MMS19_N domain-containing protein

Overview
NameMMS19_N domain-containing protein
Smed IDSMED30033075
Length (bp)2938
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MMS19_N domain-containing protein (SMED30033075) t-SNE clustered cells

Violin plots show distribution of expression levels for MMS19_N domain-containing protein (SMED30033075) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MMS19_N domain-containing protein (SMED30033075) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MMS19_N domain-containing protein (SMED30033075) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033075

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033075h1SMcG0001738 SmedASXL_015998SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033075h1SMcG0001738 SmedASXL_015998SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30033075h1SMcG0001738 dd_Smed_v4_7061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MMS19_N domain-containing protein vs. Ensembl Human
Match: MMS19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:HGNC Symbol;Acc:HGNC:13824])

HSP 1 Score: 68.9366 bits (167), Expect = 4.050e-11
Identity = 71/286 (24.83%), Postives = 133/286 (46.50%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGL---GQMNFEDVFNYHMSFLDCLLHQVHTIVAYIIGFHLPLVQK 870
            +++  +E+L   + + E  ++  A++ L+  L    + +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q  PQV R  +Y ++ + + +    LKS    F   F+  + GE  P  ++   RI   +I  ++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L       GQ   +D      + +     Q  TI+  ++GF L L QK
Sbjct:   45 TVLQVVEALGSSLENPEPRTRARAIQLLSQVLLHCHTLLLEKEVVH-LILFYENRLKDHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQTLNACCAVYGQKELKDFLPSLWASIRRESSQRRTILEMLLGF-LKLQQK 328          
BLAST of MMS19_N domain-containing protein vs. Ensembl Human
Match: MMS19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:HGNC Symbol;Acc:HGNC:13824])

HSP 1 Score: 65.4698 bits (158), Expect = 1.180e-10
Identity = 58/239 (24.27%), Postives = 115/239 (48.12%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + + E  ++  A++ L+  L    + +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q  PQV R  +Y ++ + + +    LKS    F   F+  + GE  P  ++   RI   +I  ++++    EELFE  + YFP++            ++L+  L +  L  +  F   LLP+L+EK  ++  S+++DSL  L
Sbjct:   45 TVLQVVEALGSSLENPEPRTRARAIQLLSQVLLHCHTLLLEKEVVH-LILFYENRLKDHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPIDF--------TPREDLILSL-RAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQTL 273          
BLAST of MMS19_N domain-containing protein vs. Ensembl Human
Match: MMS19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:HGNC Symbol;Acc:HGNC:13824])

HSP 1 Score: 65.855 bits (159), Expect = 3.445e-10
Identity = 59/239 (24.69%), Postives = 115/239 (48.12%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + + E  ++  A++ L+  L    + +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q  PQV R  +Y ++ + + +    LKS    F   F+  + GE  P  ++   RI   +I  ++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L
Sbjct:   45 TVLQVVEALGSSLENPEPRTRARAIQLLSQVLLHCHTLLLEKEVVH-LILFYENRLKDHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQTL 282          
BLAST of MMS19_N domain-containing protein vs. Ensembl Human
Match: MMS19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:HGNC Symbol;Acc:HGNC:13824])

HSP 1 Score: 65.855 bits (159), Expect = 3.445e-10
Identity = 59/239 (24.69%), Postives = 115/239 (48.12%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + + E  ++  A++ L+  L    + +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q  PQV R  +Y ++ + + +    LKS    F   F+  + GE  P  ++   RI   +I  ++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L
Sbjct:   45 TVLQVVEALGSSLENPEPRTRARAIQLLSQVLLHCHTLLLEKEVVH-LILFYENRLKDHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQTL 282          
BLAST of MMS19_N domain-containing protein vs. Ensembl Human
Match: MMS19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:HGNC Symbol;Acc:HGNC:13824])

HSP 1 Score: 52.373 bits (124), Expect = 1.608e-6
Identity = 37/135 (27.41%), Postives = 65/135 (48.15%), Query Frame = 1
Query:  169 LTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVE 567
            L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q  PQV R  +Y ++ + + +    LKS    F   F+  + GE  P  ++   RI   +I  ++++    EELFE  + YFP++
Sbjct:  130 LILFYENRLKDHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPID 264          
BLAST of MMS19_N domain-containing protein vs. Ensembl Celegans
Match: mms-19 (Yeast MMS related [Source:UniProtKB/TrEMBL;Acc:O76384])

HSP 1 Score: 58.9214 bits (141), Expect = 2.024e-8
Identity = 56/218 (25.69%), Postives = 96/218 (44.04%), Query Frame = 1
Query:   16 ERFMSIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLI-DFDNFKDMNARQIASALVK-LDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGP 663
            E+  ++ DF+ S R  + S     +++A++ +   +S  P      D ++ L  ++ N +         +  G+  LI    N  D     +   L K  +V  +  + R   YE+L   L   L+ LK     F+  F+ S+ GE  P C+V +    L +  NF +    E++FE++A YFPVE       +  +T+E L      CL+ S  F P
Sbjct:   24 EKSTTLSDFMTSKRTKMVSDFPEEREEAIEEIIEVISTFPMDFLQKDEVSLLLNYFINSIESSALTGGAVIRGVHHLILKSKNLPDNFEVSLIRVLFKEGNVQSWAQKERQLQYEILIWFLKYRLSFLKGLGPDFLATFMKSVSGERDPRCLVHMFSAFLEVSNNFTLGPFTEDMFETIACYFPVEF--KPQKTDTITREYLAASCASCLVSSPSFAP 239          
BLAST of MMS19_N domain-containing protein vs. Ensembl Fly
Match: Mms19 (gene:FBgn0037301 transcript:FBtr0078778)

HSP 1 Score: 69.3218 bits (168), Expect = 1.496e-11
Identity = 53/240 (22.08%), Postives = 111/240 (46.25%), Query Frame = 1
Query:   31 IVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEG 747
            I    E+L   ++S ++  +      L+  L  LP  +     +  L+TFY + L +H+ ++P I DGI  L+           QI  +  +    Q   +  R K++ +   L  +F + L++    F+   +NSI GE  P  +  +       +  + +  + EE+FE  A YFP++   +    + +T++ L++    CL+ +  F    + + +EK  ++   +++DS+++L + 
Sbjct:   37 ISALAEALGFALSSPDMEERVAGTNLLSAVLIALPQDLLQERQLEFLSTFYMDRLRDHHNVMPAIIDGIDALVHMKALPRAQIPQILQSFFEHTTCQSQTRSDRTKLFHIFQYLTENFQDELQAMAGDFVYGLINSIDGERDPRNLDIIFSFMPEFLSTYPLLHLAEEMFEIFACYFPIDFNPSKQDPAAITRDELSKKLTNCLVANNEFAEGTVVLAIEKLESELLVAKLDSIELLHQA 276          
BLAST of MMS19_N domain-containing protein vs. Ensembl Zebrafish
Match: mms19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:NCBI gene;Acc:563643])

