Innexin

Overview
NameInnexin
Smed IDSMED30033079
Length (bp)1844
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30033079) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30033079) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30033079) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30033079) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033079SMESG000045304.1 SmedASXL_001501SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30033079SMESG000045304.1 SmedASXL_004529SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30033079SMESG000045304.1 dd_Smed_v4_11502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033079SMESG000045304.1 dd_Smed_v4_11502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033079SMESG000045304.1 dd_Smed_v4_11502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30033079SMESG000045304.1 dd_Smed_v4_11502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033079SMESG000045304.1 dd_Smed_v4_11502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033079SMESG000045304.1 dd_Smed_v6_11502_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30033079SMESG000045304.1 dd_Smed_v6_13303_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30033079SMESG000045304.1 dd_Smed_v4_11502_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30033079SMESG000045304.1 dd_Smed_v4_13303_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 272.707 bits (696), Expect = 1.048e-85
Identity = 148/394 (37.56%), Postives = 227/394 (57.61%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKI-NRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNH-KSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCI-LRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWY 1550
            DDDFVD+LNY +T  I+F F  +VS +QY+G PIQCW+P +FT  WE+Y ENYCW+ NTY+  +   FP +  +R+ R I YYQW P  +AL+AL FY+PC++WRGL H  SG NV+ L QMA           +       +  A  + +  ++ + + ++R+V       SG                                C  +R  NY+  LY+ +K LYL N+++Q++++  F+G    FYG  +L DL+ G+ W  SG+FPRVT CD E + LG  + +T+QCVL +NMF EKIF+FLWFW+ ++  ++ +S+  W        + +KFIRK LR + +   TD  + ++FV ++L  D VF +++I ++ G+I+ T+L   LW+
Sbjct:   18 DDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMAC----------DARMMDADARAATVQTIAGHMEDALEIQREVTD----VSG-------------------------------MCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 272.707 bits (696), Expect = 1.048e-85
Identity = 148/394 (37.56%), Postives = 227/394 (57.61%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKI-NRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNH-KSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCI-LRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWY 1550
            DDDFVD+LNY +T  I+F F  +VS +QY+G PIQCW+P +FT  WE+Y ENYCW+ NTY+  +   FP +  +R+ R I YYQW P  +AL+AL FY+PC++WRGL H  SG NV+ L QMA           +       +  A  + +  ++ + + ++R+V       SG                                C  +R  NY+  LY+ +K LYL N+++Q++++  F+G    FYG  +L DL+ G+ W  SG+FPRVT CD E + LG  + +T+QCVL +NMF EKIF+FLWFW+ ++  ++ +S+  W        + +KFIRK LR + +   TD  + ++FV ++L  D VF +++I ++ G+I+ T+L   LW+
Sbjct:   18 DDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMAC----------DARMMDADARAATVQTIAGHMEDALEIQREVTD----VSG-------------------------------MCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 273.863 bits (699), Expect = 1.950e-85
Identity = 156/432 (36.11%), Postives = 241/432 (55.79%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKI-NRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNH-KSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCI-LRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEM-KSPRNLIGN 1661
            DDDFVD+LNY +T  I+F F  +VS +QY+G PIQCW+P +FT  WE+Y ENYCW+ NTY+  +   FP +  +R+ R I YYQW P  +AL+AL FY+PC++WRGL H  SG NV+ L QMA           +       +  A  + +  ++ + + ++R+V     +                                   C  +R  NY+  LY+ +K LYL N+++Q++++  F+G    FYG  +L DL+ G+ W  SG+FPRVT CD E + LG  + +T+QCVL +NMF EKIF+FLWFW+ ++  ++ +S+  W        + +KFIRK LR + +   TD  + ++FV ++L  D VF +++I ++ G+I+ T+L   LW+       N  D ++ + I M   FE  + +SP  L  N
Sbjct:   18 DDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMAC----------DARMMDADARAATVQTIAGHMEDALEIQREVTDVSGM-----------------------------------CVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLA--TDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH-------NFNDRVRKSPIEM---FEGGVTQSPSKLDAN 392          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 265.003 bits (676), Expect = 1.296e-82
Identity = 152/405 (37.53%), Postives = 220/405 (54.32%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHK-INRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDI 1589
            DDD +D+LNY +T  I+ +F  LVS +QY+G PIQCW+P  FT   E+Y ENYCW+ NTYF  +    PH    R+ R IGYYQW P  +AL+AL+FY+P ++WR L+ +SG +V+ L+QMA     + L           S N A + +   +              L   H    G    LL  I                  C R +G  +  LYI+VK LY +NI+ Q++++  F+G    +YGL++L DL+ G+ W  SGHFPRVT CD E K LG  + +T+QCVL +NMF EKIF+FLWFW+ LL      S+  W    +   R++ F+ K L      K  D  + R+FV  +L+ D VF+L+++ ++ GE+   +L   LW  Y   +  +  D+
Sbjct:   20 DDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLE----------SRNRALQTIATNVEEA-----------LHVKHQVMSGNRLKLLNLII-----------------CTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 386          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 255.373 bits (651), Expect = 5.267e-79
Identity = 144/394 (36.55%), Postives = 221/394 (56.09%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPH-KINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASR---QFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELW 1547
            DDD +DRLNY +T ++L +F   +S +QY+G+PIQCWIP +FT  WE+Y+ENYC++ NTYF +     P  +I+R+   IGYYQW P  + LQA++FYLP L WR +N  SG  +++++  A     +             + N A +  G ++   +    ++SR   K   +   G                                G+YL  LY+ VKFLYL+ I+ Q  I+  F+G SY+F+GL +L D++ G+ W  SGHFPRVT CD E + LG  + +T+QCVL +NMF EK+++FLWFW V++G+  FL++++W+R+++    R   I+  L+I     D +    +   +FV   LK D VFI  LI +N G +   D+  ++W
Sbjct:   16 DDDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDREGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRV----------DEKARNEAAKSTGAHLYESL---TLQSR-FAKYTSAFTYG--------------------------------GSYLTYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNKHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMW 363          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 58.9214 bits (141), Expect = 5.453e-9
Identity = 40/116 (34.48%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  381 DDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIR------------GQFPHKINRKE-RMIGYYQWAPIFMALQALMFYLPCLIWR 689
            D+ V R++Y+ T +IL  F  LV+ RQYIG PI C I  E   G     + YCWI +T+    R            G   H     E +   YYQW    +  QA++FY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          

