Dynein heavy chain axonemal-like

NameDynein heavy chain axonemal-like
Smed IDSMED30033073
Length (bp)14078
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Dynein heavy chain axonemal-like (SMED30033073) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain axonemal-like (SMED30033073) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain axonemal-like (SMED30033073) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain axonemal-like (SMED30033073) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 11

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033073SMESG000039073.1 SmedASXL_018386SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30033073SMESG000039073.1 dd_Smed_v6_4176_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033073SMESG000039073.1 dd_Smed_v6_4176_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH5 (dynein axonemal heavy chain 5 [Source:HGNC Symbol;Acc:HGNC:2950])

HSP 1 Score: 5509.88 bits (14292), Expect = 0.000e+0
Identity = 2802/4622 (60.62%), Postives = 3524/4622 (76.24%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 5340.78 bits (13853), Expect = 0.000e+0
Identity = 2712/4606 (58.88%), Postives = 3465/4606 (75.23%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 5316.9 bits (13791), Expect = 0.000e+0
Identity = 2688/4528 (59.36%), Postives = 3428/4528 (75.71%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4566.91 bits (11844), Expect = 0.000e+0
Identity = 2372/4080 (58.14%), Postives = 3037/4080 (74.44%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1986.85 bits (5146), Expect = 0.000e+0
Identity = 1218/3591 (33.92%), Postives = 1940/3591 (54.02%), Query Frame = 1
            +  ++   +D+ K  +Q+S  M    S +Q  L  +  Y  +W+    + +  + +  P +S   A I  ++++   +        +  V+     LK  L+  C+ W+  +A  L    A  +  +       ++++SRP + L+++   +  +  L+     +E  I PI E + +L KYE+   D   E +DSL   +   +      +  L + + KFK  LI     FK+   + + D++ +G     +    A D++T  +     +  +  +      +F +E     D+Q + KEL+ LQ+++++  +  +  N +    +  +  +T+         +  KL K  K+  W+  +  R  I+ F  T PL+  + + A+  RHW+++      +F+ +S++F L  ++E  +  + E+I +I  SA KE  IE  L+ +   W         +K +G   L+G  T E+   +ED+ +AL  + ++R+   F+  +  W + L+   E+IE  L VQ  W+YLE +F+G DI KQLP E+  F  ++ +W+ IM R ++  N ++       L   L  +   LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K +   +KV       + + + S + E +     +  +G VE WLGD+ +  R +L  ++R+  + +     K  ++   +  QV +   Q+ WT D  + L  +K   DKKI++   +  + ILN+       NLTKI R K   L+TI +H RD+ + L    +     F+WL Q RFY+++D D C++  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +DY+ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV A QI  +L+        F F DG  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF    +L+KK YTLY L  +QLS+Q HYDFGLR + S+LR  G  +R  PD ++  +++  +RDMN++KL   D  LF ++++DLFP +++    Y  +   ++++I    L    P+ L K+ QL+ET+  RH  M +G +G+GKT    +L   + ++   G+P+    +E  +NPKA++  +++G  D++TN+WTDGI S++ R     +K +  W++ DGPVD +WIEN+NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   + L W+P ++SWL   +   A    +   F+ + ++   +        +   E + I     L + L    +G++    E   + +E   VFSM+WS+ A ++ E R ++  ++   + + P     + DT++EY V+ K   W  +  ++P+ + YP +    +  I+VP VD  R ++L++++      +LL+G  GT KT I +         Q     +N S+ TT N  Q  +ES V+KR    + P GG+ M  F+DD+NMP  + +G Q   E++R  ++    Y   K      I ++ ++AAM  PGGGR  I  RL+ +F+I N T P+ +   +I RI G       + F+ +V+   N +  AT  ++     + LPTP K HY+FNLRD+S+++QGML  N D  ++ S +  LW HEC RV +DR  + AD + F   +         +T    C S      +  P F DFL++                PK+YE +     L   +   + +YN +     + LV F++A+ H+ +I RVI   +G+ LLVG+GGSG+QSL RLAS I  Y TFQI +T     KH   Y      +D+K LYR +G   K  +F+F D +I DESFLE +NN+LSSGE+ NL+  DE +EI   ++   + E  + P S+++L  Y + RV   LH+VLC SP+G+ FRN   ++P L++  TI+WF  WP++AL+ V+   L   ++ +   + + V          VA+         RR  +VTP  YL  +SGYK++  +KR+E+   A ++ TGL K+ E  E V  +S EL   +K++   +K+  E L  +  +   A + ++ V    +       + +AL +N  +D       LE A PAL+EA  ALE++  + I  +K  GRPP  +  +M  V+IL                 +PTW EA + +   NF+ SL+NF KD I+D+V+  +  Y    DF       VS     LC W +AM  +  + + V P +  +    ++L      L  AQE L    ++L++++ +Y++ + +K+ L   +E    K+  A  L+ GLAGE+ RW E  +  ++ +  LVGD L+  AFLSY GPF  ++R+ I+ + W  ++    +P +      + L +   + +WNIQGLP+D  S +NG+IVTR  R+ L+IDPQ Q   WI+N E    L++  L    +   LE A+  G P+L+++V E +DP L+ +L K+  + G    +++GDKEV+    F+ Y+TTKL NP Y+PE  AKT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK KELED +L  L    GSL++D  L+  L  +K TA +V ++L     TEI  + ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF  S+  S +S     RI+ + +Y TY V+RYT R  +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F  +     +  + W  W+ + APE+A +P  ++N     +++L++RS   DR       +I   +G RF E  + N++ + E+    +P++  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +LL   + +G W+ L NCHL L++M   D+ +E +   E+ H SFR W+++  HP FPI+ILQ+ IK T +PP G++A + R Y L+++ Q    +   ++K +LF + F H+ + ER+KF  +GWNI Y FN SDF  +   +  +LD+ +      W  + Y+I  + YGG VTDD+D+RLL TY  ++F  +  +  F   S  + Y IP   SL  Y+ +I  LP +D PE FG H NAD+  + + A  +  T++++QP+ +   A G+TRE  V  LA D+ Q++PE  DY      E  QK+ +L   PLN+ L QE+ R   ++  +  +L DL+  I G I+MS +L++  + IFDA +P  W K       L  W  DL  R EQF  W    R PV FW++GF  P GFLTA+ Q   R +   ++D++     V+     ++   P +GV+V GLYL+GAGW+ +++ L E  P  L   +P +H        P   + K+ +  Y CP Y  P R       +++  ++L++    PDHWI RG ALL  +

HSP 2 Score: 100.138 bits (248), Expect = 1.283e-19
Identity = 76/277 (27.44%), Postives = 133/277 (48.01%), Query Frame = 1
            FIR     +T  N  A + F  +    G  + AL R +  +  P +     W          S  + F   L +FL  L       D++ +LE          + IP+  +     + +   E +++LE  +  W +QI+++LS  E +    +++GP  E+ +W++R    + + +Q+  K V  V +ILH AKS  L  + +L  +I D + +A+ N+ +L  L + +  L+   P D+   +P LI+ IR+I   S +YN+ ER+TSLF KV +