HSP 1 Score: 82.0333 bits (201), Expect = 2.779e-15
Identity = 66/245 (26.94%), Postives = 119/245 (48.57%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVK-LDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQ 756
            +++  +E+L   +TSS+  ++   ++ L+  L    S +   + +  L  FYEN L +HY + P +  G+  L         +A  I  ++ + + V       R  +Y +L  L+ S    LK     FI  F+ S+ GE  P  ++   ++   II   +++ +  EELFE  + YFP++     N    +T+E L    +  L G+  F   LLP+++EK  +D +S+++DS+  LA   GQ
Sbjct:   37 TVLQLVEALGVSLTSSQPQTRGRGVQLLSQVLQECYSGLSERE-VEVLIAFYENRLKDHYVITPHVLRGLKALAKCSVLPPGSAVSILKSIFQDVHVQSLMVTERSCVYNILISLMESREEELKGLGADFIFGFVQSVDGERDPRNLLLAFQVAKNIIYRGYDLGKFVEELFEVTSCYFPIDFSPPPNDPHGITQEELILSLRAVLTGTPRFAEFLLPLIIEKMDSDVQSAKVDSMHTLA-ACGQ 279          
BLAST of MMS19_N domain-containing protein vs. Ensembl Xenopus
Match: fam189a1 (family with sequence similarity 189 member A1 [Source:Xenbase;Acc:XB-GENE-5873424])

HSP 1 Score: 73.559 bits (179), Expect = 1.459e-12
Identity = 59/238 (24.79%), Postives = 116/238 (48.74%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + + E  S+   ++ L+  L    S +   + +  L  FYEN L +H+ + P +  G++ L+    +K +    +  +L+++D        R  +Y ++ + + +    LKS    F   F+  + GE  P  ++    I   II +N+ +    EELFE  + YFP++     N    +T+E L    +  L+ ++ F    LP+L+EK  +D +S+++DSL  L
Sbjct:   37 TVLQVVEALGSCLANPEPRSRAKGMQLLSRVLLECYSRLTEKE-VEVLVLFYENRLKDHHLITPHVLKGLMALVSMLFWKCV-LHGVLVSLMQID--------RHTVYMIITNFMKTREEELKSLGADFTYGFIQVMDGEKDPRNLLVAFHIVQDIITKNYALGPFVEELFEVTSCYFPIDFTPPPNDPHGITREHLIVGLRAVLVSTSRFAEFFLPLLIEKMDSDVQSAKLDSLQTL 264          
BLAST of MMS19_N domain-containing protein vs. Ensembl Xenopus
Match: fam189a1 (family with sequence similarity 189 member A1 [Source:Xenbase;Acc:XB-GENE-5873424])

HSP 1 Score: 70.8626 bits (172), Expect = 9.296e-12
Identity = 59/239 (24.69%), Postives = 113/239 (47.28%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNF-KDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + + E  S+   ++ L+  L    S +   + +  L  FYEN L +H+ + P +  G++ L   D   + +    + S   ++ V       R  +Y ++ + + +    LKS    F   F+  + GE  P  ++    I   II +N+ +    EELFE  + YFP++     N    +T+E L    +  L+ ++ F    LP+L+EK  +D +S+++DSL  L
Sbjct:   63 TVLQVVEALGSCLANPEPRSRAKGMQLLSRVLLECYSRLTEKE-VEVLVLFYENRLKDHHLITPHVLKGLMALSMCDVLPQGLAVSVLKSVFQEVHVQSLMQIDRHTVYMIITNFMKTREEELKSLGADFTYGFIQVMDGEKDPRNLLVAFHIVQDIITKNYALGPFVEELFEVTSCYFPIDFTPPPNDPHGITREHLIVGLRAVLVSTSRFAEFFLPLLIEKMDSDVQSAKLDSLQTL 300          
BLAST of MMS19_N domain-containing protein vs. Ensembl Xenopus
Match: fam189a1 (family with sequence similarity 189 member A1 [Source:Xenbase;Acc:XB-GENE-5873424])

HSP 1 Score: 68.9366 bits (167), Expect = 4.282e-11
Identity = 52/195 (26.67%), Postives = 93/195 (47.69%), Query Frame = 1
Query:  160 INCLTTFYENILSEHYQLLPTITDGILTLIDFDNF-KDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +  L  FYEN L +H+ + P +  G++ L   D   + +    + S   ++ V       R  +Y ++ + + +    LKS    F   F+  + GE  P  ++    I   II +N+ +    EELFE  + YFP++     N    +T+E L    +  L+ ++ F    LP+L+EK  +D +S+++DSL  L
Sbjct:  131 VEVLVLFYENRLKDHHLITPHVLKGLMALSMCDVLPQGLAVSVLKSVFQEVHVQSLMQIDRHTVYMIITNFMKTREEELKSLGADFTYGFIQVMDGEKDPRNLLVAFHIVQDIITKNYALGPFVEELFEVTSCYFPIDFTPPPNDPHGITREHLIVGLRAVLVSTSRFAEFFLPLLIEKMDSDVQSAKLDSLQTL 325          
BLAST of MMS19_N domain-containing protein vs. Ensembl Xenopus
Match: fam189a1 (family with sequence similarity 189 member A1 [Source:Xenbase;Acc:XB-GENE-5873424])

HSP 1 Score: 68.5514 bits (166), Expect = 4.605e-11
Identity = 52/195 (26.67%), Postives = 93/195 (47.69%), Query Frame = 1
Query:  160 INCLTTFYENILSEHYQLLPTITDGILTLIDFDNF-KDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +  L  FYEN L +H+ + P +  G++ L   D   + +    + S   ++ V       R  +Y ++ + + +    LKS    F   F+  + GE  P  ++    I   II +N+ +    EELFE  + YFP++     N    +T+E L    +  L+ ++ F    LP+L+EK  +D +S+++DSL  L
Sbjct:  131 VEVLVLFYENRLKDHHLITPHVLKGLMALSMCDVLPQGLAVSVLKSVFQEVHVQSLMQIDRHTVYMIITNFMKTREEELKSLGADFTYGFIQVMDGEKDPRNLLVAFHIVQDIITKNYALGPFVEELFEVTSCYFPIDFTPPPNDPHGITREHLIVGLRAVLVSTSRFAEFFLPLLIEKMDSDVQSAKLDSLQTL 325          
BLAST of MMS19_N domain-containing protein vs. Ensembl Xenopus
Match: fam189a1 (family with sequence similarity 189 member A1 [Source:Xenbase;Acc:XB-GENE-5873424])

