulated protein 1 vs. TrEMBL
Match: A0A1I8ILP9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 403/869 (46.38%), Postives = 549/869 (63.18%), Query Frame = 2
Query:  173 CIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN-KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGT---------QDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFE--RQWNSND----KNEASTLEKIGNTISNLFGSS-TEEKSD------------KKDDSNTVTNETVAANDTQSINKT--------ASNATGD-------SVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIW 2647
             IAT ++DL SEF+KIAIVKPGVPMEIAL+RESQRKTP VV +  DER  G+ A++M +KFP+  +  I  L+G++L+ P VK FQ+ FPYY++  D    L F        TVEE+LAM+LENA+  A+ +++ P+K  +I VPPYF+Q ERLA+LRAA  AG  VLQLMNSN AVALN+GIFR K+FN TAQYYMFYD GSS+T  ++VSYQ+ +++E GM  E+PQL ++G+GYD TLGAS FILRL+ HLA  FN  K   KD+T   R+MAKL+KEA RV +VLSAN E+YAQ+E+V +DKD KVKVTR E E +C DLFER   PI  AL  AQ+ M  IKEV+LMGGGTR PK Q  LLK T   ELGKSINTDE+AALGAVYQAA +SPGF+VK FVVKDA L P+AVD   FKT E+ KE+     R++F+  N++P ++V+TFNKHT++FDF+V   +         + +    L    +K + +    Y     +     KGVKAHF +D  GIV L+  EA FE   Q   +D    K E S   KIG ++ +LFGSS  ++K+D            K+D S+   ++     + +   KT        AS A+GD       + NK++++    + E   +++ F+   K    PS+   + SR  I +L++ ++ K  LEKA+NELE+++F  K +     Y +CSTE+ER+  ++   A  +WY+EQG  T +E +  +  EL+ ++GD+  RVRE   RP+A   L  +LN +  F + ++N+TG+G +FTQAE ++L  LI DT  W +A     +   L   P + + D      ALEREI YLL KI  +
Sbjct:  497 AIATMAIDLGSEFMKIAIVKPGVPMEIALNRESQRKTPVVVGMRNDERQIGDPALSMAVKFPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEGVLTFTTVNNKKLTVEEILAMLLENAQETAQKFADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFNKTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKLSKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESALNMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVD---FKTAEDGKEI----KRLLFNLGNHYPQRKVMTFNKHTQDFDFSVGYTSLNHLNEFQQKALGDPLLYKFSLKGVAQAIGKY---DGQPGASSKGVKAHFRMDDNGIVHLDRAEAQFEILPQAAGSDGEAKKEEGSAFAKIGESLGSLFGSSEADKKADEASGADKQQEKSKEDSSSKPADKDSTKTNAEPGEKTGDSTASGNASKASGDKAAQSNNNTNKSESAATPAKPELRRESIEFVVADKTLVHPSDASQQKSRSTIQELRKREDAKRQLEKARNELEAFIFESKDRLSSADYEKCSTESERQGYMEKLSAAQDWYDEQGMDTTQEQFAAKTAELKAMLGDLTLRVREMLERPKAFKLLKDMLNHTRTFWDTMQNMTGDGNVFTQAEYNTLGNLINDTEDWQKARQLEVDGQDLTKEPLVRVEDIRLKMSALEREISYLLGKIKYY 1355          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 355/875 (40.57%), Postives = 513/875 (58.63%), Query Frame = 2
Query:  125 FWFSVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS--------DKKD---DSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNR--------------IETLHQNLNFITVYKASSL-------PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
             W    + L++  S +  +A  SVDL SE++KIAIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+ + +K PK +Y  I  L+GKT ++P V Q+QK FP ++I  DE    + F++ E+  ++  E+L MVL  +  +A+ ++E P+K  +I VP +F Q ER A+L+AA++AG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT ++V+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK +KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTRAEFE +C DLFER   P+ +AL S+++ M  I++VIL+GG TR+PK QE+LLK    +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + P+ V+F R    E+  K V H   R++F  M  +P ++V+TFN++  +FDF +  G    + +  L     +NLT V  SG   S +K+   E KG+KAHF +D  G++ L+ +E++FE       K E STL K+GNTIS+LFG  + E S        D+++   +S    +E V   D     K  +    +   +T+  +P                  +   Q  + I+V     L       PS E I  SRKK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++       A   W +E+G     ++   + +EL+KL   + FRV E    P+ ++ L+S+LN S  FL++ K +  + +IFT+ E  +L K+I +TT W                P +   + E     L+RE+ YLLN
Sbjct:    7 LWVLFCLALAHLPSPTASVAVMSVDLGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVSVKNPKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYFKYSEEMQYSPVEILGMVLNYSSGLAQDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSTKDVRENLRAMAKLLKEAQRLKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVEFSRETEEEDGVKGVKH-NKRILFQRMAPYPQRKVITFNRYNDDFDFYINYGDLSFLSQDDLKMFGSQNLTTVKLSGVGNSFKKNSDAESKGIKAHFNMDESGVLILDRVESVFETIVEE--KEEESTLTKLGNTISSLFGGGSSEPSANVTEPVQDEEEVPPESGKDQDEPVEKPDESVKEKPDTEEKTEEEPQTEEKKPDKEGSDKEQPEEEKEAEKKAKPQKKSKISVDIGVDLEVNDVLDPSLEDIVASRKKLQDLTNRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEDISAKLSAASSWMDEEGYTAGTKELKEKLSELKKLCKAMFFRVEERKKWPDRLAALDSMLNHSTIFLKSAKMIPEDDQIFTEVELKTLEKVINETTDWKNETVAEQEKRSPTEKPVLLSKEIEAKLSLLDREVNYLLN 875          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 514.998 bits (1325), Expect = 2.603e-166
Identity = 281/582 (48.28%), Postives = 390/582 (67.01%), Query Frame = 2
Query:  125 FWFSVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS 1849
             W    + L++  S +  +A  SVDL SE++KIAIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+ + +K PK +Y  I  L+GKT ++P V Q+QK FP ++I  DE    + F++ E+  ++  E+L MVL  +  +A+ ++E P+K  +I VP +F Q ER A+L+AA++AG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT ++V+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK +KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTRAEFE +C DLFER   P+ +AL S+++ M  I++VIL+GG TR+PK QE+LLK    +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + P+ V+F R    E+  K V H   R++F  M  +P ++V+TFN++  +FDF +  G    + +  L     +NLT V  SG   S +K+   E KG+KAHF +D  G++ L+ +E++FE       K E STL K+GNTIS+LFG  + E S
Sbjct:   20 LWVLFCLALAHLPSPTASVAVMSVDLGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVSVKNPKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYFKYSEEMQYSPVEILGMVLNYSSGLAQDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSTKDVRENLRAMAKLLKEAQRLKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVEFSRETEEEDGVKGVKH-NKRILFQRMAPYPQRKVITFNRYNDDFDFYINYGDLSFLSQDDLKMFGSQNLTTVKLSGVGNSFKKNSDAESKGIKAHFNMDESGVLILDRVESVFETIVEE--KEEESTLTKLGNTISSLFGGGSSEPS 595          

HSP 2 Score: 89.3521 bits (220), Expect = 1.391e-17
Identity = 62/197 (31.47%), Postives = 98/197 (49.75%), Query Frame = 2
Query: 2042 PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
            PS E I  SRKK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++       A   W +E+G     ++   + +EL+KL   + FRV E    P+ ++ L+S+LN S  FL++ K +  + +IFT+ E  +L K+I +TT W                P +   + E     L+RE+ YLLN
Sbjct:  713 PSLEDIVASRKKLQDLTNRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEDISAKLSAASSWMDEEGYTAGTKELKEKLSELKKLCKAMFFRVEERKKWPDRLAALDSMLNHSTIFLKSAKMIPEDDQIFTEVELKTLEKVINETTDWKNETVAEQEKRSPTEKPVLLSKEIEAKLSLLDREVNYLLN 909          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 513.842 bits (1322), Expect = 1.156e-165
Identity = 281/582 (48.28%), Postives = 390/582 (67.01%), Query Frame = 2
Query:  125 FWFSVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS 1849
             W    + L++  S +  +A  SVDL SE++KIAIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+ + +K PK +Y  I  L+GKT ++P V Q+QK FP ++I  DE    + F++ E+  ++  E+L MVL  +  +A+ ++E P+K  +I VP +F Q ER A+L+AA++AG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT ++V+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK +KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTRAEFE +C DLFER   P+ +AL S+++ M  I++VIL+GG TR+PK QE+LLK    +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + P+ V+F R    E+  K V H   R++F  M  +P ++V+TFN++  +FDF +  G    + +  L     +NLT V  SG   S +K+   E KG+KAHF +D  G++ L+ +E++FE       K E STL K+GNTIS+LFG  + E S