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 904/3421 (26.43%), Postives = 1638/3421 (47.88%), Query Frame = 1
            ++Q  ++ +Q KF  + EL+E      +  +  + +++   P+     P+EA + +T ++ K ++L  +            L  + +       +    +EL  ++ +++    V   ++   +  W  +    I Q L +  N+ ++LP   + +++Y+ +++ +  + +   L+ ++   A+  RHW ++  +   +   +  +  L  + +A +L ++  I+ I + A  E  +E  L+ +   W        +++++  L+   D   ++ + +++   +L A+  + Y   F+   Q W +KL     + + W+ VQ  W+YLE +F G  +I+  LP E+ RF  I      +M++    P ++   +      +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F     +  +E+  D+ I A +S+E E V L + ++ +   ++ + D L+     + H++ R  + ++  + F     +T            FP+QV  L  ++ W  + E+ L   K  + + QA     +  L  L     +    I R K E LIT  VH+RD    LV +KI    DF WL+  RFYF  D  Q      C+V + +  F Y  E+LG  +RLV TPLTDRCY+T++QAL   LGG+P GPAGTGKTE+ K +G  LG+FV+VFNC +  D++ +GRI  GL Q G+WGCFDEFNR+E  +LS  +QQI  +    +   +  +   G  ++++   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDR +I +V L S GF     L+ K   L+ LC+EQLS Q HYDFGLR +  VL + G  KR+  D          +E  ++++ + +  + KLV+ED AL  SL+ D+FP +  +     ++   +    ++  LI  D        W  K++QL++   + HG+M +G SG+GKT    VL++A+       G  H    ++ KA++   ++G +D  T +WTDG+F+++ R+     +GE     W+I DG VD  W+ENLNSVLDDNK LTL NG+R+ + PN +IIFEV ++  A+ ATVSR GMV+ S  ++                                      D +P     I R+  L L+T  +    +  + K   SE    +    Q L     ++    IR+ +    GL+   ++I +I++  L  ++  +++W+     + + R  + +FI     + +P       + +Y V   G+W+ W ++VP  +    H      ++VP +D  R + L+     ++K ++L G  G+ KT+ +     +   E ++  ++NFSS+TTP +  RT + Y + R    G    P    + + IF D+IN+P  +++G Q     +RQ++E+ G Y       + ++  IQ + A   P   GR+ +  R  R   I     P   S+ +I+               P V+   + L  A   ++  ++ +      + HYV++ R+L+R  +G+    S+ I      S  +L+ LW HE +R+  DR   + +++W +K +  T E   G+   +   L+    +  +L                  P   E ++ Y  +S RL  +   Y E +    + LV F   + H+++I R+ R ++GH LL+G  G+GK +L+R  ++++G   FQ+        K +  Y  ++  ED++ + R +G   + + F+  ++ + D  FLE LN +L++GE+  LF  DE   ++ ++     KE  +R      S++ L +++  +V++ LHVV   +P G   R R+   P L + C ++WF  W ++AL  V +    T +                  + S P  + AVVNT+ +    V +      ++  R+   TP+ +L FI  +  ++ +KR ++      +N GL K+ E  E V EL K L +K  EL+  ++ A   L ++      A++ K+  + ++      +  ++  K   E  L   +PA+ EA+ A++ IK   +  VK +  PP  +   ++ + IL     ++V  D         W    ++M   +F+T +L F  + +  E++  ME Y    D+        S     +  W +A   + ++  +V PL+  L     +LE    +     +++D +  EL+      + EY + + + + ++ D  + + K+  +  L+  L  ER+RW+  S  F +Q+  LVGD L+ +AFL+Y G ++Q  R+ +   W + +V  G+ F  D+  I  L+      +W +  LP D+L  +N +++ R  RYPL+IDP GQ   +I  +     +Q T+   + FR +LE AL  G  LL++DV E  DP L+ VL +   ++G    + +GD+++D+   FQ+++ T+     ++P++ ++ + ++FTVT   L  Q L  V+ +E+ +++ +R  L++   E   + + LE  LL  L  ++G +++D S+IE L   K  A +V QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T  +KR+  