HSP 2 Score: 53.9138 bits (128), Expect = 2.559e-7
Identity = 35/125 (28.00%), Postives = 67/125 (53.60%), Query Frame = 3
Query: 1173 FPRVTFCDLEA-KKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTEL 1544
            FP+VT C        G    +   CVLP+N+  EKI++FLWFW ++L I++ +S++     +   K R   +R + R++   ++ +L A++  +  +      F+L  +G NI  +I  ++ ++L
Sbjct:  232 FPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAES-EEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 58.9214 bits (141), Expect = 5.453e-9
Identity = 40/116 (34.48%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  381 DDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIR------------GQFPHKINRKE-RMIGYYQWAPIFMALQALMFYLPCLIWR 689
            D+ V R++Y+ T +IL  F  LV+ RQYIG PI C I  E   G     + YCWI +T+    R            G   H     E +   YYQW    +  QA++FY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          

HSP 2 Score: 53.9138 bits (128), Expect = 2.559e-7
Identity = 35/125 (28.00%), Postives = 67/125 (53.60%), Query Frame = 3
Query: 1173 FPRVTFCDLEA-KKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTEL 1544
            FP+VT C        G    +   CVLP+N+  EKI++FLWFW ++L I++ +S++     +   K R   +R + R++   ++ +L A++  +  +      F+L  +G NI  +I  ++ ++L
Sbjct:  232 FPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAES-EEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 58.9214 bits (141), Expect = 5.453e-9
Identity = 40/116 (34.48%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  381 DDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIR------------GQFPHKINRKE-RMIGYYQWAPIFMALQALMFYLPCLIWR 689
            D+ V R++Y+ T +IL  F  LV+ RQYIG PI C I  E   G     + YCWI +T+    R            G   H     E +   YYQW    +  QA++FY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          

HSP 2 Score: 53.9138 bits (128), Expect = 2.559e-7
Identity = 35/125 (28.00%), Postives = 67/125 (53.60%), Query Frame = 3
Query: 1173 FPRVTFCDLEA-KKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTEL 1544
            FP+VT C        G    +   CVLP+N+  EKI++FLWFW ++L I++ +S++     +   K R   +R + R++   ++ +L A++  +  +      F+L  +G NI  +I  ++ ++L
Sbjct:  232 FPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAES-EEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 58.9214 bits (141), Expect = 5.453e-9
Identity = 40/116 (34.48%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  381 DDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIR------------GQFPHKINRKE-RMIGYYQWAPIFMALQALMFYLPCLIWR 689
            D+ V R++Y+ T +IL  F  LV+ RQYIG PI C I  E   G     + YCWI +T+    R            G   H     E +   YYQW    +  QA++FY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          

HSP 2 Score: 53.9138 bits (128), Expect = 2.559e-7
Identity = 35/125 (28.00%), Postives = 67/125 (53.60%), Query Frame = 3
Query: 1173 FPRVTFCDLEA-KKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTEL 1544
            FP+VT C        G    +   CVLP+N+  EKI++FLWFW ++L I++ +S++     +   K R   +R + R++   ++ +L A++  +  +      F+L  +G NI  +I  ++ ++L
Sbjct:  232 FPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAES-EEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx3 (gene:FBgn0265274 transcript:FBtr0085350)