HSP 1 Score: 68.5514 bits (166), Expect = 4.669e-11
Identity = 52/192 (27.08%), Postives = 92/192 (47.92%), Query Frame = 1
Query:  169 LTTFYENILSEHYQLLPTITDGILTLIDFDNF-KDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            L  FYEN L +H+ + P +  G++ L   D   + +    + S   ++ V       R  +Y ++ + + +    LKS    F   F+  + GE  P  ++    I   II +N+ +    EELFE  + YFP++     N    +T+E L    +  L+ ++ F    LP+L+EK  +D +S+++DSL  L
Sbjct:   60 LVLFYENRLKDHHLITPHVLKGLMALSMCDVLPQGLAVSVLKSVFQEVHVQSLMQIDRHTVYMIITNFMKTREEELKSLGADFTYGFIQVMDGEKDPRNLLVAFHIVQDIITKNYALGPFVEELFEVTSCYFPIDFTPPPNDPHGITREHLIVGLRAVLVSTSRFAEFFLPLLIEKMDSDVQSAKLDSLQTL 251          
BLAST of MMS19_N domain-containing protein vs. Ensembl Mouse
Match: Mms19 (MMS19 cytosolic iron-sulfur assembly component [Source:MGI Symbol;Acc:MGI:1919449])

HSP 1 Score: 65.0846 bits (157), Expect = 3.685e-10
Identity = 76/302 (25.17%), Postives = 137/302 (45.36%), Query Frame = 1
Query:   43 IESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL---AEGLGQMNFEDVFNYHMSFLDCLLHQVHTIVAYIIGFHLPLVQKPGFR------LSSFVT*MCRL 915
            +E+L   + ++E  ++    + L+  L    S +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q   QV R  ++ ++ + + S    LK     F   F+  + GE  P  ++   RI   +I +++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L       GQ   +D      + +    +Q  TI+  I+GF L L QK  +       LSSF   +C L
Sbjct:    3 VEALGSSLENAEPRTRARGAQLLSQVLLQCHSLLSEKEVVH-LILFYENRLKDHHLVVPSVLQGLRALSMSVALPPGLAVSVLKAIFQEVHVQSLLQVDRHTVFSIITNFMRSREEELKGLGADFTFGFIQVMDGEKDPRNLLLAFRIVHDLISKDYSLGPFVEELFEVTSCYFPIDFTPPPNDPYGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTLNACCAVYGQKELKDFLPSLWASIRRESNQRRTILEMILGF-LKLQQKWSYEDRDERPLSSFKDQLCSL 302          
BLAST of MMS19_N domain-containing protein vs. Ensembl Mouse
Match: Mms19 (MMS19 cytosolic iron-sulfur assembly component [Source:MGI Symbol;Acc:MGI:1919449])

HSP 1 Score: 59.6918 bits (143), Expect = 8.041e-9
Identity = 57/239 (23.85%), Postives = 113/239 (47.28%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + ++E  ++    + L+  L    S +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q   QV R  ++ ++ + + S    LK     F   F+  + GE  P  ++   RI   +I +++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L
Sbjct:   46 TVLQVVEALGSSLENAEPRTRARGAQLLSQVLLQCHSLLSEKEVVH-LILFYENRLKDHHLVVPSVLQGLRALSMSVALPPGLAVSVLKAIFQEVHVQSLLQVDRHTVFSIITNFMRSREEELKGLGADFTFGFIQVMDGEKDPRNLLLAFRIVHDLISKDYSLGPFVEELFEVTSCYFPIDFTPPPNDPYGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTL 283          
BLAST of MMS19_N domain-containing protein vs. Ensembl Mouse
Match: Mms19 (MMS19 cytosolic iron-sulfur assembly component [Source:MGI Symbol;Acc:MGI:1919449])

HSP 1 Score: 59.6918 bits (143), Expect = 8.041e-9
Identity = 57/239 (23.85%), Postives = 113/239 (47.28%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + ++E  ++    + L+  L    S +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q   QV R  ++ ++ + + S    LK     F   F+  + GE  P  ++   RI   +I +++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L
Sbjct:   46 TVLQVVEALGSSLENAEPRTRARGAQLLSQVLLQCHSLLSEKEVVH-LILFYENRLKDHHLVVPSVLQGLRALSMSVALPPGLAVSVLKAIFQEVHVQSLLQVDRHTVFSIITNFMRSREEELKGLGADFTFGFIQVMDGEKDPRNLLLAFRIVHDLISKDYSLGPFVEELFEVTSCYFPIDFTPPPNDPYGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTL 283          
BLAST of MMS19_N domain-containing protein vs. Ensembl Mouse
Match: Mms19 (MMS19 cytosolic iron-sulfur assembly component [Source:MGI Symbol;Acc:MGI:1919449])