I   L   VFR  +RG   +DK    +LL M+I ++S                      K++E    I GG  LD   VE K           ++ +  K+  F+ +   +  N     +W  +D P E+++P  +D+ +            L+++ +  PDR +  A + +       F +   V+  L  +  E   + P++   + G D +  IE LA + N +  SI++G  +  + A   L  + + GRW+LL+N HL  +++ + LE    +   H  FR ++T E HPK P +IL+      ++P  G++A L R+ + +   +L  T A   +  L+  V +LH  VQER ++ P+GW+  YEF+ +D       +   +D +   R       + W T+  ++ +  YGG++ + +D+ LL+   +N F+ + F       PK+        P+    D+   ++++L     P   GL  NA+ +  T     ML  ++ +  ++   +  G  E +   + +   LA   LQ LP++     VK +        PL  F ++EV+   +++  +R  L ++          +   +    ++    +P+ W + +     T+  W TDL   NE+    +  G     +   FW+ G F+P+ ++TA RQ++ + +  W+L+ + L        S DV +    D+  + S G
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1153.27 bits (2982), Expect = 0.000e+0
Identity = 904/3421 (26.43%), Postives = 1638/3421 (47.88%), Query Frame = 1
            ++Q  ++ +Q KF  + EL+E      +  +  + +++   P+     P+EA + +T ++ K ++L  +            L  + +       +    +EL  ++ +++    V   ++   +  W  +    I Q L +  N+ ++LP   + +++Y+ +++ +  + +   L+ ++   A+  RHW ++  +   +   +  +  L  + +A +L ++  I+ I + A  E  +E  L+ +   W        +++++  L+   D   ++ + +++   +L A+  + Y   F+   Q W +KL     + + W+ VQ  W+YLE +F G  +I+  LP E+ RF  I      +M++    P ++   +      +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F     +  +E+  D+ I A +S+E E V L + ++ +   ++ + D L+     + H++ R  + ++  + F     +T            FP+QV  L  ++ W  + E+ L   K  + + QA     +  L  L     +    I R K E LIT  VH+RD    LV +KI    DF WL+  RFYF  D  Q      C+V + +  F Y  E+LG  +RLV TPLTDRCY+T++QAL   LGG+P GPAGTGKTE+ K +G  LG+FV+VFNC +  D++ +GRI  GL Q G+WGCFDEFNR+E  +LS  +QQI  +    +   +  +   G  ++++   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDR +I +V L S GF     L+ K   L+ LC+EQLS Q HYDFGLR +  VL + G  KR+  D          +E  ++++ + +  + KLV+ED AL  SL+ D+FP +  +     ++   +    ++  LI  D        W  K++QL++   + HG+M +G SG+GKT    VL++A+       G  H    ++ KA++   ++G +D  T +WTDG+F+++ R+     +GE     W+I DG VD  W+ENLNSVLDDNK LTL NG+R+ + PN +IIFEV ++  A+ ATVSR GMV+ S  ++                                      D +P     I R+  L L+T  +    +  + K   SE    +    Q L     ++    IR+ +    GL+   ++I +I++  L  ++  +++W+     + + R  + +FI     + +P       + +Y V   G+W+ W ++VP  +    H      ++VP +D  R + L+     ++K ++L G  G+ KT+ +     +   E ++  ++NFSS+TTP +  RT + Y + R    G    P    + + IF D+IN+P  +++G Q     +RQ++E+ G Y       + ++  IQ + A   P   GR+ +  R  R   I     P   S+ +I+               P V+   + L  A   ++  ++ +      + HYV++ R+L+R  +G+    S+ I      S  +L+ LW HE +R+  DR   + +++W +K +  T E   G+   +   L+    +  +L                  P   E ++ Y  +S RL  +   Y E +    + LV F   + H+++I R+ R ++GH LL+G  G+GK +L+R  ++++G   FQ+ + S         Y  ++  ED++ + R +G   + + F+  ++ + D  FLE LN +L++GE+  LF  DE   ++ ++     KE  +R      S++ L +++  +V++ LHVV   +P G   R R+   P L + C ++WF  W ++AL  