HSP 1 Score: 58.5362 bits (140), Expect = 9.261e-9
Identity = 39/123 (31.71%), Postives = 54/123 (43.90%), Query Frame = 3
Query:  381 DDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQC----WIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKIN-------------RKERMIGYYQWAPIFMALQALMFYLPCLIWRGLN 698
            D+ V R +Y+ T  ILF    +V+    IG PI C     IP             +CWI  TY  TI GQ   +I              +++R   YYQW P  +  Q LMFY+P  +W+ + 
Sbjct:   26 DNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIPMHVI-------NTFCWITYTY--TIPGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNME 139          
BLAST of Innexin vs. Ensembl Zebrafish
Match: panx3 (pannexin 3 [Source:ZFIN;Acc:ZDB-GENE-091204-114])

HSP 1 Score: 50.0618 bits (118), Expect = 5.889e-6
Identity = 35/112 (31.25%), Postives = 51/112 (45.54%), Query Frame = 3
Query:  396 RLNYQFTGVILFLFIGL----VSI----RQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKS 707
             L+     VI F+ +GL    VS+       IG  I C+ P  FT     Y + YCW +      +  +F    N +ER +  ++  P  + + A+M YLP LIWR L   S
Sbjct:   30 ELDLPLDKVIKFISVGLPLLLVSMAFAREISIGPQISCFPPNNFTVKQAAYVDTYCWDS-----LMHHEFDTDGNIEERSLWVHKMFPYSLLVMAMMMYLPALIWRYLAVPS 136          
BLAST of Innexin vs. Ensembl Zebrafish
Match: panx3 (pannexin 3 [Source:ZFIN;Acc:ZDB-GENE-091204-114])