Sbjct:    7 LWVLFCLALAHLPSPTASVAVMSVDLGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVSVKNPKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYFKYSEEMQYSPVEILGMVLNYSSGLAQDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSTKDVRENLRAMAKLLKEAQRLKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVEFSRETEEEDGVKGVKH-NKRILFQRMAPYPQRKVITFNRYNDDFDFYINYGDLSFLSQDDLKMFGSQNLTTVKLSGVGNSFKKNSDAESKGIKAHFNMDESGVLILDRVESVFETIVEE--KEEESTLTKLGNTISSLFGGGSSEPS 582          

HSP 2 Score: 89.3521 bits (220), Expect = 1.245e-17
Identity = 62/197 (31.47%), Postives = 98/197 (49.75%), Query Frame = 2
Query: 2042 PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
            PS E I  SRKK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++       A   W +E+G     ++   + +EL+KL   + FRV E    P+ ++ L+S+LN S  FL++ K +  + +IFT+ E  +L K+I +TT W                P +   + E     L+RE+ YLLN
Sbjct:  700 PSLEDIVASRKKLQDLTNRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEDISAKLSAASSWMDEEGYTAGTKELKEKLSELKKLCKAMFFRVEERKKWPDRLAALDSMLNHSTIFLKSAKMIPEDDQIFTEVELKTLEKVINETTDWKNETVAEQEKRSPTEKPVLLSKEIEAKLSLLDREVNYLLN 896          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 482.256 bits (1240), Expect = 2.778e-155
Identity = 264/561 (47.06%), Postives = 370/561 (65.95%), Query Frame = 2
Query:   86 CN*Y*YSKMNYFKF-WFSVIIVLSYFSKSEC----IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMEN--KEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD-IDKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYI 1735
            CN    S  ++ +  W    +  +   ++ C    +A  SVDL SE++KIAIVKPGVPMEI L++ES+RKTP  V + ++ERLFG+ A+   +K PK +Y  I  L+GKT ++P V Q+QK FP ++I  DE    + F++ E+  ++  E+L MVL  +  +A+ ++E P+K  +I VP +F Q ER A+L+AA++AG  VLQL+N NTAVALNYG+FRRK  N+TAQ  MFYD GS +TT ++V+YQ VK KE G     PQL I G+G+DRTLG  +  LRL+ HLA  FN+ KK +KDV    R+MAKL KEA R+  VLSAN E  AQ+E ++DD D K KVTRAEFE +C DLFER   P+ +AL S+++ M  I++VIL+GG TR+PK QE+LLK    +EL K+IN DE+AA+GAVYQAA +S  FKVK F+V+DA + P+ V+F R    E+  K V H   R++F  M  +P ++V+TFN++  +FDF +  G    + +  L     +NLT V  SG   S +K+   E KG+KAHF +D  G++ L+ +
Sbjct:    1 CNVSEQSHCSFLRICWLPSDVASTEKREAGCLSSSVAVMSVDLGSEWMKIAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALG-SVKNPKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYFKYSEEMQYSPVEILGMVLNYSSGLAQDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGT---QPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSTKDVRENLRAMAKLLKEAQRLKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVEFSRETEEEDGVKGVKH-NKRILFQRMAPYPQRKVITFNRYNDDFDFYINYGDLSFLSQDDLKMFGSQNLTTVKLSGVGNSFKKNSDAESKGIKAHFNMDESGVLILDRV 556          

HSP 2 Score: 89.3521 bits (220), Expect = 1.015e-17
Identity = 62/197 (31.47%), Postives = 98/197 (49.75%), Query Frame = 2
Query: 2042 PSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLN 2632
            PS E I  SRKK+  L   D EK   EK  N LE+++F  + +  ++ Y    TE E++       A   W +E+G     ++   + +EL+KL   + FRV E    P+ ++ L+S+LN S  FL++ K +  + +IFT+ E  +L K+I +TT W                P +   + E     L+RE+ YLLN
Sbjct:  597 PSLEDIVASRKKLQDLTNRDLEKQEREKTLNSLEAFIFETQDKLYQDEYQAVVTEEEKEDISAKLSAASSWMDEEGYTAGTKELKEKLSELKKLCKAMFFRVEERKKWPDRLAALDSMLNHSTIFLKSAKMIPEDDQIFTEVELKTLEKVINETTDWKNETVAEQEKRSPTEKPVLLSKEIEAKLSLLDREVNYLLN 793          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000055474.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:150188:156169:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000055474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.749 bits (504), Expect = 1.361e-53
Identity = 126/391 (32.23%), Postives = 197/391 (50.38%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQH-DEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFI 1357
             +DL + +  + + + G  +EI  + +  R TPS V     ERL G+AA N     P         L+G+  D PVV+   K +P+  +      ++  +H  E+  F  EE+ +MVL   K IAE Y    +   +I VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ + K   T  ++ + +D G     VSI++            +E+    +     D  LG   F  RL  H    F +  K  KD++   R++ +L     R  + LS++++   +++++ +  D    +TRA FEEMC DLF   +EP+ KAL  A++    I E++L+GG TRIPK Q++L      ++L KSIN DE+ A GA  QAA +
Sbjct:   10 GIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDGGKPKVQVEHKGEQKTFYPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGK---TGERHVLIFDLGGGTFDVSILT------------IEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKR--KHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGVDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAIL 382          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 171.785 bits (434), Expect = 6.515e-45
Identity = 119/394 (30.20%), Postives = 192/394 (48.73%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPS-VVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPY--YEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFIS 1360
             +DL + +  + + K G  +EI  + +  R TPS V +  + ERL G+AA N     P+        L+G++   P V+   K +P+   E K   + Q+     E   F  EE+ AMVL   K  AE Y    +   ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ +++      +  + +D G     VS+++            +++    +V    D  LG   F  R+  H    + K  K  KDV    R++ KL +E  +  + LS  ++    +E+  D  D    +TRA+FEE+  DLF   ++P+ K +E + L    I E++L+GG TRIPK Q+++ +    +E  + IN DE+ A GA  QA  +S
Sbjct:   37 GIDLGTTYSCVGVFKNG-RVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEG----EKNILVFDLGGGTFDVSLLT------------IDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKK--KTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLS 411          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 124.02 bits (310), Expect = 2.327e-29
Identity = 110/421 (26.13%), Postives = 192/421 (45.61%), Query Frame = 2
Query:  146 VLSYFSK----SECI--ATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKD-ERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDD----KDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQEL-----GKSINTDESAALGAVYQAAFIS 1360
            +L  FS+    SE I  A   +DL +    +A+++ G   ++  + E  R TPSVV    D ERL G  A    +  P   +++   L+G+  D   V++   +  Y  ++    +     H +  +++  ++ A VL   K  AE +    +K  +I VP YF   +R A   A +I+G NVL+++N  TA AL YG+ +        +    YD G     +SI+  Q                 +     D  LG   F   L  ++   F +  +   D+T    ++ ++ + A +    LS++ +    +  +  D    K L +K+TR++FE +  DL  + + P  KAL+  ++    I +VIL+GG TR+PK Q+ +      QE+      K++N DE+ A+GA  Q   ++
Sbjct:   37 ILKGFSRRQYASEAIRGAVIGIDLGTTNSCVAVME-GKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRASNGDAWVEAHGK--MYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK-----ADDKVIAVYDLGGGTFDISILEIQ------------KGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKR--ESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTV------QEVFGRAPSKAVNPDEAVAIGAAIQGGVLA 429          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 122.094 bits (305), Expect = 2.677e-29
Identity = 123/464 (26.51%), Postives = 198/464 (42.67%), Query Frame = 2
Query:  176 IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQF---------QKD-FPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVE-NPQL-SIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFN 1531
            +A   V L S    +AI K G    IA D    R TP++V     E++ G AA    I+        +  ++G   +  VV+++         +KD  P + I    NN    +H      T  E+  ++L+  K  A        K  +I  P  FT ++   + +AA  AG NVL++++   A  L +GI +                 SS +   ++ Y++     +   +E N  L  ++G   D T+G  +F   L  +LA  F K  +  +D+    R+M KL+  A     VLS        V+++ D  D +  +TRA F+ +C  LF++ ++PIH  L    L     ++V+L GG  RIPK Q++L +     EL  SI  DE  ALGA  +A  +  G     F  +  ++   ++D       E  E       V+F      P +R  TF 