V +    T +                  + S P  + AVVNT+ +    V +      ++  R+   TP+ +L FI  +  ++ +KR ++      +N GL K+ E  E V EL K L +K  EL+  ++ A   L ++      A++ K+  + ++      +  ++  K   E  L   +PA+ EA+ A++ IK   +  VK +  PP  +   ++ + IL     ++V  D         W    ++M   +F+T +L F  + +  E++  ME Y    D+        S     +  W +A   + ++  +V PL+  L     +LE    +     +++D +  EL+      + EY + + + + ++ D  + + K+  +  L+  L  ER+RW+  S  F +Q+  LVGD L+ +AFL+Y G ++Q  R+ +   W + +V  G+ F  D+  I  L+      +W +  LP D+L  +N +++ R  RYPL+IDP GQ   +I  +     +Q T+   + FR +LE AL  G  LL++DV E  DP L+ VL +   ++G    + +GD+++D+   FQ+++ T+     ++P++ ++ + ++FTVT   L  Q L  V+ +E+ +++ +R  L++   E   + + LE  LL  L  ++G +++D S+IE L   K  A +V QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T  +KR+  I   L   VFR  +RG   +DK    +LL M+I ++S                      K++E    I GG  LD   VE K           ++ +  K+  F+ +   +  N     +W  +D P E+++P  +D+ +            L+++ +  PDR +  A + +       F +   V+  L  +  E   + P++   + G D +  IE LA + N +  SI++G  +  + A   L  + + GRW+LL+N HL  +++ + LE    +   H  FR ++T E HPK P +IL+      ++P  G++A L R+ + +   +L  T A   +  L+  V +LH  VQER ++ P+GW+  YEF+ +D       +   +D +   R       + W T+  ++ +  YGG++ + +D+ LL+   +N F+ + F       PK+        P+    D+   ++++L     P   GL  NA+ +  T     ML  ++ +  ++   +  G  E +    + +  LA   LQ LP++     VK +        PL  F ++EV+   +++  +R  L ++          +   +    ++    +P+ W + +     T+  W TDL   NE+    +  G     +   FW+ G F+P+ ++TA RQ++ + +  W+L+ + L        S DV +    D+  + S G
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1153.27 bits (2982), Expect = 0.000e+0
Identity = 904/3421 (26.43%), Postives = 1638/3421 (47.88%), Query Frame = 1
            ++Q  ++ +Q KF  + EL+E      +  +  + +++   P+     P+EA + +T ++ K ++L  +            L  + +       +    +EL  ++ +++    V   ++   +  W  +    I Q L +  N+ ++LP   + +++Y+ +++ +  + +   L+ ++   A+  RHW ++  +   +   +  +  L  + +A +L ++  I+ I + A  E  +E  L+ +   W        +++++  L+   D   ++ + +++   +L A+  + Y   F+   Q W +KL     + + W+ VQ  W+YLE +F G  +I+  LP E+ RF  I      +M++    P ++   +      +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F     +  +E+  D+ I A +S+E E V L + ++ +   ++ + D L+     + H++ R  + ++  + F     +T            FP+QV  L  ++ W  + E+ L   K  + + QA     +  L  L     +    I R K E LIT  VH+RD    LV +KI    DF WL+  RFYF  D  Q      C+V + +  F Y  E+LG  +RLV TPLTDRCY+T++QAL   LGG+P GPAGTGKTE+ K +G  LG+FV+VFNC +  D++ +GRI  GL Q G+WGCFDEFNR+E  +LS  +QQI  +    +   +  +   G  ++++   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDR +I +V L S GF     L+ K   L+ LC+EQLS Q HYDFGLR +  VL + G  KR+  D          +E  ++++ + +  + KLV+ED AL  SL+ D+FP +  +     ++   +    ++  LI  D        W  K++QL++   + HG+M +G SG+GKT    VL++A+       G  H    ++ KA++   ++G +D  T +WTDG+F+++ R+     +GE     W+I DG VD  W+ENLNSVLDDNK LTL NG+R+ + PN +IIFEV ++  A+ ATVSR GMV+ S  ++                                      