HSP 1 Score: 58.9214 bits (141), Expect = 3.532e-8
Identity = 57/239 (23.85%), Postives = 113/239 (47.28%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + ++E  ++    + L+  L    S +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q   QV R  ++ ++ + + S    LK     F   F+  + GE  P  ++   RI   +I +++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L
Sbjct:   46 TVLQVVEALGSSLENAEPRTRARGAQLLSQVLLQCHSLLSEKEVVH-LILFYENRLKDHHLVVPSVLQGLRALSMSVALPPGLAVSVLKAIFQEVHVQSLLQVDRHTVFSIITNFMRSREEELKGLGADFTFGFIQVMDGEKDPRNLLLAFRIVHDLISKDYSLGPFVEELFEVTSCYFPIDFTPPPNDPYGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTL 283          
BLAST of MMS19_N domain-containing protein vs. UniProt/SwissProt
Match: sp|E7FBU4|MMS19_DANRE (MMS19 nucleotide excision repair protein homolog OS=Danio rerio OX=7955 GN=mms19 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.675e-14
Identity = 68/247 (27.53%), Postives = 121/247 (48.99%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVK-LDVPQFDPQV--RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQ 756
            +++  +E+L   +TSS+  ++   ++ L+  L    S +   + +  L  FYEN L +HY + P +  G+  L         +A  I  ++ + + V Q    V  R  +Y +L  L+ S    LK     FI  F+ S+ GE  P  ++   ++   II   +++ +  EELFE  + YFP++     N    +T+E L    +  L G+  F   LLP+++EK  +D +S+++DS+  LA   GQ
Sbjct:   37 TVLQLVEALGVSLTSSQPQTRGRGVQLLSQVLQECYSGLSERE-VEVLIAFYENRLKDHYVITPHVLRGLKALAKCSVLPPGSAVSILKSIFQDVHVQQQSLMVTERSCVYNILISLMESREEELKGLGADFIFGFVQSVDGERDPRNLLLAFQVAKNIIYRGYDLGKFVEELFEVTSCYFPIDFSPPPNDPHGITQEELILSLRAVLTGTPRFAEFLLPLIIEKMDSDVQSAKVDSMHTLA-ACGQ 281          
BLAST of MMS19_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0V9L1|MMS19_XENTR (MMS19 nucleotide excision repair protein homolog OS=Xenopus tropicalis OX=8364 GN=mms19 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 4.517e-11
Identity = 59/239 (24.69%), Postives = 113/239 (47.28%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNF-KDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + + E  S+   ++ L+  L    S +   + +  L  FYEN L +H+ + P +  G++ L   D   + +    + S   ++ V       R  +Y ++ + + +    LKS    F   F+  + GE  P  ++    I   II +N+ +    EELFE  + YFP++     N    +T+E L    +  L+ ++ F    LP+L+EK  +D +S+++DSL  L
Sbjct:   37 TVLQVVEALGSCLANPEPRSRAKGMQLLSRVLLECYSRLTEKE-VEVLVLFYENRLKDHHLITPHVLKGLMALSMCDVLPQGLAVSVLKSVFQEVHVQSLMQIDRHTVYMIITNFMKTREEELKSLGADFTYGFIQVMDGEKDPRNLLVAFHIVQDIITKNYALGPFVEELFEVTSCYFPIDFTPPPNDPHGITREHLIVGLRAVLVSTSRFAEFFLPLLIEKMDSDVQSAKLDSLQTL 274          
BLAST of MMS19_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DCF2|MMS19_XENLA (MMS19 nucleotide excision repair protein homolog OS=Xenopus laevis OX=8355 GN=mms19 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.097e-9
Identity = 57/244 (23.36%), Postives = 117/244 (47.95%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-----RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILA 741
            +++  +ESL   + + E   +   ++ L+  L    S +   + +  L  FYEN L +H+ + P +  G++ L    +  D+  + +A +++K    +   Q      R  +Y ++ + + +    LK+    F   F+  + GE  P  ++    I   I+ +N+ +    EELFE  + YFP++     +    +T+E L    +  L  ++ F   LLP+L+EK  ++ +S+++DSL  L+
Sbjct:   37 TVLQVVESLGSCLANPEPRMRSKGVQLLSRVLLECYSRLTEKE-VEVLVVFYENRLKDHHLITPHVLQGLMAL----SMCDVLPQGVAVSVLKSVFQEVHVQSLMQIDRHTVYMIITNFMKTREEELKNLGADFTYGFIQVMDGEKDPRNLLVAFYIVQDIVTKNYALGPFVEELFEVTSCYFPIDFTPPPSDPHGITREHLIMGLRAVLASTSRFAEFLLPLLIEKMDSEMQSAKLDSLQTLS 275          
BLAST of MMS19_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96T76|MMS19_HUMAN (MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 1.655e-9
Identity = 59/239 (24.69%), Postives = 115/239 (48.12%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQV-RLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +++  +E+L   + + E  ++  A++ L+  L    + +   + ++ L  FYEN L +H+ ++P++  G+  L          A  +  A+ +    Q  PQV R  +Y ++ + + +    LKS    F   F+  + GE  P  ++   RI   +I  ++++    EELFE  + YFP++     N    + +E L    +  L  +  F   LLP+L+EK  ++  S+++DSL  L
Sbjct:   45 TVLQVVEALGSSLENPEPRTRARAIQLLSQVLLHCHTLLLEKEVVH-LILFYENRLKDHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQTL 282          
BLAST of MMS19_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UTR1|MMS19_SCHPO (DNA repair/transcription protein mms19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mms19 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.344e-9
Identity = 61/245 (24.90%), Postives = 110/245 (44.90%), Query Frame = 1
Query:   25 MSIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVK-LDVPQFDPQVRLKIYELLNDLLTSFLNALKS-FDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXX--XXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEG 747
            M IVD + S+ E +T + IS +  A+  L+  L  LP     +  ++ L  FY + L +   +      GI  L++  NF       +  AL    D+P++    RL I ++   ++ ++L  + S   D F +   ++  GE  P  ++ V  +   I+  F ID   ++ F+    YFP+  +        +  + +L   L ++ L+ +  F   LLP L E+  A     +ID+L+I  E 
Sbjct:   36 MGIVDLVTSIGEYLTDNNISVRAKAVLLLSQTLGELPKDRLPAKHVSVLLQFYLSRLDDEVTMKENAL-GIGALLNMQNFPAQKIVDVCKALFSSTDMPKYAQATRLNILKVFETIIDNYLFFISSQTRDAFFSGICSTFAGEKDPRNLMLVFSMLKKILSTFPIDGFEQQFFDITYCYFPITFRAPPDATNLAITSDDLKIAL-RETLVANDAFSKLLLPALFERLKASTVRIKIDALNIYIEA 278          
BLAST of MMS19_N domain-containing protein vs. TrEMBL
Match: A0A1I8IDI9 (MMS19_N domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.003e-21
Identity = 71/238 (29.83%), Postives = 129/238 (54.20%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQI-ASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            S++  IESL+ D+TS++I  +  A+  +A  L  LP +  N   +  L  F    L++H+ +      G+  L    N  +  A  +  S   +L V   +   R+ +Y++   LL + L+ LKS +  F+  F+ +I  E  P  ++ V  +  +++  F+I R  E++FE +A YFPV+     + S  VT++ L EL+ +CL  + +FG  ++P+LLEK  +D +S+R++S ++L
Sbjct:   16 SVLQLIESLQPDLTSTKIEQRAGAIGEVANVLQKLPPAHLNEQEVTTLVQFLCVKLADHFSVSSHAIFGLKALCSCVNLSNAAAEAVFRSVTTELQVQTLNQMERMAVYQIFQLLLQNKLHFLKSINHDFVFGFVRTIDAEKDPRNLLIVFELFPLVVAEFDITRFSEDMFEVIACYFPVDF--KPSASGSVTRDQLVELHSRCLSSTPIFGEFMVPLLLEKLASDLRSARLESFNLL 251          
BLAST of MMS19_N domain-containing protein vs. TrEMBL
Match: A0A267FXC2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024648g2 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.364e-19
Identity = 71/238 (29.83%), Postives = 129/238 (54.20%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQI-ASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            S++  IESL+ D+TS++I  +  A+  +A  L  LP +  N   +  L  F    L++H+ +      G+  L    N  +  A  +  S   +L V   +   R+ +Y++   LL + L+ LKS +  F+  F+ +I  E  P  ++ V  +  +++  F+I R  E++FE +A YFPV+     + S  VT++ L EL+ +CL  + +FG  ++P+LLEK  +D +S+R++S ++L
Sbjct:   16 SVLQLIESLQPDLTSTKIEQRAGAIGEVANVLQKLPPAHLNEQEVTTLVQFLCVKLADHFSVSSHAIFGLKALCSCVNLSNAAAEAVFRSVTTELQVQTLNQMERMAVYQIFQLLLQNKLHFLKSINHDFVFGFVRTIDAEKDPRNLLIVFELFPLVVAEFDITRFSEDMFEVIACYFPVDF--KPSASGSVTRDQLVELHSRCLSSTPIFGEFMVPLLLEKLASDLRSARLESFNLL 251          
BLAST of MMS19_N domain-containing protein vs. TrEMBL
Match: A0A267DUR9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004541g1 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.412e-19
Identity = 71/238 (29.83%), Postives = 129/238 (54.20%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQI-ASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            S++  IESL+ D+TS++I  +  A+  +A  L  LP +  N   +  L  F    L++H+ +      G+  L    N  +  A  +  S   +L V   +   R+ +Y++   LL + L+ LKS +  F+  F+ +I  E  P  ++ V  +  +++  F+I R  E++FE +A YFPV+     + S  VT++ L EL+ +CL  + +FG  ++P+LLEK  +D +S+R++S ++L
Sbjct:   16 SVLQLIESLQPDLTSTKIEQRAGAIGEVANVLQKLPPAHLNEQEVTTLVQFLCVKLADHFSVSSHAIFGLKALCSCVNLSNAAAEAVFRSVTTELQVQTLNQMERMAVYQIFQLLLQNKLHFLKSINHDFVFGFVRTIDAEKDPRNLLIVFELFPLVVAEFDITRFSEDMFEVIACYFPVDF--KPSASGSVTRDQLVELHSRCLSSTPIFGEFMVPLLLEKLASDLRSARLESFNLL 251          
BLAST of MMS19_N domain-containing protein vs. TrEMBL
Match: E0VJ45 (DNA repair/transcription protein met18/mms19, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8230415 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.736e-19
Identity = 74/268 (27.61%), Postives = 137/268 (51.12%), Query Frame = 1
Query:   19 RFMSIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFD-NFKDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQMNFEDVFNYHMSFLDCLLHQV 819
            +F++IV   ESL+E +T+ +I+ ++  +K L+  L+ +P    N   I  +T FY   L  H+ LLP    G+L +++     K+ N + I+S    ++      + RL IY +L   + + L+  K     FI   ++ I GE  P+C++ +      +I+N ++  + +ELFE  + YFP++        S VT+E L+E   +CL  +  F    LP+L EK  +  +++++DS  +L     ++N   + NY   F  C+ + +
Sbjct:   37 KFITIV---ESLQEILTNEDINIRERGIKFLSWVLTQIPKDKLNCSEITHITNFYCECLKSHHNLLPATFKGLLAIVNMKYTLKEDNIKIISSLFQNVNCITQLQEDRLNIYNILEVSVLNHLDEAKQMGPDFIFGVISFIEGETDPKCLLKIFSFFPYLIQNLDLGHLTDELFEVFSCYFPIDFNAAAKDKSLVTREELSEGLLQCLTSNEKFCELSLPLLFEKLDSTFQTAKLDSYQLLKACCQKLNASSLQNYLNQFWKCVQNDI 301          
BLAST of MMS19_N domain-containing protein vs. TrEMBL
Match: A0A0C9Y4P0 (Unplaced genomic scaffold K443scaffold_5, whole genome shotgun sequence OS=Laccaria amethystina LaAM-08-1 OX=1095629 GN=K443DRAFT_671974 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 8.541e-18
Identity = 66/242 (27.27%), Postives = 119/242 (49.17%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASAL-VKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGL 750
            +++  +++L E +TS E   ++  ++ L++ L   P +     SI  LT FY   L +   ++P +  GILTL+    F    A  +  AL + +        VR  +Y +++ L+    +ALK+   +F+ +++    GE  P  +V    I  +I+  F+I    E LF     YFP+  +   N    ++ + L    ++CL  + LFGP  +P+ LEK TA  ++++ D+L  LA  L
Sbjct:   33 TLIVIVKALGEYLTSEENDLRRKGVELLSLVLEKCPPARLTRQSIRVLTPFYCGKLDDSETIVPAL-QGILTLVKLPTFGAPEATGVIDALFLYVKTKSLVQSVRFNVYSIIDSLMARHRDALKALGKKFVGNYIALAEGEKDPRNLVVAFAIARVILIEFDISEYVESLFNITFCYFPITFRPPPNDPYGISSDDLRAALRQCLCATPLFGPLAIPVFLEKLTAGSRATKKDTLQALATCL 273          
BLAST of MMS19_N domain-containing protein vs. Ensembl Cavefish
Match: mms19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:NCBI gene;Acc:563643])