Sbjct:    1 MAAVGVHLGSTCACVAIYKDGRADVIAND-AGDRVTPAMVAFRDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSI----NNGTVKKH-----ITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQE----------------SSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHR--QDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAAEAGIL-LGRDAVRFEPEALSIECASLDIL---VKEQDEAGQDCYTVVFPVGTPLPARRQHTFQ 432          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003663.1 (pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:ENSPMAG00000003351.1 transcript:ENSPMAT00000003663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 6.975e-20
Identity = 112/504 (22.22%), Postives = 211/504 (41.87%), Query Frame = 2
Query: 1112 RAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENK-----EVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDT----QSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKE---IYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFE 2587
            R EFE+    LF+R + P+++ L+ A L +  + ++ L+GGG RIPK QE+L++T +  +LG  +N DE+   G+ + A+  S  FKV+   + +++           ++ EN       + +  + V++   +Y   K+ L+    T +   +V   ++D  K+ +    +K +  V S  + +  K    F              V         +   ++N  NE    +   NT S              D +NT T+E   A  T    Q + KT          K     P ++IE         T Y   SL +E+ +  S++++  L++ DE+K   EK++N+ E+ ++ ++   ++E    +   +   E +  +  A+    W EE G       Y  +Y E+      +  R  EY LR +A+    S L      L+ I + T +    T  +   +   I +   W E   +    + L+ +P   +S+ +
Sbjct:    1 REEFEDASAHLFDRAITPVYEVLKRANLSIDEVDQIELLGGGIRIPKIQEMLIQTLQKNDLGVHLNGDEAMCFGSAFIASNSSASFKVRKVYLTESSTTESQSTSTDEQSAENHTATPVAIVYEKNYVLYKRTDYLGQKKSLSLTYDT-DMKIDVYSESEDGKKEKVSTYVIKGIDTVASNDIANQPKVTLSF-----ELSRSVEERVPTPKKNKTAKATKDTNATNET---DGTSNTTS--------------DAANTTTDEAQPAEPTPAQPQFVKKT---------KKRTIPYPLSQIEK--------TFYGLPSLTTEQ-LRASKERLRWLEKRDEDKFKTEKSKNDYETVIYALRDWINEEENMPFVGAAKVEEIQEILREAE---NWLEEDG-------YNAKYIEINGKFSSLKMRKEEYGLRDQAVDNAKSKLQK---LLDKIDDWTTKKAWITTDQKKDVIDKIKEVLAWLEDVVEKQKGIALDEDPAFKVSEID 450          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 77.0258 bits (188), Expect = 7.875e-15
Identity = 81/333 (24.32%), Postives = 147/333 (44.14%), Query Frame = 2
Query:  509 TVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKV-LSANNEIYAQVENVL----DDK---------------------------DLKVK-----------VTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVK 1378
            T E + A +L+  + +AE    +P++  ++ VP  F + +R + ++AA +AG  VL+++N  TA AL YG+   ++ ++     +  D G   T VS+++      K+ GM           +  +  LG   F  RL  HL     +L           R+  +L +EA+ + K+ L+ N+     +   L    D++                            LK+K           VTR EFE + +DLF++ +EPI + L S +L    +  V+L+GG TRIP+ + +L       E   S++ + +   G   QA  ++  + ++
Sbjct:  146 TPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVSSV----LVVDLGGGTTDVSLLT------KQGGMFFTR------AMAGNNHLGGQDFTQRLVEHLT---GRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYFG-SEPDTSVDPELAVVTGVAVQAGVLAGAWPLR 458          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 193.356 bits (490), Expect = 2.505e-52
Identity = 132/436 (30.28%), Postives = 210/436 (48.17%), Query Frame = 2
Query:  245 MEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN--QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKN 1546
            +EI  + +  R TPS V     ERL G+AA N     P         L+G+  D P V    K FP+  I  D     Q+ ++ + KT FT EE+ +MVL   K  AE Y    +   ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++          + +D G     VS++S            ++     +     D  LG   F  RL  HLA  F +  K  KD++   RS+ +L   A R  + LS++++   +++++ +  D    +TRA FEE+C DLF   +EP+ K L+ ++L    I E++L+GG TRIPK Q+++      +E  +SIN DE+ A GA  QAA ++     KT  +   ++ P+++       +  K +P  ++          P K+  TF+ +  N
Sbjct:   24 VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKT-FTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKK---GRAEHNVLIFDLGGGTFDVSLLS------------IDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKR--KTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNST---------IPTKKSETFSTYADN 432          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 186.037 bits (471), Expect = 6.154e-50
Identity = 115/373 (30.83%), Postives = 187/373 (50.13%), Query Frame = 2
Query:  245 MEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTV-FTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFIS 1360
            ++I  + +  R TPS V     ERL G+AA N     P         L+G+  + P V+   K FP+  I +D   Q+  +   +T  FT E++ +MVL   K  AE+Y    +   ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++       ++ + +D G     VS++S            +E+    +     D  LG   F  RL  H    F +  K  KD++T  R++ +L     R  + LS++ +   +++++ +  D    +TRA FEE+C DLF   ++P+ K L  A+L    + E++L+GG TRIPK Q+++      +E  +SIN DE+ A GA  QAA ++
Sbjct:   24 VDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGK----EEHVLIFDLGGGTFDVSLLS------------IEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNK--KDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILT 378          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 185.652 bits (470), Expect = 7.170e-50
Identity = 124/435 (28.51%), Postives = 209/435 (48.05%), Query Frame = 2
Query:  245 MEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTV-FTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKN 1546
            ++I  + +  R TPS V     ERL G+AA N     P         L+G+  + P V+   K FP+  I +D   Q+  +   +T  FT E++ +MVL   K  AE+Y    +   ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++       ++ + +D G     VS++S            +E+    +     D  LG   F  RL  H    F +  K  KD++T  R++ +L     R  + LS++ +   +++++ +  D    +TRA FEE+C DLF   ++P+ K L  A+L    + E++L+GG TRIPK Q+++      +E  +SIN DE+ A GA  QAA ++     KT  +   ++ P+++       +  K +P  ++          P K+   F+ +  N
Sbjct:   24 VDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKG----KEEHVLIFDLGGGTFDVSLLS------------IEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNK--KDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNST---------IPTKKSEVFSTYADN 431          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 186.037 bits (471), Expect = 1.193e-49
Identity = 128/413 (30.99%), Postives = 206/413 (49.88%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQ-HDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVD 1423
             +DL + +  +A++K G   EI  + +  R TPS V    DERL G+AA N     P+     I  L+G   +   V++  K  P+  +  D    +      EK VFT EE+  M+L   K IAE Y    +   ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ +    +      + YD G     VS++S            +EN    +     D  LG   F  ++   L  AF K  K   DV+   +++AKL +EA +  + LS+      ++++ +D  DL   +TRA+FEE+  DLF++ ++P+ K L+ + L    + +++L+GG TRIPK Q++L    + ++  K IN DE+ A GA  QA  +S    V+  V+ D N + + ++
Sbjct:   54 GIDLGTTYSCVAVMKNG-KTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDK----SDKEHQIIVYDLGGGTFDVSLLS------------IENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKK--KHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIE 447          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 182.956 bits (463), Expect = 7.546e-49
Identity = 120/374 (32.09%), Postives = 186/374 (49.73%), Query Frame = 2
Query:  245 MEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN--QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFIS 1360