HSP 1 Score: 50.0618 bits (118), Expect = 5.889e-6
Identity = 35/112 (31.25%), Postives = 51/112 (45.54%), Query Frame = 3
Query:  396 RLNYQFTGVILFLFIGL----VSI----RQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKS 707
             L+     VI F+ +GL    VS+       IG  I C+ P  FT     Y + YCW +      +  +F    N +ER +  ++  P  + + A+M YLP LIWR L   S
Sbjct:   30 ELDLPLDKVIKFISVGLPLLLVSMAFAREISIGPQISCFPPNNFTVKQAAYVDTYCWDS-----LMHHEFDTDGNIEERSLWVHKMFPYSLLVMAMMMYLPALIWRYLAVPS 136          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.649e-81
Identity = 152/405 (37.53%), Postives = 220/405 (54.32%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHK-INRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDI 1589
            DDD +D+LNY +T  I+ +F  LVS +QY+G PIQCW+P  FT   E+Y ENYCW+ NTYF  +    PH    R+ R IGYYQW P  +AL+AL+FY+P ++WR L+ +SG +V+ L+QMA     + L           S N A + +   +              L   H    G    LL  I                  C R +G  +  LYI+VK LY +NI+ Q++++  F+G    +YGL++L DL+ G+ W  SGHFPRVT CD E K LG  + +T+QCVL +NMF EKIF+FLWFW+ LL      S+  W    +   R++ F+ K L      K  D  + R+FV  +L+ D VF+L+++ ++ GE+   +L   LW  Y   +  +  D+
Sbjct:   20 DDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLE----------SRNRALQTIATNVEEA-----------LHVKHQVMSGNRLKLLNLII-----------------CTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 386          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 6.451e-77
Identity = 150/398 (37.69%), Postives = 223/398 (56.03%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKI-NRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNH-KSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKD------TDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELW 1547
            DDDFVD+LNY +T  IL  F  LVS +QY+G PIQCW+P  FT   E+Y ENYCW+ NTY+  ++   P +I +R+ R IGYYQW P  +A++AL+FY+PC++WRGL +  SG N++ L+QMA  D  ++ S                  M R++ +     +V+   + + GHS     N  L                    + CGR  G Y+  LYI +K LY  N+++Q +++   +G++   YG  LL DL+    W  +G FPRVT CD E + LG  + +T+QCVL +NMF EKIF+FLWFW +  GI+   + + W   +    + + F+RK LR   VL D       D    R+F   +L+ D VF+L++I ++ GE++ ++L   LW
Sbjct:  138 DDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMA-CDARLMDSEIKTR---------TVYTMARHMQD-----EVQLTNIDRQGHSRSCFSNLQL-------------------GANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLR---VLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW 498          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.199e-61
Identity = 117/405 (28.89%), Postives = 205/405 (50.62%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKI-NRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASR--------------QFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELW 1547
            DD   DRLNY ++ +I+      ++ RQY+G P+QCW+P +FT+ WE+YAE+YC++ NTY+     + P  +  R  + + YYQWAP  MA++A  FYLP + W  L+ KSG N+ +L++ A             E             + R+ISN + +R               + E E+                    +   G ++G Y+ ++Y+  K +Y+ N  +Q Y    F+G +  ++G+R+L D++KG  W +SG+FPR+  CD + + LG    Y++QCVL +NMF EKIF+FL+ W +L+  +     +     + S  + ++F+++ L      ++ +                   +F L    PD++ +LK+I ++ G+I+ T++   +W
Sbjct:   16 DDLGTDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQLIYYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQK----------AEGAESEERKKQIDIICRHISNNLRKR---------------RNEEET--------------TKMAKIQRIFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLGNLQRYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMW 381          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q22549|INX10_CAEEL (Innexin-10 OS=Caenorhabditis elegans OX=6239 GN=inx-10 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 9.066e-58
Identity = 132/399 (33.08%), Postives = 203/399 (50.88%), Query Frame = 3
Query:  378 DDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFP--HKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSN--AACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGAS-YSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQ----FVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELW 1547
            D DFVDRL+  FT  +L     LVS +Q+ GKP++C +P  F+  WE+YAENYCW ++TY+              +++R I YYQW P F+ L+A  F LP L+W+ L   SG  +  ++++ SSDPN I  +         + +   A RF  R     + ++Q+R    L              LF +                      +  ++ ++Y+  KF YL N+ +QL  M  F+    Y +YG+  L+DL+ G  W  SG FPRV+ CD + + +G    +T+QCVL +N+F EKIFI LWFW++ L +  F S   W    L     ++FI + L +S +  D+    +++    F+  YLK D VF+++++    G I  TDL  ELW
Sbjct:   18 DRDFVDRLHSYFTCNLLIGLAVLVSFKQFGGKPVECLVPDIFSSSWEQYAENYCWASDTYYVPTNEPVAGLQSDEKRQRKISYYQWVPFFLLLEAACFRLPSLLWKYLAGHSGIKINEIVKL-SSDPNNIKPDIKRANIKSLTVHLQGALRFHRR-----LQKKQIRPHRFL-------------WLFNLPY--------------------SAFFVTAMYLCTKFFYLANVCLQLMFMNRFLETDKYKWYGMGALVDLLNGTTWEQSGMFPRVSLCDFDVRVMGNMQEHTIQCVLVINIFNEKIFILLWFWYLALLVFTFGSFFYWLLVSLWRHLNVRFIIRHLEMSDIAFDSSEDGAQEKVNRFISNYLKSDGVFVIRMMTLQSGVIFGTDLVQELW 377          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 8.908e-57
Identity = 138/462 (29.87%), Postives = 214/462 (46.32%), Query Frame = 3
Query:  291 IQLITRWMDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKI-NRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLR--ISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIY----RHKR-LNECDDIKNTTIMMRSSFESEMKSPRNL 1652
            +  I RW+  TF  K               DD VDRL+Y  T  +L  F  +VS +QY+G  IQCW+P EF  GWE+YAE+YC+I NT+F   R + P  + +R++  IGYYQW PI +A+QA MFYLP  IW  L  + G +           P++I        +   +       +  +I + +  R     G       C +                             G+  G+    LYI +K +YL N+ +Q  I+  F+G     +G     DL  G+ W +SG FPRVT CD   +KL   + YT+QCVL +NMF EKI++F+WFW V + I  F++ L    ++     R  +IR  L   ++    +  + AS  F    LK D V +++ I  + G ++  ++  EL+  +    +H R  +     K+T+  +       + +P  +
Sbjct:    4 VPFIDRWLSETFKPKTF-------------DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDF----------PSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRF----YCYR----------------------------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIAS--FANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHHGHSTKSTSPGLEEGHHEHLYTPEKM 408          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N1 (Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 2.692e-149
Identity = 245/464 (52.80%), Postives = 327/464 (70.47%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQV--RSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEMKSPRNLIGNNTLSNNTVDKSS 1697
            MDATF W+L KLGR+GS++LR+DDDFVDRLNYQFTG++LF+FIGL+ IRQY+GKPIQCWIPQEFTRGWEEY ENYCW++NTYFA+I+ + P K  R E+MIGYYQWAPI + LQ+L+FY+PCLIWR ++ +SGFNVRR++Q+AS        + NC   P      +  F+ R++  C+ R ++    +  ++S  + K+ +    L  +                 C G+  GN+L  LYI++KFLYLINII QLY+ME FIG  Y+FYG+R+L DL++G  W++SG+FPRVTFCDLEAKKLGKN+LY+LQCVLPMNMFLEKI+IFLWFWHV++GI    S+ SW R+I S   RIK IR  LR+  +L DTD   SR+F   YL+ D  F+++LI  NIG+++  DL  E+W IYRHKR+ E +++K T++ + S   S       L+ NNT + N  DK+ 
Sbjct:   39 MDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDTRNEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVAS--------DANCSLIP-EQLQKSISFIARHMDTCLYRHRICYEHKHFMRS--NGKRSKFSRCLAKLRCI-------------CCLGKLQGNFLTVLYISIKFLYLINIIGQLYLMEKFIGTKYTFYGIRVLWDLMRGHEWHHSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLCSLFSWIRRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPS-------LMLNNTSNLNDYDKNG 471          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GCN3 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 2.566e-147
Identity = 241/432 (55.79%), Postives = 304/432 (70.37%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATI-RGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGL-LKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTT 1601
            MDATF+WKL KLGR+GSS+LR+DDDF DRLNYQFTGVILFLFIGL+ IRQY+GKPIQCWIPQEFTRGWEEYAENYCW+ANTY+A++     P +  R++RMI YYQWAPI +A+QALMFYLPCLIWR   + SGFNVR+++QMA+ D N+++           + N   RFM RY+  CI R++   RG+ ++  H   K                           CCG+R GN+L+ LY  +K LYL+N+  QLYIME F+G +Y+F+G ++L DL  G  WY S +FPRVTFCDL+AKKLG N  YTLQCVLP+NMFLEKI++FLWFWHVL+ I+   S ++W  ++   +RR+ F+RK L+I  VLKDTD + SR+FV  YL+ D VFI +LI  N G+I+  DL  ELW IYRHKRL E DD K  T
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVPEEHLPAEHLRRKRMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNVRKILQMAT-DANVVIPE---------ALNKNIRFMARYMEGCIYRQREYRRGVGVRVKHCLAKCSC-----------------------LCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFVGTTYTFFGFQVLRDLFNGIQWYQSSNFPRVTFCDLQAKKLGVNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLGSFVNWFFRMAFARRRLIFVRKYLKIMNVLKDTDKTTSRKFVENYLRIDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTKLET 399          
BLAST of Innexin vs. TrEMBL
Match: A0A267EEW5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 5.633e-145
Identity = 240/428 (56.07%), Postives = 304/428 (71.03%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRG-QFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIK 1592
            MDATF+WKL KLGR+GSS+LR+DDDF DRLNYQFTGVILFLFIGL+ IRQY+GKPIQCWIPQEFTRGWEEYAENYCW+ANTY+A+++    P +  R E MI YYQWAPI +A+QALMFYLPCLIWR   + SGFN+R+++QMA+ D N+++           + N   RFM RY+  CI R++   RG+   G   K   ++                       CCG+R GN+L+ LY  +K LYL+N+  QLYIME FIG +Y+F+G R+L+D++ G  WY S +FPRVTFCDL+AKK G+N  YTLQCVLP+NMFLEKI++FLWFWHVL+ I+   S ++W  ++   +RR+ FIRK L+I  VLKDTD + SR+FV  YL+ D VFI +LI  N G+I+  DL  ELW IYRHKRL E DD K
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVQADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMAT-DANVVIPE---------ALNKNVRFMARYMEGCIYRQREYRRGV---GVRLKHCLSKCS-------------------CLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTK 396          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N0 (Innexin OS=Dugesia japonica OX=6161 GN=inx4 PE=2 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 1.086e-143
Identity = 237/442 (53.62%), Postives = 314/442 (71.04%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQV-RSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEM 1634
            MDATFV KL KLGRLGSS LRYDDDF+DRLNYQ TG++LFLFIG++ IRQY+GKPIQCW PQEFTRGWEEYAENYCW++NTY+A++  + P K NRK+ MIGYYQWA IF+ +QALMFY+PC++WRGL ++S FN+RR+IQM++S  +II+     E     SSN + +F+ +Y+ +CI RR + R +   K  ++ K G   S  +                   CC  ++GN L  LY+ +K LY++N I Q+Y+ME+FIG  Y+FYG+ +L DL++G HW +SGHFPRVTFCD +AKKLGKN+LYTLQCVLP+NM LEK+FI LWFW VLL IIN  S ++W+ ++L  + R++FIRK L I G L  +D   SR FV  YL  DVVFI++LI +N  E + + L  ELW IYRH+R  E +D+K     +  S +S++
Sbjct:    1 MDATFVRKLAKLGRLGSSHLRYDDDFIDRLNYQITGILLFLFIGIIGIRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYASVSNRLPDKPNRKDLMIGYYQWAWIFLGVQALMFYIPCILWRGLYNQSRFNIRRIIQMSASATDIIMPL--SEKNGNASSNTSIKFIAKYLDSCIRRRHLGRCKPDKKLNNNIKPGHQVSTSW-------------------CCSHKSGNCLTILYLLIKLLYILNAISQVYLMEIFIGTKYTFYGVYVLKDLLRGLHWADSGHFPRVTFCDFQAKKLGKNHLYTLQCVLPINMILEKVFIILWFWIVLLFIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGTLVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHASLSPSQKSKL 421          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GJJ5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 5.807e-143
Identity = 233/428 (54.44%), Postives = 297/428 (69.39%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRG-QFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIK 1592
            MDATF+WKL KLGR+GSSR R DDDF DRLNYQF+GVILFLFIGL+ IRQY+GKPIQCWIPQEFTRGWEEYAENYCW+ANTY+A++     P + +R    I YYQWAPI +A+QALMFY+PCLIWR   + SGFNVRRL+QMA+ D N+++           + N   RFM RY+  CI R++   RGL      C    +                        CCG+R+GN+L+ LY  VK LYL+N   QLY+ME F+G +++F+G R+L+D+++G HWY S +FPRVTFCDL+A+K+G N  YTLQCVLP+NMFLEKI++FLWFW  L+ +I   S +SW  ++   +RR  F+RK L+I   LKDTD   SR+FV  YL+ D VFIL+L+ +N G+I+  DL  ELW IYRHKRL E +D K
Sbjct:   91 MDATFMWKLSKLGRIGSSRQRVDDDFADRLNYQFSGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASLEADHLPEEQSRSRLTITYYQWAPIVLAVQALMFYIPCLIWRLFMNYSGFNVRRLLQMAA-DANVVIPE---------ALNKNVRFMARYMEGCIYRQREYKRGLGVRVRRCLSACSCI----------------------CCGKRHGNFLVVLYFFVKLLYLLNAFGQLYLMEKFVGTTHTFFGFRVLLDILQGVHWYRSSNFPRVTFCDLQARKIGVNYRYTLQCVLPLNMFLEKIYVFLWFWVALVSVITMSSFVSWFCRMAFARRRTGFVRKYLKIMNALKDTDRLTSRKFVENYLRVDGVFILRLVSANCGDIVAGDLACELWSIYRHKRLQELEDTK 486          