HSP 1 Score: 80.4925 bits (197), Expect = 7.112e-15
Identity = 64/239 (26.78%), Postives = 119/239 (49.79%), Query Frame = 1
Query:   31 IVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVK-LDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILA 741
            I++ +E+L   +TSS+  ++   ++ L+  L    S +   + +  L  FYEN L +HY + P +  G+  L         +A  I  +L + ++V       R  +Y +L  L+ S  + LK     F+  F+ ++ GE  P  ++   +I   II   +++ +  EE FE  + YFP++     N +  +T+E L    +  L G+  F   LLP+++EK  +D +++++DSL  LA
Sbjct:   38 ILELVEALGISLTSSQSQTRGRGVQLLSEVLQECYSGLSERE-VEVLIAFYENRLKDHYAITPHVLRGLKALAKSTVLPPGSAVSILRSLFQDVNVQSLMLAERSCVYNMLISLMGSREDELKGLGPDFVFGFVQAVDGERDPRNLLLAFQIARNIIHRGYDLSQFTEEFFEVTSCYFPIDFTPPPNDAHGITQEELILALRGVLTGTPRFAEFLLPLIIEKLDSDVQNAKVDSLQTLA 275          
BLAST of MMS19_N domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005339.1 (pep scaffold:Pmarinus_7.0:GL478833:10460:21403:-1 gene:ENSPMAG00000004861.1 transcript:ENSPMAT00000005339.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 9.591e-12
Identity = 50/195 (25.64%), Postives = 87/195 (44.62%), Query Frame = 1
Query:  160 INCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVK-LDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDIL 738
            +  L  FY + L +HY +LP++  G + L    N       Q+  A+ + + V       R  +Y ++ + + +    LK     F   F+ +  GE  P  ++   RI   I+   + +    EELFE  + YFP++          +T E L    +  L  +  F    LP+LLEK  +D  S+++D+L+ L
Sbjct:   86 LEVLALFYIDKLKDHYTVLPSVLQGFVALSSTPNLPVGLEVQVLKAIFQDVHVQSLVYSDRRSVYNIIANFMETKEPELKGLGTDFTYGFVQATDGEKDPRNLLISFRIAHGIVAHGYQLGSFVEELFEVTSCYFPIDFTPPTTDPHGITAEQLVLGLRAVLSSTPKFAEFCLPLLLEKLDSDINSAKVDALETL 280          
BLAST of MMS19_N domain-containing protein vs. Ensembl Nematostella
Match: EDO37103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGP8])

HSP 1 Score: 49.6766 bits (117), Expect = 6.428e-6
Identity = 33/113 (29.20%), Postives = 51/113 (45.13%), Query Frame = 1
Query:  391 LKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSL 729
            LK      +  FL ++ GE  P  +V   ++  III+NF I    E+LFE  + YFP++                             F P  LP+L+EK ++D  +++IDSL
Sbjct:   70 LKPVGSDLVFGFLQAMDGEKDPRNLVVAFKLARIIIKNFPIGLFAEDLFEVTSCYFPID-----------------------------FTPFCLPLLMEKLSSDVINAKIDSL 153          
BLAST of MMS19_N domain-containing protein vs. Ensembl Medaka
Match: mms19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:NCBI gene;Acc:101163725])