            +EI  + +  R TPS V     ERL G+AA N     P         L+G+  D P V    K +P+  I        Q+ ++ + KT FT EE+ +M+L   K  AE +    +K  ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++   +      + +D G     VS++S            ++     +     D  LG   F  RL   LA  F +  K  KD+TT  RS+ +L   A R  + LS++ +   +++++ +  D    +TRA FEE+C DLF   +EP+ K L  ++L    I E++L+GG TRIPK Q+++      +E  +SIN DE+ A GA  QAA ++
Sbjct:   24 VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKT-FTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK---SQKEHNVLIFDLGGGTFDVSLLS------------IDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNK--KDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILT 379          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Nematostella
Match: EDO35204 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM46])

HSP 1 Score: 524.628 bits (1350), Expect = 2.661e-171
Identity = 276/587 (47.02%), Postives = 391/587 (66.61%), Query Frame = 2
Query:  134 SVIIVLSYF-SKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDEN-NQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQ-YYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFR-FKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTI-GTQDI--DKKTLIFVEVKNLTEVHSGYLESSEKHVT--EFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDS 1867
            S ++VLSYF + S+ +A  SVDL S+F+KIAIVKPG+PMEIAL++ES+RKTP  V +   ERLF + A+ + +  P   Y  +  L+GK LD+P VK +Q+ FP+Y+++ D+    + F+HD    FT EEL+ M+L +++ I E +++ P+K  ++ VPP+F Q ER A+LRAA + G NVLQ+MNSNTAVALNYG+F++K+FN T + ++MFYD G+S+T  +IV Y M K K+ G+    PQL I GIG+DRTLG     +RL+ HL   F K  K   +VT   R+MAK YKEA RV +VLSANNEI+AQ+E V D KD +VKVTR E EEMC+DLF+R   P+++AL+SA + M  I  V+L+GGG R+PK Q+ LL+  +  EL K+IN DE+AALGAVYQAA +  GFKVK F++KDAN+ PI V F R  K  +  E      R ++  MN  P K+V+TFNKHT +F F+V+  G +D+       +F E+   T    G  ++  KH +  E KG+KA+F LD  G+ +++ +E++FE+     +    STL K+G+ I++ F  S E+  D K+ S
Sbjct:   12 SALLVLSYFFAASDGLAVMSVDLGSQFMKIAIVKPGIPMEIALNKESRRKTPMAVSLRNKERLFSDGALAVSVMHPDKSYIYLHDLLGKKLDNPHVKNYQQRFPWYKLEEDKTTGNVVFRHDSDVTFTPEELMGMILNHSRFIGEQFADHPIKDVVLTVPPFFNQAERRALLRAAELVGLNVLQIMNSNTAVALNYGLFQQKSFNDTLEKHFMFYDMGASSTVATIVGYSMTKTKDRGISETAPQLVIKGIGFDRTLGGHAIDMRLRDHLVQLFKKNYKFKGEVTQSSRAMAKFYKEALRVKQVLSANNEIFAQIEGVFDGKDFRVKVTREELEEMCQDLFDRVAGPVNRALKSASMTMNDIDSVVLVGGGIRVPKVQDALLRAVKKPELAKNINADEAAALGAVYQAAHLGKGFKVKKFIIKDANIYPIQVSFSRKVKAEDGTESTKHVKRTLYYNMNTVPQKKVMTFNKHTDDFQFHVSYNGLEDLMNPADLAMFGELNVSTVSVKGVADALNKHASKGESKGIKAYFRLDENGLFNIDKVESVFEKMPEDIEDENESTLSKLGSKITSFFSGSNEKSDDAKEGS 598          

HSP 2 Score: 128.257 bits (321), Expect = 3.452e-30
Identity = 76/240 (31.67%), Postives = 133/240 (55.42%), Query Frame = 2
Query: 1928 SNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIW 2647
            +N T ++  K   S+P    ETL   ++     + +  PS E +E SR K+++L+  D+ KAA E+A+N LES++F V+ + + E+  + STE ER+   +A  A  +W +E G  +    Y  + N L+K+  D   R++E+  RP+A++ LN  LN S+ FL+ +KN+  + +I+T  + + L K+  +T +W E   K  +  + +  P +   D E     ++RE+ YLLNK   +
Sbjct:  688 ANTTEEAPKKKAPSKPVTVRETLTMTVDL----EDAVHPSHEDVEKSRAKLVELQARDDAKAANERAKNALESHIFGVRDEMNSELGEKLSTEAERETISEALTAASDWLDEDGWDSTANVYNEKLNGLKKISADFRRRMKEHKTRPKALAALNQSLNLSSTFLKQVKNMMEKDEIYTGKDLEELDKVNNETKEWLEKMTKKQDETKPHEAPVLLTRDIEHKQNKIDRELLYLLNKAKYY 923          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 187.193 bits (474), Expect = 8.680e-50
Identity = 128/414 (30.92%), Postives = 213/414 (51.45%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN--QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLP--MPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIA 1417
             +DL + +  + + + G  +EI  + +  R TPS V  +  ERL G+AA N     P+        L+G+  D PVV +    +P++ I+  E    Q+ F+ ++K+ F  EE+ +MVL   K  AE Y    +   ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++       +  + YD G     VS+++            +E+    +     D  LG   F  ++  H    F +  K  KD+T   R+M +L     R  + LS++ +   +++++ +  D    +TRA FEE+ +DLF++  EP+ +A+  +++P    +I +++L+GG TRIPK Q++L +    +EL KSIN DE+ A GA  QAA +  G K  T  VKD  L+ +A
Sbjct:    8 GIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFP-EEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVE---RNVLIYDLGGGTFDVSVLT------------IEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQ--KYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILH-GDKDDT--VKDLLLLDVA 399          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 186.422 bits (472), Expect = 1.454e-49
Identity = 134/413 (32.45%), Postives = 205/413 (49.64%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQ---HDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIA 1417
             +DL + +  + + + G  +EI  + +  R TPS V     ERL G+AA N     P+        L+G+  D   V+   K +P+  I   +NN+   Q     E+  F  EE+ +MVL   K  AE Y    +   +I VP YF   +R A   A  IAG NVL+++N  TA AL YG+ +     +  +  + +D G     VSI++       + G + E     +     D  LG   F  RL  H    F +  K  KD++   R+M +L     R  + LS++ E   +V+++ +  D   K++RA FE++C DLF   ++P++KAL  A+     I EV+L+GG TR+PK Q++L +    + L KSIN DE+ A GA  QAA +S     K+  VKD  LV +A
Sbjct:    8 GIDLGTTYSCVGVFQNG-KVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIIS--DNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSL---SGEKNVLIFDLGGGTFDVSILTI------DDGSLFE-----VKSTAGDTHLGGEDFDNRLVNHFVAEFKR--KYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGD---KSDEVKDVLLVDVA 398          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Nematostella
Match: EDO49736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFJ9])

HSP 1 Score: 178.333 bits (451), Expect = 4.601e-46
Identity = 134/460 (29.13%), Postives = 222/460 (48.26%), Query Frame = 2
Query:  176 IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE--NNQLAFQ---HDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSAN-NEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKH 1537
            ++    D+ ++   IA+ + G  +E   +  S R TPS V +   +RL G +  N  I   K         +G+    P V   QK+ P+   K+ E  N+ +  Q     ++ VF+ E+++AM+    K  AE   +  +   +I VP Y+T  +R  +L A+  AG N L+LMN  TAV+L YGI+++       +  +F D G S+  V I ++               QL ++    +  LG   F   L  H A  F    K   DV +  ++  KL  E  ++ K++SAN +EI   +E  ++DKD+  ++ RA+FEE+  DL +    P+  AL  + L    I  V ++GG TRIP  ++I +K    +EL  ++N DE+ A G   Q A +SP F+V+ F V D    PI      +K+   +++       +F   + FP+ ++LTF + 
Sbjct:    1 MSVVGFDVGNQSCYIAVARGG-GIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQMISNLKNTISQFKRFIGRKFSDPAV---QKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAMLFTRLKTTAEIALKTKVTDCVISVPSYYTDRQRRCMLDASATAGLNCLRLMNDTTAVSLAYGIYKQDLPTDKPRNVVFVDIGHSSLQVCITAFL------------KGQLKVLSTAVEPNLGGRDFDYVLVEHFAQEFK--TKYKIDVHSSIKAKIKLGAECEKLKKLMSANTSEIPINIECFMEDKDVHGRMKRAQFEELAADLLKLVEAPLRSALAQSGLKNEEIDSVEIVGGSTRIPAIKDI-IKNVFGKELMTTMNADEAVARGCALQCAMLSPTFRVREFSVNDITPYPIV---LTWKSQCEEDIGEME---LFAANHSFPLSKMLTFYRR 435          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 165.622 bits (418), Expect = 1.103e-42
Identity = 115/392 (29.34%), Postives = 190/392 (48.47%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKT-VFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQL-PMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFI 1357
             +DL + +  + + + G  +EI  + +  R TPS V    +ERL G+AA N     P         L+G+  D P VK   K + +  +      ++  ++  +T  F  EE+ +MVL   K  AE Y    +   ++ VP YF   +R A   A  I+G NVL+++N  TA A+ YG+ ++       +  + +D G     VS++S            +E+    +     D  LG   F   +       F +  K  KD+T   R++ +L     R  + LS++ +   +++++ D  D    +TRA FEEM   LF++ +EP+ KA++ ++L     I E++++GG TRIPK Q +L      +EL KSIN DE+ A GA  QAA +