HSP 2 Score: 70.0922 bits (170), Expect = 7.543e-9
Identity = 31/81 (38.27%), Postives = 54/81 (66.67%), Query Frame = 3
Query: 1248 LPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILK 1490
            LP+N F+EK+++FLWFW+++LG++  LS + W  +IL    R+ +I++ LR   ++ +T+    ++FV   L PD  FIL+
Sbjct:    7 LPINHFVEKVYVFLWFWYIILGVLTLLSTIIWMLRILIPGGRVAYIKQYLRAMKLISNTEDRDCKRFVANSLGPDGGFILQ 87          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000045304.1 (SMESG000045304.1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 461/464 (99.35%), Postives = 463/464 (99.78%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEMKSPRNLIGNNTLSNNTVDKSSMI 1703
            MDATFVWKLGKLGRLGS+RLRYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPISNSCCSRCCAN GCFESCCGRRNGNYLISLYITVKFLYLINIIIQLYIMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGI+NFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEMKSPRNLIGNNTLSNNTVDKSSMI
Sbjct:    1 MDATFVWKLGKLGRLGSNRLRYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPISNSCCSRCCANHGCFESCCGRRNGNYLISLYITVKFLYLINIIIQLYIMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIVNFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEMKSPRNLIGNNTLSNNTVDKSSMI 464          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000060499.1 (SMESG000060499.1)