D +P     I R+  L L+T  +    +  + K   SE    +    Q L     ++    IR+ +    GL+   ++I +I++  L  ++  +++W+     + + R  + +FI     + +P       + +Y V   G+W+ W ++VP  +    H      ++VP +D  R + L+     ++K ++L G  G+ KT+ +     +   E ++  ++NFSS+TTP +  RT + Y + R    G    P    + + IF D+IN+P  +++G Q     +RQ++E+ G Y       + ++  IQ + A   P   GR+ +  R  R   I     P   S+ +I+               P V+   + L  A   ++  ++ +      + HYV++ R+L+R  +G+    S+ I      S  +L+ LW HE +R+  DR   + +++W +K +  T E   G+   +   L+    +  +L                  P   E ++ Y  +S RL  +   Y E +    + LV F   + H+++I R+ R ++GH LL+G  G+GK +L+R  ++++G   FQ+ + S         Y  ++  ED++ + R +G   + + F+  ++ + D  FLE LN +L++GE+  LF  DE   ++ ++     KE  +R      S++ L +++  +V++ LHVV   +P G   R R+   P L + C ++WF  W ++AL  V +    T +                  + S P  + AVVNT+ +    V +      ++  R+   TP+ +L FI  +  ++ +KR ++      +N GL K+ E  E V EL K L +K  EL+  ++ A   L ++      A++ K+  + ++      +  ++  K   E  L   +PA+ EA+ A++ IK   +  VK +  PP  +   ++ + IL     ++V  D         W    ++M   +F+T +L F  + +  E++  ME Y    D+        S     +  W +A   + ++  +V PL+  L     +LE    +     +++D +  EL+      + EY + + + + ++ D  + + K+  +  L+  L  ER+RW+  S  F +Q+  LVGD L+ +AFL+Y G ++Q  R+ +   W + +V  G+ F  D+  I  L+      +W +  LP D+L  +N +++ R  RYPL+IDP GQ   +I  +     +Q T+   + FR +LE AL  G  LL++DV E  DP L+ VL +   ++G    + +GD+++D+   FQ+++ T+     ++P++ ++ + ++FTVT   L  Q L  V+ +E+ +++ +R  L++   E   + + LE  LL  L  ++G +++D S+IE L   K  A +V QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T  +KR+  I   L   VFR  +RG   +DK    +LL M+I ++S                      K++E    I GG  LD   VE K           ++ +  K+  F+ +   +  N     +W  +D P E+++P  +D+ +            L+++ +  PDR +  A + +       F +   V+  L  +  E   + P++   + G D +  IE LA + N +  SI++G  +  + A   L  + + GRW+LL+N HL  +++ + LE    +   H  FR ++T E HPK P +IL+      ++P  G++A L R+ + +   +L  T A   +  L+  V +LH  VQER ++ P+GW+  YEF+ +D       +   +D +   R       + W T+  ++ +  YGG++ + +D+ LL+   +N F+ + F       PK+        P+    D+   ++++L     P   GL  NA+ +  T     ML  ++ +  ++   +  G  E +    + +  LA   LQ LP++     VK +        PL  F ++EV+   +++  +R  L ++          +   +    ++    +P+ W + +     T+  W TDL   NE+    +  G     +   FW+ G F+P+ ++TA RQ++ + +  W+L+ + L        S DV +    D+  + S G
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 456.833 bits (1174), Expect = 6.819e-128
Identity = 321/996 (32.23%), Postives = 515/996 (51.71%), Query Frame = 1
            +DT++Q+  + F++K     + L++W         Q +  +R  K ++ F E    L+    + +   HW  +    G       +     +L+     ++ N ++++ +   A  E  I   ++ +T  W+AQ+    +    S G+ L       E ++ ++DS   L +L S+ Y + F  K   W  +L      +     +Q  WIYLE +F  G     LP EA RF  +D  ++ I+    +   +V  C    +L + L  +++QL  CQK+L  +LE+KR  FPRF+F+ D  LLEILGQ+++   IQ H+  +F     V F     + I+++ S E E V L + +     VE WL +L    R++L  +   A   + D+Q  L      +PSQV  L  ++ ++   E  L  