Sbjct:    8 GIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVG---QERNVLIFDLGGGTFDVSVLS------------IEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQ--KYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAIL 381          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Medaka
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:101156550])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 349/872 (40.02%), Postives = 509/872 (58.37%), Query Frame = 2
Query:  131 FSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDE-NNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDI--DKKTLIFVEVKNLTEVH-SGYLESSEKHV-TEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKS---------------DKKDDSNTVTNETVAANDTQS-INKTA-----------SNATGD-----SVNKTQTSEPQNRIE-----------TLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRA 2602
             S + + S  S S  +A  SVDL SE++K+AIVKPGVPMEI L++ES+RKTP+ V + ++ERLFG++A+ M +K PK +Y  +  L+GK   +  V  +QK FP +++  D     + F+  E   FT EELL MVL  ++ +A+ ++E  +K  +I VP +F Q ER A+L AA +AG  VLQL+N NTAVALNYG+FRRK  ++T +  +FYD G+S+TT ++V+YQMVK KEFG     PQL I G+G+DR LG  +  LRL+ HLA  FN+ KK  KDV    R+MAKL KEA R+  VLSAN E  AQVE ++DD D K KVTRAEFEE+C DLFER   P+H ALE+A L +  I+ VIL+GG TR+PK QE+LLK TE +ELGK+IN DE+AA+GAVYQAA +S  FKVK F+++DA L PI V+F R    E  +      R++F  M  +P ++V+TFN++  +F FN+  G        +  +F  V NL+ V  SG   S +KH   E KG+KAHF +D  G++ L+ +E++FE     ++K E STL ++GNTIS LFG  + + +               D + D+   + +  AA DTQS   K++           SN   D        K   +EP+ + +           T+ Q +N I        P+ + +  S+KK+  L   D  K   EK+ N LE+++F  + +  +E Y++  ++ E++        + EW +E+G A   +    + ++L+ L  D+ FRV E    P+ ++ L S+LN+S  FL + K +  + +IFT+ E + L K+I +TT W          + L   P +   D E   + 
Sbjct:   11 LSCLFLASLPSYSVSVAVMSVDLGSEWIKVAIVKPGVPMEIVLNKESRRKTPTAVCLKENERLFGDSALGMSVKNPKTVYRHLQSLLGKKHSNLNVALYQKRFPEHQLLEDPVRGTVLFESSEAKWFTPEELLGMVLNYSRGLAQDFAEQQIKDAVITVPAFFNQAERRAVLHAAEMAGLKVLQLINDNTAVALNYGVFRRKDLDSTVKNVIFYDMGASSTTATVVTYQMVKTKEFGT---QPQLQIRGVGFDRGLGGFEMDLRLRDHLAKLFNEQKKSKKDVRENHRAMAKLLKEAQRLKTVLSANMEFMAQVEGLMDDIDFKSKVTRAEFEELCSDLFERVPRPLHDALETADLKLDDIELVILVGGSTRVPKVQEVLLKATEKEELGKNINADEAAAMGAVYQAAVLSKAFKVKPFLIRDAALFPIQVEFTREVEEEGIKTLKQNKRILFQRMAPYPQRKVITFNRYQSDFAFNINYGDMSFLTPNELSVFGSV-NLSTVKLSGVGSSFQKHADAESKGIKAHFNMDESGVLLLDRVESVFET--TVDEKEEESTLTRLGNTISTLFGGGSSDPTVNLTEPVQDDEETPLDSRKDNKDESQKEEAAKDTQSDFEKSSEDEKLQEKEEESNDKKDPTEEKDAEKHGKAEPEKKAKLQKKSKISEEITVEQIINDILN------PTPDDLASSKKKLQDLTNRDLAKQEREKSLNNLEAFIFETQDKLYQEDYSQVVSDQEKEQIAAKLTEVSEWMDEEGYAATTKQLKEKLSQLKGLCKDMFFRVEERRKWPDRLAALESLLNTSTFFLRSAKQIPEDDQIFTEVELNMLEKVINETTIWKNKTVAAQEKLSLQEPPILLSKDIEAKAKG 870          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Medaka
Match: hspa4b (heat shock protein family A (Hsp70) member 4 [Source:NCBI gene;Acc:101166806])

HSP 1 Score: 207.994 bits (528), Expect = 2.766e-55
Identity = 211/825 (25.58%), Postives = 363/825 (44.00%), Query Frame = 2
Query:  218 IAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN---QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRR--KAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSAN-NEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQD---IDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSL---NYIEALFERQWNSNDKN-EASTLE--KIGNTISNLFGSSTEEKSDKKD---DSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKI 2638
            +A+ + G  +E   +  S R TP+ V      R  G AA +  +   K          G+    P V+  +    Y   +M       ++ +  +EK +F++E++ AM+L   K  AE+  + P+   ++ VP Y+T  ER +++ AA+IAG N L+LMN  TAVAL YGI+++   A    A+  +F D G S    S+ ++   K+K            ++    D  LG   F   L  H    F K  K   DV T PR++ +LY+E  ++ K++SAN +++   +E  ++D D+  K+ R +FEEMC D+  R   P+   LE A+L    I  V ++GG +RIP  +E + K    +EL  ++N DE+ A G   Q A +SP FKV+ F + +  +VP  +        E+      +   +F   +  P  +VLTF +  + F                 T+    ++ +    SG  ESS+  V     +   F + +  +V +   +  E   E +  + DK+ E S ++  + G          TEEK+ +++   D++T  N+    +D Q      +      +     + PQ ++     NL                +E   K I+Q K +++E+     A+N +E YV+ ++ +    I+ +  +E++R       +    W  E G   PK+ YI +  EL+KL   I  R  E   RP+A   +   +     F+E  K    +     +A+   + KL  D   W  +     +   L ++P + + D     RA  RE+    N I
Sbjct:   15 VAVARAGG-IETVANEYSDRCTPACVSFGPRNRSIGAAAKSQVVTNCKNTVQGFKRFHGRVFSDPYVQSIKNSLVYDIAQMPTGTTGIKVTYMEEEK-LFSIEQITAMLLTKLKETAESALKKPVFDCVVSVPCYYTDAERRSVVDAAQIAGLNCLRLMNETTAVALAYGIYKQDLPAPEEKARNVVFVDLGHSGYQTSVCAFNKGKLK------------VLATACDPQLGGKDFDEMLVQHFCEDFGKRYK--LDVKTKPRALVRLYQECEKLKKLMSANSSDLPLNIECFMNDIDVTGKMNRGQFEEMCADILTRVEPPLQSLLEQAKLKKEDIYAVEIVGGASRIPAVKERISKFF-GKELSTTLNADEAVARGCALQCAILSPAFKVREFSITE--VVPYPISLKWHSAAED----GLSDCEVFPKNHAAPFSKVLTFYRR-EPFSLEAYYSCPSELPYPDPTIGQFLIQKVVPQASG--ESSKVKVKVRVNIHGIFSVSSASLVEVQKSDETEEPMETEQAATDKDGEQSKMQTDQDGQQAQADVQKETEEKTPQENEEMDTSTEENKGEKKSD-QPPQAKKAKVKTKVLELPIENSPQWQLANDMLNL---------------FVENEGKMIMQDK-LEKER---NDAKNYVEEYVYDMRDKLHG-IFEKFVSESDRDALSLKLEDTENWLYEDGEDQPKQVYIDKLAELKKLGQPIQERYLEAEERPKAFDEMGKQIQQYMKFVEAFKMNEEQYNHLDEADVSKVDKLTSDAMIWMNSTMNQQSKQSLTLDPAVKVKDI----RAKTRELFSACNPI 788          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Medaka
Match: hspa4l (heat shock protein family A (Hsp70) member 4 like [Source:NCBI gene;Acc:101157098])

HSP 1 Score: 201.06 bits (510), Expect = 3.595e-53
Identity = 203/813 (24.97%), Postives = 364/813 (44.77%), Query Frame = 2
Query:  176 IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQH-DEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNT--TAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSAN-NEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGT-QDI---DKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQ-TSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDF 2584
            ++   +D+  +   IA+ + G  +E   +  S R TP+ V      R+ GNAA +  I   K   H    L G+  D   +   Q   PY   K+   N  +  ++ D   VFTVE++  M+L   +  +++  + P+   +I VP +FT  ER ++  A +IAG N L+L+N  TAVAL YGI+++   N     +  +F D G S+  VSI ++   K+K            ++   +D  LG   F   L  +    F    K   +V   PR++ +L++E  ++ K++SAN +++   +E  ++D D+  ++ RA+FE+MC     R   P+  ALE ++L    +  V L+GG TRIP  ++ + K    +++  ++N DE+ A G   Q A +SP FKV+ F + D    PI +   R+KT     +       +F   +  P  +V+TF+K  + FD        Q++   D +   F  V+N+     G  +SS+        VK    ++  GI S++   +L E+Q     K E   ++     +    G + E+   + D      N+    ND  S N +   A G+S + T   S+P+ ++++L   +    + +  +      +E  R+ I Q K + E    +  A+N +E YV+ ++ +    +Y +   E +        +    W  E G   PK  Y  + + L++L   I  R  E+  RP+A   L   L     F++  +         +  E   + K + +   W        + + +  +P + ++D 
Sbjct:    1 MSVVGIDVGFQNCYIAVARSG-GIETIANEYSDRCTPACVSFASKNRMIGNAAKSQMITNFKNTVHGFKKLHGRAFDDAFILAEQPKLPYSLHKLPNGNAGIKVRYLDADKVFTVEQITGMLLSKLRETSQSALKKPVVDCVISVPSFFTDAERRSVFDATQIAGLNCLRLINDTTAVALAYGIYKQDLPNPEEKPRNVVFVDMGHSSFQVSITAFNKGKLK------------VLATAFDPYLGGRNFDEALVDYFCEEFK--TKYKLNVRDNPRALLRLHQECEKLKKLMSANSSDLPLNIECFMNDIDVSSRMNRAQFEDMCAQYLMRVEMPLKTALEQSKLSRDDVYAVELVGGATRIPAVKDRIAKYF-CKDISTTLNADEAVARGCALQCAILSPAFKVREFSITDVVTFPITL---RWKTPTEDGLGECE---VFGKNHSAPFSKVITFHK-KEPFDLEAFYSNPQELPYPDHRIGCF-SVQNVVPQPDG--DSSK--------VKVKVRVNIHGIFSVSSA-SLIEKQ-----KGEGEDMQIDSEPMVQNEGRAEEQTKMQVDPEG--QNQGDQHNDDSSFN-SKEGAAGESQDPTAGGSKPKVKVKSLDLPIMSSNIRQLDTEVLANFVESERQMISQDKLVKE----VNDAKNAVEEYVYELREKLCG-VYQKYINEEDSNRLTLMLEDTENWLYEDGEDQPKHVYEEKLDALKRLGQPIQERHIEHEDRPKAFEELGKKLQLYLKFVDCYRQKDERFVHLSPEEMSIVEKCVNEGMGWLNNKMNAQSKLDITQDPVVKVADI 765          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Medaka