HSP 1 Score: 442.195 bits (1136), Expect = 6.666e-150
Identity = 241/459 (52.51%), Postives = 318/459 (69.28%), Query Frame = 3
Query:  321 TFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEMKSPRNLIGNNTLSNNTVDKSS 1697
            TF W+L KLGR+GS++LR+DDDFVDRLNYQFTG++LF+FIGL+ IRQY+GKPIQCWIPQEFTRGWEEY ENYCW++NTYFA+I+ + P K  RKE+MIGYYQWAPI + LQ+L+FY+PCLIWR ++ +SGFNVRR++Q+AS        + NC   P      +  F+ R++  C+ R ++      +  H  +     S +                    C G+  GN+L  LYI++K LYLINII QLY+ME FIG  Y+FYG+R+L DL++G  W+ SG+FPRVTFCDLEAKKLGKN+LY+LQCVLPMNMFLEKI+IFLWFWHV++GI    S+ SW ++I S   RIK IR  LR+  +L DTD   SR+F   YL+ D  F+++LI  NIG+++  DL  E+W IYRHKR+ E +++K T++ + S   S       L+ NNT + N  DKS 
Sbjct:   42 TFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVAS--------DANCSLIP-EQLQKSISFIARHMDTCLYRHRI----CYEHKHFMRTNGKRSTISRCLAKLRCI---------CCLGKLQGNFLTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPS-------LMLNNTSNLNDYDKSG 471          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000059204.1 (SMESG000059204.1)

HSP 1 Score: 438.728 bits (1127), Expect = 2.615e-149
Identity = 234/428 (54.67%), Postives = 305/428 (71.26%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQV-RSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIK 1592
            MDATFVWKL KLGRLGSS LRYDDDF+DRLNYQ TG++LFLFIG++ IRQY+GKPIQCW PQEFTRGWEEYAENYCW++NTY++++  + P K +R+  MIGYYQWA IF+ +QAL+FYLPC+IWRGL ++S FN+RR+IQM++S  +II+     E     SSN + +F+ +Y+ +CI RR + R +   K  ++ K G   S  +                   CC  ++GN L  LY+ +K LY++N I Q+Y+ME FIG     YG+ +LIDL+KG+HW  SGHFPRVTFCD +AKKLGKN++YTLQCVLP+NM LEKIFI LWFW VLL IIN  S ++W+ ++L  + R++FIRK L I G L  +D   SR FV  YL  DVVFI++LI +N  E + + L  ELW IYRH+R  E +D+K
Sbjct:    1 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTGILLFLFIGIIGIRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPL--SEKSGNSSSNTSIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPW-------------------CCSHKSGNCLSILYLFIKLLYILNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKIFIILWFWIVLLAIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMK 407          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048374.1 (SMESG000048374.1)