S          N     +L +L A T   +  K+   K ++LI   +H  D+ D L+  +  +   + W +Q RFY        ++     +F Y  E+ G   +LV TPLTD+CY+TL+QA+ M LGG P GPAGTGKTE+ K +   +G+ V+VFNC + +D   +GRI+ G+ + G+WGCFDEFNR++  VLS  + QI  +    K R     F  G  V ++P   IF+T+NP   GY GRQ++P+NLK  FR V M  PD  +I    L S GF+  T L++K  ++++L  + LSKQ HYD+GLR +  VL   GA +R   + +E  +V++ L    LSKL   D   F SLI+D+F  +      + ++   +    ++  +   D    K+ QL+E  R R G++ +G +G+GK+    +L R++    +P K  + NPKA+   ++ G +D+ T +W+DGI +   R   K     H W++ DG +D  W+E LNSVLDDN+ LT+ +G+RI    N   +FE  ++  ASPATVSR GM+Y+S   +  + I+ SWL+

HSP 2 Score: 410.994 bits (1055), Expect = 5.428e-114
Identity = 425/1718 (24.74%), Postives = 781/1718 (45.46%), Query Frame = 1
            I RV+    GH  L G  G G++   RL + +   + F   +T+N        ++      +LK     +    + +  +  D++++   FL+ +N++L+SG +  LF + E+D ++  LVS    E   +      LQ++   R+   +HVVL        F+      P ++  C + +  R+ +++L+ +    + +  I +T  +       +  F D++    +N  +       + P  Y  F+  + ++   KR  +     R+  G+ KL EA + V ++ K+   K K L   + +A E L  +    S A+  K  ++ +K   E     I   KA  +E+L+  +P + EA  A+ +IK + ++ ++ L  PP  +  I+  VL LF   LD+            +W+   K +S S     ++NF  + I +E    V  L++   N   F  A+AK  S   A L +W KA   +  I +++ PL+         L+ A K++ N  + L +  + +  ++ ++   M E   ++ D +  +  +  A  L+  L+GE ERW    +TF ++  ++    LI +AF++Y G  ++  R  L +S     + N  P    ++  S+ T+      W  +GLP D+LS++NG I+  +   PL+ID  GQ   ++    EK+   +    +       +E A+  G+ ++I+D+ E  D AL  +L K+    G    +  G K +D    F++Y  T+       P  + + +I++FT TI  L  QLL V I  EK ELE   + L+ +    K + + LE  LL +L S++G+L+E+ +L++ L  +KE+AE + + ++       ++ + ++ Y P++   S L+F    +   N MY  S+   + LF K++   +    +S R+  +   +   VF + +RG +  D+  F +        K  Q K  E    +    + DL+A+     +WI      +L  + + LP  F     Q   +D  W  +  +   E A   +    +  F+K+L I++  P+R       ++ +T+ I         L+ + +E +   P++  L+ G+DP+  +   A   N+   SISMGQGQE+ A + +  S  +G W+ L N HL L  +    + ++ T   HE+FR W+TTEG  +FP  +LQ  +K T++PP G+R  L RTY  + +   ++         +F +A+LH  +QERR F P GW   YEF  SD      FV+    +        W+ V  ++  V YGGR+ +D+D ++L++Y    F  E  N +      KG  + +  ++ EY   I K +P +D P  FGL  N    ++   A++ +++I  +   D+     +  + +  +  L   + Q   LP+   P  ++       S  P++  L  E      +I  +  ++  +  ++    + S  ++  + ++   + P  W  + W   +    + +++ +  +    L+E          P+ F  +  F P  FL A+RQ  +R  K   LD ++LS+  T       +  P+ + V V GL L GA +++    LRE  +    Y+  P+V +   S ++      +      + PVY    R+DL  I  +N+    A D W +  VAL 
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 97.0561 bits (240), Expect = 3.537e-19
Identity = 111/489 (22.70%), Postives = 211/489 (43.15%), Query Frame = 1