Match: hspa4l (heat shock protein family A (Hsp70) member 4 like [Source:NCBI gene;Acc:101157098])

HSP 1 Score: 201.06 bits (510), Expect = 4.363e-53
Identity = 203/813 (24.97%), Postives = 364/813 (44.77%), Query Frame = 2
Query:  176 IATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQ-LAFQH-DEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNT--TAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSAN-NEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGT-QDI---DKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQ-TSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDF 2584
            ++   +D+  +   IA+ + G  +E   +  S R TP+ V      R+ GNAA +  I   K   H    L G+  D   +   Q   PY   K+   N  +  ++ D   VFTVE++  M+L   +  +++  + P+   +I VP +FT  ER ++  A +IAG N L+L+N  TAVAL YGI+++   N     +  +F D G S+  VSI ++   K+K            ++   +D  LG   F   L  +    F    K   +V   PR++ +L++E  ++ K++SAN +++   +E  ++D D+  ++ RA+FE+MC     R   P+  ALE ++L    +  V L+GG TRIP  ++ + K    +++  ++N DE+ A G   Q A +SP FKV+ F + D    PI +   R+KT     +       +F   +  P  +V+TF+K  + FD        Q++   D +   F  V+N+     G  +SS+        VK    ++  GI S++   +L E+Q     K E   ++     +    G + E+   + D      N+    ND  S N +   A G+S + T   S+P+ ++++L   +    + +  +      +E  R+ I Q K + E    +  A+N +E YV+ ++ +    +Y +   E +        +    W  E G   PK  Y  + + L++L   I  R  E+  RP+A   L   L     F++  +         +  E   + K + +   W        + + +  +P + ++D 
Sbjct:    1 MSVVGIDVGFQNCYIAVARSG-GIETIANEYSDRCTPACVSFASKNRMIGNAAKSQMITNFKNTVHGFKKLHGRAFDDAFILAEQPKLPYSLHKLPNGNAGIKVRYLDADKVFTVEQITGMLLSKLRETSQSALKKPVVDCVISVPSFFTDAERRSVFDATQIAGLNCLRLINDTTAVALAYGIYKQDLPNPEEKPRNVVFVDMGHSSFQVSITAFNKGKLK------------VLATAFDPYLGGRNFDEALVDYFCEEFK--TKYKLNVRDNPRALLRLHQECEKLKKLMSANSSDLPLNIECFMNDIDVSSRMNRAQFEDMCAQYLMRVEMPLKTALEQSKLSRDDVYAVELVGGATRIPAVKDRIAKYF-CKDISTTLNADEAVARGCALQCAILSPAFKVREFSITDVVTFPITL---RWKTPTEDGLGECE---VFGKNHSAPFSKVITFHK-KEPFDLEAFYSNPQELPYPDHRIGCF-SVQNVVPQPDG--DSSK--------VKVKVRVNIHGIFSVSSA-SLIEKQ-----KGEGEDMQIDSEPMVQNEGRAEEQTKMQVDPEG--QNQGDQHNDDSSFN-SKEGAAGESQDPTAGGSKPKVKVKSLDLPIMSSNIRQLDTEVLANFVESERQMISQDKLVKE----VNDAKNAVEEYVYELREKLCG-VYQKYINEEDSNRLTLMLEDTENWLYEDGEDQPKHVYEEKLDALKRLGQPIQERHIEHEDRPKAFEELGKKLQLYLKFVDCYRQKDERFVHLSPEEMSIVEKCVNEGMGWLNNKMNAQSKLDITQDPVVKVADI 765          
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027715.1 (pep primary_assembly:ASM223467v1:8:715730:793937:1 gene:ENSORLG00000026256.1 transcript:ENSORLT00000027715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 9.549e-50
Identity = 127/396 (32.07%), Postives = 196/396 (49.49%), Query Frame = 2
Query:  182 TYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHD---EKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFIS 1360
            +  +DL + +  + + + G  +EI  + +  R TPS V     ERL G+AA N     P         L+G+  D PVV+   K +P+  +   E  +   Q D   E   F  EE+ +MVL   K IAE Y    +   +I VP YF   +R A   A  IAG NV +++N  TA A+ YG+ + K   +  +  + +D G     VSI++            +E+    +     D  LG   F  R+  H    F +  K  KD++   R++ +L     R  + LS++++   +++++ +  D    VTRA FEE+C DLF   +EP+ KAL  A++    I +V+L+GG TRIPK Q++L      +EL KSIN DE+ A GA  QAA +S
Sbjct:    8 SIGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVVS--EGGKPKIQVDYKGENKTFFPEEISSMVLVKMKEIAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVQRIINEPTAAAIAYGLDKGK---SGERNVLIFDLGGGTFDVSILT------------IEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKR--KHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSVTRARFEELCSDLFRGTLEPVEKALRDAKMDKGQIHDVVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILS 383          
BLAST of Hypoxia up-regulated protein 1 vs. Planmine SMEST
Match: SMESG000054253.1 (SMESG000054253.1)

HSP 1 Score: 1803.49 bits (4670), Expect = 0.000e+0
Identity = 912/917 (99.45%), Postives = 917/917 (100.00%), Query Frame = 2
Query:  110 MNYFKFWFSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIEMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWKXXXXXXXXXXXXDNQXXXXXXXXXXXXXDNQSKSESAKDAGKKDEPKPSLPDENDTTKFQETPRKDEHVD 2860
            MNYFKFWFSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEERLAILRAARIAGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVI+MSRKKIIQLKQID+EKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLA+D+AQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLN+NPKITISDFEPHGRALEREIGYLLNKISIWKSQPPPPTQSPPTDNQTSKEETKESSEKKDNQSKSESAKDAGKKDEPKPSLPDENDTTKFQETPRKDEHVD
Sbjct:    1 MNYFKFWFSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEERLAILRAARIAGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQWNSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQSINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVIDMSRKKIIQLKQIDDEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTETERKLAVDSAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNVNPKITISDFEPHGRALEREIGYLLNKISIWKSQPPPPTQSPPTDNQTSKEETKESSEKKDNQSKSESAKDAGKKDEPKPSLPDENDTTKFQETPRKDEHVD 917          
BLAST of Hypoxia up-regulated protein 1 vs. Planmine SMEST
Match: SMESG000080711.1 (SMESG000080711.1)

HSP 1 Score: 196.052 bits (497), Expect = 1.067e-52
Identity = 131/412 (31.80%), Postives = 210/412 (50.97%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENN--QLAFQHDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIA 1417
             +DL + F  + + + G  +EI  + +  R TPS V  N  ERL G+AA N     P         L+G+  D P V+   K F +  + ++     Q+ F+ + KT F+ EE+ +MVL   K  AE Y    +K  ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ ++   ++  +  + +D G     VSI+S            +++    +     D  LG   F  R+  H    F +  K  KD++   R++ +L     R  + LS++ +   +V+++ +  D    +TRA FEE+C DLF   ++P+ K+L  A++    I E++L+GG TRIPK Q++L      +EL KSIN DE+ A GA  QAA +S     K+ VV+D  L+ +A
Sbjct:    7 GIDLGTTFSCVGVFQHG-KVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKT-FSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKK---SSDEKNVLIFDLGGGTFDVSILS------------IDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKR--KHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGD---KSDVVQDLLLLDVA 396          
BLAST of Hypoxia up-regulated protein 1 vs. Planmine SMEST
Match: SMESG000077989.1 (SMESG000077989.1)

HSP 1 Score: 189.889 bits (481), Expect = 1.241e-50
Identity = 131/411 (31.87%), Postives = 205/411 (49.88%), Query Frame = 2
Query:  188 SVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQH-DEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIA 1417
             +DL + F  + I + G  +EI  + +  R TPS V  N  ERL G+AA N     P         L+G+  + P V+   K F Y  + +D   ++  +   E  VF+ EE+ +MVL   K  AE Y    +K  ++ VP YF   +R A   A  IAG NVL+++N  TA A+ YG+ + +      +  + +D G     VS+++            +EN    +     D  LG   F  R+       F +  K  KD++   +S+ +L     R  + LS++     +V+++ D  D    +TRA FEE+C DLF+  ++P+ KAL+ A++    I E++L+GG TRIPK Q++L      +EL KSIN DE+ A GA  QAA +S      + +V+D  L+ IA
Sbjct:    7 GIDLGTTFSCVGIFQHG-KVEIIGNDQGNRTTPSFVAFNDSERLIGDAAKNQAALNPINTVFDAKRLIGRKFNDPSVQNDLKHFSYKVVDVDNLPKIQVEFLGEIKVFSPEEISSMVLLKMKETAEAYLGSEVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKNE---KKIRNVLIFDLGGGTFDVSVLA------------IENGIFEVKSTAGDTHLGGEDFDNRMVDFFIQEFKR--KHKKDISDNKKSLRRLRTVCERAKRTLSSSAVANIEVDSLFDGIDFYTSITRARFEELCADLFKSTLDPVEKALKDAKIDKKNINEIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGD---TSEIVQDLLLLDIA 396          