HSP 1 Score: 87.4261 bits (215), Expect = 4.104e-17
Identity = 65/266 (24.44%), Postives = 128/266 (48.12%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVK-LDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQMNFEDVFNYHMSFLDCLLHQV 819
            +++  +E+L   +TSS+  ++   ++ L+  L    + +   + +  L  FY+N L +H+   P +  G+L L         +A  +  +L + + V       R  +Y +L +L+ +    LKS    F+  F+ S+ GE  P  ++   RI   +I++ +++ +  EELFE  + YFP++     N    +TKE L +  +  L G+  F   L P+L+EK  ++ +S+++D+L  L   L +   +D   +       L  +V
Sbjct:   37 TVLQLVEALGPSLTSSQPQTRARGVQLLSEVLQDGRAELSQKE-VEVLMAFYQNRLKDHHVTTPPVLRGLLALTKCAALPPGSAVSMLRSLFQDVHVQSLMLAERACVYNMLTNLMETREAELKSLGADFVFGFVQSMDGERDPRNLLLAFRIARNLIVQGYDLGKFAEELFEVTSCYFPIDFTPPPNDPHGITKEELVQALRAVLTGTPKFAEFLFPLLIEKLDSEVQSAKLDALQTLNACLSRFEHKDTAEFLQGLWSSLRREV 301          
BLAST of MMS19_N domain-containing protein vs. Ensembl Medaka
Match: mms19 (MMS19 homolog, cytosolic iron-sulfur assembly component [Source:NCBI gene;Acc:101163725])

HSP 1 Score: 87.0409 bits (214), Expect = 5.958e-17
Identity = 65/266 (24.44%), Postives = 128/266 (48.12%), Query Frame = 1
Query:   28 SIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVK-LDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICL-IIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQMNFEDVFNYHMSFLDCLLHQV 819
            +++  +E+L   +TSS+  ++   ++ L+  L    + +   + +  L  FY+N L +H+   P +  G+L L         +A  +  +L + + V       R  +Y +L +L+ +    LKS    F+  F+ S+ GE  P  ++   RI   +I++ +++ +  EELFE  + YFP++     N    +TKE L +  +  L G+  F   L P+L+EK  ++ +S+++D+L  L   L +   +D   +       L  +V
Sbjct:  119 TVLQLVEALGPSLTSSQPQTRARGVQLLSEVLQDGRAELSQKE-VEVLMAFYQNRLKDHHVTTPPVLRGLLALTKCAALPPGSAVSMLRSLFQDVHVQSLMLAERACVYNMLTNLMETREAELKSLGADFVFGFVQSMDGERDPRNLLLAFRIARNLIVQGYDLGKFAEELFEVTSCYFPIDFTPPPNDPHGITKEELVQALRAVLTGTPKFAEFLFPLLIEKLDSEVQSAKLDALQTLNACLSRFEHKDTAEFLQGLWSSLRREV 383          
BLAST of MMS19_N domain-containing protein vs. Planmine SMEST
Match: SMESG000059575.1 (SMESG000059575.1)

HSP 1 Score: 1300.42 bits (3364), Expect = 0.000e+0
Identity = 678/683 (99.27%), Postives = 680/683 (99.56%), Query Frame = 2
Query:  845 DFICH*FKNRDSDCQALSLKCADSIARTFQKHASEAQLIEFCWHLYEITSGIIIENDKKLLQFLMSAVAGKCRVWCGVLANFLAPXXXXXXXXXXXXXXXXXILVDLLSAGDNLPQYKGLMDSSKADGFFTKLNLIYMEILNNPNTIENHEKLSIMFNLMAHYSLFNIWMSNGTDNANYDNDVNSIIGSRCQLISKSMAYLAKNTNIQLELSVLKLTPKLLESSISLTTVRNQFTELVLSYSQENDSLQKLGFRLLESVPVSCLELVLPIIDLKLKDLPLVATVASCFARLTERFSNDPETTELLCMFFLTVLDDILIKQSHLDPVAVSNIALALSELGIPEDESLKSRIIEELLRASRANDLSEPSVMWLCSILGQSSIPMIQRSIMVSDLLNLLYAMIFAAGNGEIKSILCQTYASLINKLEEPSDFDDFILHLEYRKDDSEFLLWNLKASMMSSKLDYASKLIDVIVDPIHISTGFGLELVKRIPILMRPSSMKKHFCSELKLFPKQNLFYHQQSFHLVAQPFRSMAIDDSNIDCIKDISMEIYLKLISSYPQQVVDLYIDEIVQTVGQWFKKLVDSNSKISLRIEALKAVCNLNSSVNHLEKYTDDIAGNIIATGNSIGLLSVRDRYFLAEVIGWFSLSFPKHKSDQFMXXXXXXXXXXXXXXXXXVRMEAAKSQTVLF 2893
            D + H FKNRDSDCQALSLKCADSIARTFQKHASEAQLIEFCWHLYEITSGIIIENDKKLLQFLMSAVAGKCRVWCGVLANFLAPLLEKLLKLDFEDTEKLDILVDLLSAGDNLPQYKGLMDSSKADGFFTKLNLIYMEILNNPNTIENHEKLSIMFNLMAHYSLFNIWMSNGTDNANYDNDVNSIIGSRCQLISKSMAYLAKNTNIQLELSVLKLTPKLLESSISLTTV+NQFTELVLSYSQENDSLQKLGFRLLESVPVSCLELVLPIIDLKLKDLPLVATVASCFARLTERFSNDPETTELLCMFFLTVLDDILIKQSHLDPVAVSNIALALSELGIPEDESLKSRIIEELLRASRANDLSEPSVMWLCSILGQSSIPMIQRSIMVSDLLNLLYAMIFAAGNGEIKSILCQTYASLINKLEEPSDFDDFILHLEYRKDDSEFLLWNLKASMMSSKLDYASKLIDVIVDPIHISTGFGLELVKRIPILMRPSSMKKHFCSELKLFPKQNLFYHQQSFHLVAQPFRSMAIDDSNIDCIKDISMEIYLKLISSYPQQVVDLYIDEIVQTVGQWFKKLVDSNSKISLRIEALKAVCNLNSSVNHLEKYTDDIAGNIIATGNSIGLLSVRDRYFLAEVIGWFSLSFPKHKSDQFMIDVKLILRKLIDDKKRIVRMEAAKSQTVLF
Sbjct:  259 DCLLHQFKNRDSDCQALSLKCADSIARTFQKHASEAQLIEFCWHLYEITSGIIIENDKKLLQFLMSAVAGKCRVWCGVLANFLAPLLEKLLKLDFEDTEKLDILVDLLSAGDNLPQYKGLMDSSKADGFFTKLNLIYMEILNNPNTIENHEKLSIMFNLMAHYSLFNIWMSNGTDNANYDNDVNSIIGSRCQLISKSMAYLAKNTNIQLELSVLKLTPKLLESSISLTTVQNQFTELVLSYSQENDSLQKLGFRLLESVPVSCLELVLPIIDLKLKDLPLVATVASCFARLTERFSNDPETTELLCMFFLTVLDDILIKQSHLDPVAVSNIALALSELGIPEDESLKSRIIEELLRASRANDLSEPSVMWLCSILGQSSIPMIQRSIMVSDLLNLLYAMIFAAGNGEIKSILCQTYASLINKLEEPSDFDDFILHLEYRKDDSEFLLWNLKASMMSSKLDYASKLIDVIVDPIHISTGFGLELVKRIPILMRPSSMKKHFCSELKLFPKQNLFYHQQSFHLVAQPFRSMAIDDSNIDCIKDISMEIYLKLISSYPQQVVDLYIDEIVQTVGQWFKKLVDSNSKISLRIEALKAVCNLNSSVNHLEKYTDDIAGNIIATGNSIGLLSVRDRYFLAEVIGWFSLSFPKHKSDQFMIDVKLILRKLIDDKKRIVRMEAAKSQTVLF 941          