HSP 1 Score: 379.407 bits (973), Expect = 3.842e-126
Identity = 207/436 (47.48%), Postives = 292/436 (66.97%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSS 1619
            MDAT VWK+ KLGR+GSS LR+DDD+VDRLNYQ T  + FLFIG++ +R YIGKPIQCW PQEF + WE+Y+EN+CW++NT++A I    P ++++  ++IGYYQW PI +A+QALMFY+PCLIWR L + SGFNVRR+IQMA  D N ++ + N +           +F+ RYI  CI R              CK+ +       +     +           CC   +G +L  LY  VK LY+IN+++Q+Y+M+ F+G   +F+G+++L+DLI G  W +SG+FPRVTFC+++ KKLG+NN+Y LQCVLP+NMFLEKI+IFLWF++V+LGII   S  SW  ++  +K R KFIRK L+I   +++TD +A+ +F    L+PD VFI+ L+  N+G I+  DLT ELW IYRHK   + D+++   +  R S
Sbjct:    1 MDATLVWKIAKLGRVGSSHLRFDDDWVDRLNYQITCFLHFLFIGVLGLRSYIGKPIQCWAPQEFNKAWEDYSENFCWVSNTFYAPINNNLPLRMDKTSKLIGYYQWTPIVLAVQALMFYIPCLIWRLLMNYSGFNVRRIIQMAG-DTNSLVPDINSK---------NIKFIARYIDTCIDRNY----------RDCKRNQ-----ISVDGKQLNYRKKCNCFSRHCCHTNHGRFLFFLYGIVKVLYVINVLLQMYLMKRFLGTDSNFFGVKVLVDLINGFEWNHSGNFPRVTFCEVQTKKLGENNIYNLQCVLPLNMFLEKIYIFLWFYYVILGIITTASFCSWLLRMGYVKSRWKFIRKYLKILNAMRETDNTATLKFTENNLRPDGVFIIYLVTINVGHIVAGDLTVELWNIYRHKSWQDNDNVRYLDMDCRRS 411          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048827.1 (SMESG000048827.1)