BLAST of Hypoxia up-regulated protein 1 vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 184.111 bits (466), Expect = 2.041e-48
Identity = 131/466 (28.11%), Postives = 223/466 (47.85%), Query Frame = 2
Query:  113 NYFKFWFSVIIVLSYFS---------KSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPS-VVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQ---HDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFT 1471
            N+      + +V+SY +         K +      +DL + +  + + K G  +EI  + +  R TPS V +  + ERL G+AA N     P+     +   +G+  D   VKQ  K++P+  I  ++NN+   Q    +E  +F  EE+ AMVL   K IAE+Y    +   ++ VP YF   +R A   A  I+G NVL+++N  TA A+ YG+ +++      +  + +D G     VS+++            ++N    +V    D  LG   F  R+  +    + K  K  KDV    R++ KL +E  +  + LS ++     +E+  D  D    +TRA FEE+  DLF+  ++P+ K L+ + L    + E++L+GG TRIPK Q+++ +  + +E  + IN DE+ A GA  QA  I    +    V+ D  + P+ +       +  K +P  T
Sbjct:    6 NFICIILCINVVISYATENKKDSESPKDDYGTVIGIDLGTTYSCVGVFKSG-RVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPFLVI--NKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKEG----EKNILVFDLGGGTFDVSLLT------------IDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRK--KHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETLTRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLD--VCPLTLGIETVGAVMTKLIPRNT 448          
BLAST of Hypoxia up-regulated protein 1 vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 184.111 bits (466), Expect = 2.110e-48
Identity = 131/466 (28.11%), Postives = 223/466 (47.85%), Query Frame = 2
Query:  113 NYFKFWFSVIIVLSYFS---------KSECIATYSVDLSSEFLKIAIVKPGVPMEIALDRESQRKTPS-VVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQ---HDEKTVFTVEELLAMVLENAKHIAETYSEMPMKGGIIVVPPYFTQEEXXXXXXXXXXXGTNVLQLMNSNTAVALNYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEVPHFT 1471
            N+      + +V+SY +         K +      +DL + +  + + K G  +EI  + +  R TPS V +  + ERL G+AA N     P+     +   +G+  D   VKQ  K++P+  I  ++NN+   Q    +E  +F  EE+ AMVL   K IAE+Y    +   ++ VP YF   +R A   A  I+G NVL+++N  TA A+ YG+ +++      +  + +D G     VS+++            ++N    +V    D  LG   F  R+  +    + K  K  KDV    R++ KL +E  +  + LS ++     +E+  D  D    +TRA FEE+  DLF+  ++P+ K L+ + L    + E++L+GG TRIPK Q+++ +  + +E  + IN DE+ A GA  QA  I    +    V+ D  + P+ +       +  K +P  T
Sbjct:    5 NFICIILCINVVISYATENKKDSESPKDDYGTVIGIDLGTTYSCVGVFKSG-RVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPFLVI--NKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKEG----EKNILVFDLGGGTFDVSLLT------------IDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRK--KHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETLTRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLD--VCPLTLGIETVGAVMTKLIPRNT 447          
The following BLAST results are available for this feature:
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HYOU10.000e+041.72hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGN... [more]
HYOU10.000e+041.72hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGN... [more]
HYOU10.000e+041.72hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGN... [more]
HYOU10.000e+041.72hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGN... [more]
HYOU10.000e+039.49hypoxia up-regulated 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T24H7.25.260e-12932.50pep chromosome:WBcel235:II:6247311:6250841:1 gene:... [more]
T14G8.31.931e-11935.01pep chromosome:WBcel235:X:12861237:12870025:1 gene... [more]
T14G8.34.460e-11935.15pep chromosome:WBcel235:X:12861237:12870018:1 gene... [more]
F44E5.57.955e-5634.13pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.57.955e-5634.13pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG29180.000e+040.16gene:FBgn0023529 transcript:FBtr0300792[more]
CG29180.000e+040.16gene:FBgn0023529 transcript:FBtr0070411[more]
Hsp683.418e-5032.04gene:FBgn0001230 transcript:FBtr0084589[more]
Hsc70-43.676e-5031.46gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-43.676e-5031.46gene:FBgn0266599 transcript:FBtr0337053[more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hyou10.000e+039.55hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou10.000e+039.55hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou10.000e+039.55hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hsph15.573e-5425.03heat shock 105/110 protein 1 [Source:ZFIN;Acc:ZDB-... [more]
hsp70.16.418e-5131.20heat shock cognate 70-kd protein, tandem duplicate... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pawr0.000e+041.42PRKC, apoptosis, WT1, regulator [Source:Xenbase;Ac... [more]
pawr0.000e+041.73PRKC, apoptosis, WT1, regulator [Source:Xenbase;Ac... [more]
pawr0.000e+041.50PRKC, apoptosis, WT1, regulator [Source:Xenbase;Ac... [more]
pawr0.000e+041.55PRKC, apoptosis, WT1, regulator [Source:Xenbase;Ac... [more]
pawr0.000e+039.24PRKC, apoptosis, WT1, regulator [Source:Xenbase;Ac... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hyou14.705e-16347.95hypoxia up-regulated 1 [Source:MGI Symbol;Acc:MGI:... [more]
Hyou14.705e-16347.95hypoxia up-regulated 1 [Source:MGI Symbol;Acc:MGI:... [more]
Hyou14.705e-16347.95hypoxia up-regulated 1 [Source:MGI Symbol;Acc:MGI:... [more]
Hspa4l4.443e-5425.09heat shock protein 4 like [Source:MGI Symbol;Acc:M... [more]
Hspa4l4.443e-5425.09heat shock protein 4 like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZUW2|HYOU1_DANRE0.000e+039.55Hypoxia up-regulated protein 1 OS=Danio rerio OX=7... [more]
sp|Q9Y4L1|HYOU1_HUMAN0.000e+039.49Hypoxia up-regulated protein 1 OS=Homo sapiens OX=... [more]
sp|Q60432|HYOU1_CRIGR6.068e-18038.47Hypoxia up-regulated protein 1 OS=Cricetulus grise... [more]
sp|Q63617|HYOU1_RAT8.265e-18039.49Hypoxia up-regulated protein 1 OS=Rattus norvegicu... [more]
sp|Q0VA61|HYOU1_XENTR1.396e-16746.53Hypoxia up-regulated protein 1 (Fragment) OS=Xenop... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FLJ40.000e+045.89Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G9A30.000e+045.89Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DVT40.000e+045.77Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8ISK30.000e+046.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8ILP90.000e+046.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hyou10.000e+040.57hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou12.603e-16648.28hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou11.156e-16548.28hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou12.778e-15547.06hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
ENSAMXT00000055474.11.361e-5332.23pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa56.515e-4530.20heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa92.327e-2926.13heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa142.677e-2926.51heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
ENSPMAT00000003663.16.975e-2022.22pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:... [more]
hspa137.875e-1524.32heat shock protein 70 family, member 13 [Source:ZF... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA32.505e-5230.28ATPase involved in protein folding and the respons... [more]
SSA16.154e-5030.83ATPase involved in protein folding and NLS-directe... [more]
SSA27.170e-5028.51HSP70 family ATP-binding protein; involved in prot... [more]
KAR21.193e-4930.99ATPase involved in protein import into the ER; als... [more]