HSP 2 Score: 502.286 bits (1292), Expect = 1.537e-162
Identity = 262/264 (99.24%), Postives = 262/264 (99.24%), Query Frame = 1
Query:   25 MSIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASALVKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMXXXXXXXXXXXXELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQMNFEDVFNYHMSFLDCLLHQ 816
            MSIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGI TLIDFDNFKDMNARQIASALVKLDVPQ DPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMKKTNNTSSKVTKELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQMNFEDVFNYHMSFLDCLLHQ
Sbjct:    1 MSIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPNSDSINCLTTFYENILSEHYQLLPTITDGISTLIDFDNFKDMNARQIASALVKLDVPQLDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGENSPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMKKTNNTSSKVTKELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGLGQMNFEDVFNYHMSFLDCLLHQ 264          
The following BLAST results are available for this feature:
BLAST of MMS19_N domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MMS194.050e-1124.83MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
MMS191.180e-1024.27MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
MMS193.445e-1024.69MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
MMS193.445e-1024.69MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
MMS191.608e-627.41MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mms-192.024e-825.69Yeast MMS related [Source:UniProtKB/TrEMBL;Acc:O7... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mms191.496e-1122.08gene:FBgn0037301 transcript:FBtr0078778[more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mms192.779e-1526.94MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam189a11.459e-1224.79family with sequence similarity 189 member A1 [Sou... [more]
fam189a19.296e-1224.69family with sequence similarity 189 member A1 [Sou... [more]
fam189a14.282e-1126.67family with sequence similarity 189 member A1 [Sou... [more]
fam189a14.605e-1126.67family with sequence similarity 189 member A1 [Sou... [more]
fam189a14.669e-1127.08family with sequence similarity 189 member A1 [Sou... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mms193.685e-1025.17MMS19 cytosolic iron-sulfur assembly component [So... [more]
Mms198.041e-923.85MMS19 cytosolic iron-sulfur assembly component [So... [more]
Mms198.041e-923.85MMS19 cytosolic iron-sulfur assembly component [So... [more]
Mms193.532e-823.85MMS19 cytosolic iron-sulfur assembly component [So... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E7FBU4|MMS19_DANRE2.675e-1427.53MMS19 nucleotide excision repair protein homolog O... [more]
sp|Q0V9L1|MMS19_XENTR4.517e-1124.69MMS19 nucleotide excision repair protein homolog O... [more]
sp|Q6DCF2|MMS19_XENLA1.097e-923.36MMS19 nucleotide excision repair protein homolog O... [more]
sp|Q96T76|MMS19_HUMAN1.655e-924.69MMS19 nucleotide excision repair protein homolog O... [more]
sp|Q9UTR1|MMS19_SCHPO4.344e-924.90DNA repair/transcription protein mms19 OS=Schizosa... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IDI91.003e-2129.83MMS19_N domain-containing protein OS=Macrostomum l... [more]
A0A267FXC21.364e-1929.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DUR91.412e-1929.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
E0VJ453.736e-1927.61DNA repair/transcription protein met18/mms19, puta... [more]
A0A0C9Y4P08.541e-1827.27Unplaced genomic scaffold K443scaffold_5, whole ge... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mms197.112e-1526.78MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005339.19.591e-1225.64pep scaffold:Pmarinus_7.0:GL478833:10460:21403:-1 ... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO371036.428e-629.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mms194.104e-1724.44MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
mms195.958e-1724.44MMS19 homolog, cytosolic iron-sulfur assembly comp... [more]
back to top
BLAST of MMS19_N domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000059575.11.537e-16299.27SMESG000059575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033075 ID=SMED30033075|Name=MMS19_N domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2938bp
ATTAATATTACTTTTGAAAGATTCATGTCTATAGTTGATTTTATTGAAAG
CCTCAGAGAGGATATTACAAGTTCAGAAATATCTTCGAAAAAAGATGCTT
TAAAAAGATTAGCCATTTATCTTTCTGGGCTTCCGTCTTCAGTACCTAAT
TCTGATTCCATTAATTGCTTGACAACATTCTATGAAAACATTTTAAGTGA
ACACTATCAATTATTACCTACTATTACAGATGGAATATTAACACTAATTG
ATTTTGATAATTTCAAAGATATGAATGCCAGACAAATAGCCAGTGCTCTT
GTTAAATTGGATGTGCCTCAATTTGATCCACAAGTTCGTCTTAAGATCTA
TGAATTATTGAATGATTTACTAACGTCATTTTTGAACGCTCTGAAAAGTT
TTGATGACAGATTTATTAATGATTTTCTCAATTCTATTTACGGCGAAAAT
TCACCAGAATGTGTTGTATCCGTTTTGAGAATATGTTTGATAATAATTGA
AAATTTTAATATCGATCGAGTGTATGAAGAATTATTTGAATCGGTGGCAG
TATATTTCCCGGTAGAAATGAAAAAAACAAATAATACTTCATCGAAAGTC
ACAAAAGAACTGTTAACGGAGTTGAATAAGAAATGTCTGATTGGATCGGC
TTTGTTTGGGCCGCAACTGCTGCCGATTTTACTGGAAAAGGCGACCGCTG
ATAAGAAATCCTCCAGAATCGATTCTTTGGACATTCTTGCGGAAGGACTG
GGCCAAATGAATTTCGAGGACGTTTTCAATTATCACATGTCGTTTCTCGA
TTGTCTTCTCCATCAGGTTCATACGATTGTCGCGTATATTATCGGATTTC
ATTTGCCACTAGTTCAAAAACCGGGATTCAGATTGTCAAGCTTTGTCACT
TAAATGTGCCGACTCTATCGCCAGAACATTTCAGAAACACGCAAGTGAGG
CCCAACTGATTGAGTTTTGCTGGCATTTATATGAAATAACGAGTGGAATA
ATAATAGAAAACGACAAGAAATTGCTGCAATTCCTCATGTCAGCAGTCGC
AGGCAAATGCCGAGTCTGGTGTGGCGTGCTGGCCAATTTTTTGGCACCAC
TGCTGGAGAAATTGCTGAAATTAGACTTTGAGGACACAGAGAAGCTGGAT
ATTTTGGTGGATCTTTTGTCGGCAGGTGATAATCTGCCCCAGTATAAAGG
TTTAATGGACTCTTCAAAAGCAGATGGATTTTTCACAAAATTAAACCTAA
TTTATATGGAAATCTTAAACAATCCAAATACAATCGAAAATCATGAAAAA
TTGTCGATTATGTTCAACTTAATGGCTCACTATTCTCTTTTTAATATATG
GATGTCGAACGGCACGGACAATGCCAACTATGATAATGACGTGAACTCTA
TTATTGGATCTCGCTGCCAATTAATATCGAAATCAATGGCGTATTTGGCC
AAAAACACAAATATTCAACTCGAGCTCTCTGTATTGAAATTAACTCCAAA
ACTCTTAGAGTCGTCAATTTCTTTGACAACTGTTCGAAATCAATTCACTG
AATTGGTTTTATCTTATTCACAAGAAAATGATTCCTTACAAAAACTTGGG
TTTAGATTATTAGAATCAGTGCCGGTTTCTTGCCTTGAACTTGTACTACC
AATCATCGATCTGAAACTGAAAGATCTCCCCTTAGTGGCAACTGTTGCAT
CGTGTTTTGCTAGACTGACAGAAAGATTTTCAAATGATCCTGAAACGACT
GAATTGTTGTGCATGTTCTTCCTTACAGTATTGGACGACATCCTTATCAA
ACAATCTCATTTGGATCCAGTTGCTGTGAGTAATATAGCTTTGGCCTTGA
GTGAACTTGGCATTCCTGAGGACGAAAGCTTGAAATCAAGGATAATAGAG
GAACTCCTTCGTGCATCTAGGGCTAATGATCTCTCCGAGCCGTCAGTCAT
GTGGCTTTGCTCGATTTTAGGACAATCGTCGATTCCAATGATTCAGCGGT
CCATAATGGTTTCTGATTTGCTGAATTTATTATATGCGATGATATTCGCT
GCTGGTAATGGTGAAATAAAATCAATCCTCTGCCAAACGTATGCCTCCCT
GATCAACAAACTGGAGGAGCCATCCGATTTCGATGACTTTATTCTACATT
TGGAATATCGAAAAGACGATTCAGAATTTTTACTCTGGAATCTCAAAGCG
TCAATGATGTCGAGCAAATTGGATTATGCCAGCAAACTAATCGATGTAAT
AGTTGATCCCATTCACATTTCCACGGGATTCGGATTGGAATTAGTTAAAC
GCATTCCTATTTTGATGCGGCCGTCCTCAATGAAAAAGCATTTTTGTAGT
GAATTGAAATTGTTTCCTAAACAAAATTTATTTTACCACCAACAATCCTT
CCATTTAGTAGCGCAACCATTCCGATCAATGGCCATAGATGACAGTAACA
TAGATTGTATTAAAGATATTTCAATGGAAATTTACCTAAAACTTATCAGC
AGTTATCCGCAACAAGTGGTGGATTTGTATATCGACGAAATCGTCCAAAC
TGTTGGACAATGGTTTAAGAAACTTGTCGATAGTAACAGTAAAATATCGT
TACGAATTGAAGCTTTGAAAGCTGTTTGCAATTTAAATTCATCTGTAAAT
CACCTAGAGAAATATACTGATGACATCGCCGGAAATATAATCGCAACCGG
AAACTCTATTGGGCTTCTCAGTGTGCGAGATCGATATTTTCTGGCAGAAG
TGATTGGCTGGTTTTCTCTGTCATTCCCGAAACATAAATCAGATCAGTTT
ATGATCGATGTTAAACTAATTTTACGCAAACTGATCGATGACAAAAAGCG
GATAGTTCGCATGGAAGCAGCTAAATCACAAACAGTTTTGTTTTGAAACT
TTATAAATACATTTTACATTATTGAAAAAAGATCGGAA
back to top