HSP 1 Score: 370.163 bits (949), Expect = 3.708e-122
Identity = 207/427 (48.48%), Postives = 276/427 (64.64%), Query Frame = 3
Query:  312 MDATFVWXXXXXXXXXXXXXXYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLK-------SGHSCKKGEN--ESLLFPIXXXXXXXXXXXXXXFESCCGRRNGNYLISLYITVKFXXXXXXXXXXXXMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHK 1565
            +D  F+W   KLGR GS  LR DDD  DRLNY+ + +++F FI L+ +RQY+GKPIQCWIPQEFTRGWEEY+ENYCWIA+TYFA +  + P K++R++R+IGYYQWAPI +ALQ  +FY+P LIW+  +  S +N+ +LI +     +               ++    F  RYI  CI R++   R   +          SC K +N   SL F I                   GR  GN+L+SLY  VK LY+ N+I QLY+ME   G+S SF+G+R+LIDLI+G  W  SG+FPRVTFCD+E KKLGKN LYT+QCVLPMN+FLEKI++FLWFWHV+L II   S+  W  +I +LKRR+K IRK L+    + DTD S +R+FV +YL+ D VF++ ++  + GEI+   +  ELW IYRHK
Sbjct:   35 LDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLD-------------TEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSFSCTKPKNCVVSLHFHI-------------------GRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHK 429          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-11.048e-8537.56Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.048e-8537.56Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.950e-8536.11Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-91.296e-8237.53Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-135.267e-7936.55Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx25.453e-934.48gene:FBgn0027108 transcript:FBtr0301860[more]
Inx25.453e-934.48gene:FBgn0027108 transcript:FBtr0071005[more]
Inx25.453e-934.48gene:FBgn0027108 transcript:FBtr0332314[more]
Inx25.453e-934.48gene:FBgn0027108 transcript:FBtr0071006[more]
Inx39.261e-931.71gene:FBgn0265274 transcript:FBtr0085350[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
panx35.889e-631.25pannexin 3 [Source:ZFIN;Acc:ZDB-GENE-091204-114][more]
panx35.889e-631.25pannexin 3 [Source:ZFIN;Acc:ZDB-GENE-091204-114][more]
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.649e-8137.53Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL6.451e-7737.69Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q27295|EAT5_CAEEL1.199e-6128.89Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q22549|INX10_CAEEL9.066e-5833.08Innexin-10 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q19746|INX3_CAEEL8.908e-5729.87Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6N12.692e-14952.80Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 S... [more]
A0A1I8GCN32.566e-14755.79Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A267EEW55.633e-14556.07Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
Q2L6N01.086e-14353.62Innexin OS=Dugesia japonica OX=6161 GN=inx4 PE=2 S... [more]
A0A1I8GJJ55.807e-14354.44Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045304.10.000e+099.35SMESG000045304.1[more]
SMESG000060499.16.666e-15052.51SMESG000060499.1[more]
SMESG000059204.12.615e-14954.67SMESG000059204.1[more]
SMESG000048374.13.842e-12647.48SMESG000048374.1[more]
SMESG000048827.13.708e-12248.48SMESG000048827.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033079 ID=SMED30033079|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1844bp
TATGAAATACATAAGTAAATCTCCAACACGATTGCCACATACTAATTGGG
TTCTGTCATCAATGTATGATCGGAAAGTTATATCTATTTTTGTAAGTTGA
CTCCGATCAGTCTATTATTCGTCCTAAGAAGTGGCCAATCTAATTACGAG
CAAAAATATTATAGTGAAAAATTAAAGCTAGAGTAATTAAGAAATATAAT
CTTGCAGAAATATTCTTCAGTCACAATAACTGTTAAAATTACTATTATAA
GAAATGGAACAATACTTGGAAATTGATTGGTAAAGATTGAATTCAGCTTA
TCACAAGGTGGATGGACGCAACATTTGTATGGAAACTGGGCAAACTTGGT
CGACTAGGATCAAGCCGTTTAAGATATGACGACGATTTTGTTGATCGGCT
CAACTATCAGTTTACGGGAGTCATTCTCTTTCTTTTCATCGGTCTCGTCA
GTATCCGACAATATATAGGCAAACCAATCCAATGTTGGATTCCTCAGGAA
TTTACTCGTGGATGGGAAGAATATGCGGAAAACTATTGCTGGATTGCCAA
CACTTATTTTGCTACAATTAGAGGCCAGTTTCCGCATAAAATAAATCGAA
AAGAAAGAATGATTGGATATTATCAATGGGCTCCAATTTTTATGGCTCTG
CAAGCTTTGATGTTTTATTTGCCGTGCTTAATTTGGCGGGGATTGAATCA
TAAATCTGGATTTAATGTTCGTAGACTCATTCAAATGGCATCGAGTGATC
CGAATATCATTTTATCTAACTTCAATTGTGAATATAAACCTGGACCCTCG
TCCAATGCAGCATGTAGATTTATGGGTCGTTACATTTCTAACTGCATTTT
ACGACGACAGGTCAGATCAAGAGGCTTGCTCAAATCTGGTCATTCTTGTA
AAAAGGGTGAAAATGAAAGTCTTCTTTTCCCGATTTCCAACTCTTGTTGT
TCTCGCTGCTGTGCTAATCGTGGATGTTTTGAATCCTGTTGTGGTAGGCG
AAATGGAAATTATCTGATATCTCTTTACATTACTGTCAAATTTCTGTATC
TAATCAACATTATCATTCAATTGTATATTATGGAACTTTTTATCGGTGCA
TCATACAGCTTTTATGGATTGAGACTGCTAATTGATTTGATCAAAGGAAA
ACACTGGTATAATTCCGGCCATTTTCCCAGAGTAACGTTTTGCGACCTTG
AAGCTAAAAAGCTTGGAAAAAATAATTTATATACTCTACAATGCGTTTTG
CCAATGAACATGTTTCTTGAGAAGATATTTATATTCTTATGGTTCTGGCA
TGTTTTGCTTGGAATCATTAACTTCTTGAGTATTCTTTCATGGTCAAGAC
AGATCCTATCGTTGAAACGACGAATAAAATTTATCAGGAAACAACTTCGT
ATAAGTGGAGTGTTAAAAGACACTGATCTCAGTGCAAGTCGACAGTTTGT
GCTTCAATATCTTAAACCTGATGTCGTATTCATTCTCAAGCTTATCGGCT
CAAATATCGGCGAAATCATTGTCACAGATTTGACCACCGAGCTATGGTAC
ATATACCGACACAAGCGGTTGAACGAGTGCGACGACATTAAGAATACGAC
AATAATGATGCGTTCTTCATTCGAATCAGAAATGAAATCTCCAAGAAATC
TCATTGGAAATAATACCCTGAGTAACAATACTGTTGACAAATCCAGTATG
ATAAATAATAACAATAACAATAACAATAGTAACAACAACAACAACAACAA
CCACGATGATATTGTATAAATACTCATTGAGATTTAGCCAAGATTTAACC
TGATATTTAAATAGATATAAATACCAAATATAGATAGAGAATGC
back to top

protein sequence of SMED30033079-orf-1

>SMED30033079-orf-1 ID=SMED30033079-orf-1|Name=SMED30033079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=486bp
MDATFVWKLGKLGRLGSSRLRYDDDFVDRLNYQFTGVILFLFIGLVSIRQ
YIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERM
IGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNII
LSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGE
NESLLFPISNSCCSRCCANRGCFESCCGRRNGNYLISLYITVKFLYLINI
IIQLYIMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKK
LGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIINFLSILSWSRQILS
LKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIG
EIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEMKSPRNLIGN
NTLSNNTVDKSSMINNNNNNNNSNNNNNNNHDDIV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 103..125
score: 54.09
coord: 311..327
score: 66.12
coord: 47..58
score: 51.67
coord: 287..296
score: 65.2
coord: 75..84
score: 55.2
IPR000990InnexinPFAMPF00876Innexincoord: 24..414
e-value: 2.2E-119
score: 398.9
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 19..435
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 19..421
score: 34.97
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 469..488
NoneNo IPR availablePANTHERPTHR11893:SF36INNEXIN-5coord: 19..435
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 235..257
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 322..344