SSA47.546e-4932.09Heat shock protein that is highly induced upon str... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352042.661e-17147.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372808.680e-5030.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445301.454e-4932.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497364.601e-4629.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303231.103e-4229.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hyou10.000e+040.02hypoxia up-regulated 1 [Source:NCBI gene;Acc:10115... [more]
hspa4b2.766e-5525.58heat shock protein family A (Hsp70) member 4 [Sour... [more]
hspa4l3.595e-5324.97heat shock protein family A (Hsp70) member 4 like ... [more]
hspa4l4.363e-5324.97heat shock protein family A (Hsp70) member 4 like ... [more]
ENSORLT00000027715.19.549e-5032.07pep primary_assembly:ASM223467v1:8:715730:793937:1... [more]
back to top
BLAST of Hypoxia up-regulated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054253.10.000e+099.45SMESG000054253.1[more]
SMESG000080711.11.067e-5231.80SMESG000080711.1[more]
SMESG000077989.11.241e-5031.87SMESG000077989.1[more]
SMESG000068215.12.041e-4828.11SMESG000068215.1[more]
SMESG000068215.12.110e-4828.11SMESG000068215.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033090 ID=SMED30033090|Name=Hypoxia up-regulated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3004bp
TTTCAAAGAACGAACCAATCATATTTCTCCAAATATAACTTACTAAAAAT
TCGTGTATTTTATAGGATTTTTGGAATTGTTCACGTGTAACTAATATTAA
TATTCGAAAATGAATTACTTTAAATTCTGGTTTTCCGTGATTATTGTATT
ATCGTATTTCTCCAAATCAGAATGTATCGCAACTTATTCTGTCGATCTTA
GTAGTGAATTTCTCAAAATTGCCATAGTGAAGCCGGGTGTTCCTATGGAA
ATTGCGTTAGATCGAGAATCCCAACGAAAAACACCATCAGTAGTTTACAT
AAATAAAGATGAGAGATTATTTGGAAATGCTGCAATGAATATGGGTATTA
AATTCCCTAAATATTTATACCATTCAATCACATTATTGGTTGGGAAGACT
CTTGACCACCCTGTCGTTAAACAATTTCAAAAAGATTTCCCATATTATGA
AATTAAAATGGATGAAAATAATCAATTAGCTTTCCAACATGATGAGAAAA
CTGTGTTCACTGTCGAAGAGCTGCTTGCTATGGTGTTGGAAAATGCTAAA
CATATCGCTGAAACATATTCTGAAATGCCAATGAAGGGTGGGATTATTGT
TGTGCCCCCTTACTTTACCCAGGAAGAGAGATTGGCGATTTTGAGGGCAG
CTAGAATTGCTGGAACCAATGTATTGCAATTGATGAACAGCAACACTGCT
GTTGCACTCAATTATGGGATTTTCAGACGGAAAGCTTTTAATACCACTGC
CCAATATTACATGTTTTATGATTTTGGATCAAGCGCCACCACTGTATCGA
TTGTCAGCTATCAGATGGTCAAAGTCAAAGAATTTGGAATGATGGTTGAG
AATCCTCAATTATCAATTGTGGGAATTGGATACGATCGCACTCTGGGAGC
GTCACAATTTATTTTGAGATTACAAGCCCATTTAGCCCATGCCTTTAACA
AACTGAAAAAACCGTCAAAAGATGTTACAACCGTTCCAAGATCCATGGCA
AAACTTTACAAAGAAGCTTCCCGAGTTCTCAAAGTTCTCAGTGCTAATAA
TGAGATTTATGCCCAGGTTGAGAATGTCCTTGATGATAAAGATTTGAAAG
TCAAAGTAACGAGAGCGGAATTTGAAGAAATGTGCAAAGATTTGTTTGAG
AGGTTCGTCGAGCCAATTCACAAGGCTCTGGAATCTGCCCAGTTGCCAAT
GCCGACAATTAAGGAGGTTATATTGATGGGCGGTGGAACTAGAATTCCCA
AATTTCAAGAAATACTGTTGAAAACCACTGAAATGCAAGAACTGGGTAAA
AGTATAAACACCGACGAGTCGGCTGCCCTCGGCGCAGTTTATCAAGCTGC
CTTTATTAGTCCTGGTTTTAAAGTTAAAACATTCGTGGTTAAAGATGCAA
ACTTAGTTCCGATTGCGGTTGATTTCTTCCGTTTCAAGACGATGGAAAAT
AAAGAAGTTCCACATTTCACTTCAAGAGTCATTTTTGATTTTATGAATTA
TTTCCCCATGAAAAGAGTCCTAACTTTTAATAAGCATACCAAAAATTTTG
ATTTCAATGTTACGATAGGAACTCAGGATATTGATAAAAAAACTTTGATT
TTTGTGGAAGTAAAAAACCTGACCGAAGTTCATAGTGGATATTTGGAATC
CTCCGAAAAGCACGTAACAGAATTTAAAGGTGTAAAAGCTCATTTCGGAT
TGGATGCCGGTGGAATAGTTTCACTGAATTATATTGAAGCTCTTTTTGAA
AGGCAGTGGAATAGTAATGATAAAAATGAAGCCAGCACTTTGGAAAAGAT
TGGAAATACTATCAGTAATTTATTCGGATCATCGACAGAAGAAAAATCTG
ATAAGAAAGACGACTCGAATACCGTGACAAATGAAACTGTTGCCGCAAAC
GATACTCAATCGATAAACAAAACGGCATCTAACGCCACCGGAGACTCCGT
TAACAAAACCCAAACGTCAGAACCGCAAAACCGAATCGAAACTCTTCACC
AAAACCTGAATTTCATCACCGTCTATAAAGCATCCTCCCTGCCGTCCGAG
GAAGTTATTGAGATGTCTAGGAAAAAAATTATTCAATTAAAACAAATCGA
CGAGGAAAAGGCTGCATTAGAAAAAGCACAGAATGAATTGGAATCCTACG
TTTTTCTGGTGAAAAGTCAATTCGATAAAGAGATCTACACCCGATGTTCC
ACTGAGACCGAAAGAAAGTTAGCTATAGACGCTGCACAAGCGCTCGGTGA
GTGGTATGAAGAGCAGGGTCCAGCAACACCGAAAGAAGACTACATTACAA
GATACAACGAGTTACGAAAGTTAATGGGGGATATCGATTTTCGGGTGCGA
GAGTATAATTTGCGGCCCGAAGCAATTAGTCGATTGAATTCCGTTTTGAA
CTCTTCGAATGGATTTCTGGAAAATATCAAAAATCTCACCGGTGAAGGGA
AAATCTTTACCCAAGCGGAATCTGATTCATTGTCAAAGTTGATTGTCGAC
ACAACTAAATGGTTTGAGGCGGCAAATAAAACTTTCAATTCTATGCAACT
GAATATCAACCCGAAAATTACTATTTCTGATTTCGAACCCCACGGCAGAG
CATTGGAAAGGGAAATCGGATATCTTTTGAATAAGATCTCGATTTGGAAG
TCGCAACCTCCACCTCCGACACAATCTCCACCAACTGATAATCAGACCTC
CAAAGAAGAGACAAAGGAATCGAGTGAGAAAAAAGACAATCAAAGTAAAT
CAGAATCAGCTAAAGATGCTGGGAAAAAGGACGAACCAAAACCGAGTTTA
CCAGACGAGAATGATACTACAAAATTCCAAGAAACTCCGAGAAAAGATGA
GCACGTTGATTTGTAGTTGCATTTTATTGAAATTTTATTGTTTATTGTGT
TTTTAATTGTTATTGTGGATTTTTGCATTTGCAATGGTTTCTATGAACAT
TTATTTATTTGCATTTCTTCGGTTTCAAATGTATCATTCCGATTCTAAAA
AAAA
back to top

protein sequence of SMED30033090-orf-1

>SMED30033090-orf-1 ID=SMED30033090-orf-1|Name=SMED30033090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=919bp
MNYFKFWFSVIIVLSYFSKSECIATYSVDLSSEFLKIAIVKPGVPMEIAL
DRESQRKTPSVVYINKDERLFGNAAMNMGIKFPKYLYHSITLLVGKTLDH
PVVKQFQKDFPYYEIKMDENNQLAFQHDEKTVFTVEELLAMVLENAKHIA
ETYSEMPMKGGIIVVPPYFTQEERLAILRAARIAGTNVLQLMNSNTAVAL
NYGIFRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQ
LSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLY
KEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFV
EPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSIN
TDESAALGAVYQAAFISPGFKVKTFVVKDANLVPIAVDFFRFKTMENKEV
PHFTSRVIFDFMNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVE
VKNLTEVHSGYLESSEKHVTEFKGVKAHFGLDAGGIVSLNYIEALFERQW
NSNDKNEASTLEKIGNTISNLFGSSTEEKSDKKDDSNTVTNETVAANDTQ
SINKTASNATGDSVNKTQTSEPQNRIETLHQNLNFITVYKASSLPSEEVI
EMSRKKIIQLKQIDEEKAALEKAQNELESYVFLVKSQFDKEIYTRCSTET
ERKLAIDAAQALGEWYEEQGPATPKEDYITRYNELRKLMGDIDFRVREYN
LRPEAISRLNSVLNSSNGFLENIKNLTGEGKIFTQAESDSLSKLIVDTTK
WFEAANKTFNSMQLNINPKITISDFEPHGRALEREIGYLLNKISIWKSQP
PPPTQSPPTDNQTSKEETKESSEKKDNQSKSESAKDAGKKDEPKPSLPDE
NDTTKFQETPRKDEHVDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR019651Glutamate_DH_NAD-spec
IPR013126Hsp_70_fam
IPR029048HSP70_C_sf
IPR029047HSP70_peptide-bd_sf
IPR018181Heat_shock_70_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 656..683
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 161..181
score: 35.97
coord: 53..65
score: 42.29
coord: 399..419
score: 44.39
coord: 367..383
score: 59.67
coord: 522..538
score: 30.11
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 208..396
e-value: 4.6E-114
score: 382.9
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 263..348
e-value: 4.6E-114
score: 382.9
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 28..414
e-value: 4.6E-114
score: 382.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 848..918
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 863..918
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 599..621
NoneNo IPR availablePANTHERPTHR45639FAMILY NOT NAMEDcoord: 10..891
NoneNo IPR availablePANTHERPTHR45639:SF3HYPOXIA UP-REGULATED PROTEIN 1coord: 10..891
NoneNo IPR availableCDDcd10230HYOU1-like_NBDcoord: 27..414
e-value: 1.05886E-172
score: 504.406
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.69
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 421..594
e-value: 2.0E-15
score: 59.0
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 646..757
e-value: 1.4E-11
score: 46.1
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 673..750
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 29..632
e-value: 4.4E-81
score: 272.9
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 219..232
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 28..205
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 215..415