protein sequence of SMED30033075-orf-1

>SMED30033075-orf-1 ID=SMED30033075-orf-1|Name=SMED30033075-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=620bp
MSAVAGKCRVWCGVLANFLAPLLEKLLKLDFEDTEKLDILVDLLSAGDNL
PQYKGLMDSSKADGFFTKLNLIYMEILNNPNTIENHEKLSIMFNLMAHYS
LFNIWMSNGTDNANYDNDVNSIIGSRCQLISKSMAYLAKNTNIQLELSVL
KLTPKLLESSISLTTVRNQFTELVLSYSQENDSLQKLGFRLLESVPVSCL
ELVLPIIDLKLKDLPLVATVASCFARLTERFSNDPETTELLCMFFLTVLD
DILIKQSHLDPVAVSNIALALSELGIPEDESLKSRIIEELLRASRANDLS
EPSVMWLCSILGQSSIPMIQRSIMVSDLLNLLYAMIFAAGNGEIKSILCQ
TYASLINKLEEPSDFDDFILHLEYRKDDSEFLLWNLKASMMSSKLDYASK
LIDVIVDPIHISTGFGLELVKRIPILMRPSSMKKHFCSELKLFPKQNLFY
HQQSFHLVAQPFRSMAIDDSNIDCIKDISMEIYLKLISSYPQQVVDLYID
EIVQTVGQWFKKLVDSNSKISLRIEALKAVCNLNSSVNHLEKYTDDIAGN
IIATGNSIGLLSVRDRYFLAEVIGWFSLSFPKHKSDQFMIDVKLILRKLI
DDKKRIVRMEAAKSQTVLF*
back to top

protein sequence of SMED30033075-orf-2

>SMED30033075-orf-2 ID=SMED30033075-orf-2|Name=SMED30033075-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=301bp
INITFERFMSIVDFIESLREDITSSEISSKKDALKRLAIYLSGLPSSVPN
SDSINCLTTFYENILSEHYQLLPTITDGILTLIDFDNFKDMNARQIASAL
VKLDVPQFDPQVRLKIYELLNDLLTSFLNALKSFDDRFINDFLNSIYGEN
SPECVVSVLRICLIIIENFNIDRVYEELFESVAVYFPVEMKKTNNTSSKV
TKELLTELNKKCLIGSALFGPQLLPILLEKATADKKSSRIDSLDILAEGL
GQMNFEDVFNYHMSFLDCLLHQVHTIVAYIIGFHLPLVQKPGFRLSSFVT
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0097428protein maturation by iron-sulfur cluster transfer
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.453