             + +F +  P+L  +S  AM  RHW+ I   +    +V+  N L+  L+E   +   ++ E +   A KE+ +E  ++ + + W   +F        GELL     T E+   M+  L     +LS+ +       I+ W+  L      +  +      W  +E VF   DIA Q+P E + F  I   W  I  +  E   +++       L+  L  L       +     YL KKR +FPR F +SD  +L ++  + +    ++++  +F +    TFD+    +I+++ S + E + L +P+N   ++ +VE W+ +L    + +L + IR   + I    +KL   ET    P QV  + +++ +T   E ++ Q+              L IL   + +  ++     L K +R +F   L  I+     + + L+  ++    D+ W  Q R+Y+  +     V      + Y+ + + C

HSP 2 Score: 83.9593 bits (206), Expect = 4.066e-15
Identity = 52/205 (25.37%), Postives = 104/205 (50.73%), Query Frame = 1
            T+    ++++K +  PP+ +   M+ V IL   +   +T +         W    KL+S  +FL  + +F +DT++ + V L+ E Y + E+F+  + K  S    GLC W  A+  +  I+K V P +  L   +  ++  +K+L   ++ L    ++L  +  ++++   +KQ LE    +C  +M  A+ L+  L+GE+++W
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 4636.63 bits (12025), Expect = 0.000e+0
Identity = 2462/4707 (52.31%), Postives = 3213/4707 (68.26%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 4632.78 bits (12015), Expect = 0.000e+0
Identity = 2460/4731 (52.00%), Postives = 3213/4731 (67.91%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 4630.08 bits (12008), Expect = 0.000e+0
Identity = 2463/4728 (52.09%), Postives = 3216/4728 (68.02%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 4622.38 bits (11988), Expect = 0.000e+0
Identity = 2461/4752 (51.79%), Postives = 3216/4752 (67.68%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: kl-3 (gene:FBgn0267432 transcript:FBtr0346771)

HSP 1 Score: 4217.54 bits (10937), Expect = 0.000e+0
Identity = 2209/4514 (48.94%), Postives = 3059/4514 (67.77%), Query Frame = 1
            + +K++ + +++ ++   M+ A      L+ ++  +  ++ P ++ + E+G          +  +FF IL+ +   L +++  + S++    D   +L   + +  +++ A +   T  +L E    +W++QI+ +L E +QI+R+  DVGP   L  W+  ++R+  + E + ++   +    L  ++S + L +W E+D+++T A NEAKDNV+Y+ +L KF+ PL + +P  +I  +P L+ AIR +   + Y+N+   +T L VK++NQ+  T K+++ +                  H K + E Y+  +  T  +++ +S E+ +  S  YI    + F +RL+K+  + N   +YS+L    I G++      K     I  + YD L++R   FD D++ F+ + E  E  +Q F+     +       + +LK+FE   ++CL LD   ++ +V +   + +  ++ +Y + + +P + RNLPP+AG+I W R +FKKI+ PM   K  R  +L   +A + V+ YN M  ++  +E+ Y+  WF  +E  +  L + ++  N    K+ A ++VN D  IL+LI E +++  LNL++P +A+ + + ++ +      +K +L  Y  +  S+ PV   +MR  +  I     P L  +TW S  + DY+EKV   ++        + DI D+RI   +  ++      +PE EP++  EF+  + +   E    L K+S  +E AV DI    ID+L                  K+N T    +     D ++ +Q   K  R +   P                         C+   + +Y+  +    L+  ++ +LD +++ +  ++  +  +PM    +P L   DL +   N    +PNL+ +Q   N AV    +++  +  W       KQ +  E+       D+NK       +S  + + +HKDV +AV  L+  + ++KS ++    + F  Y  LW E+ +  +  F+ T P+  +I     ++ ++  +I +      +G +        + L+SE   WK      L+ +  +++D ++E     +  L +P+ DLDDVR  M  L ++R++ I++++++Q I + Y +  ++ IY    + ++V+ L   ++K+   A+ V D + E++     EL +G+  F +    F  D+D  GPM +GI  +EASDR+ ++Q +FDELWRK+  YS GE+LFGL +TDYP + + ++E N L +LY LY  VL T+  YY++ W+++NI+ I+ +L DFQ +CRKLPK ++ W A+ DL+  IDDFNETCPLLE M++ AM  RHW R+  +    F+  +  F L  L+EAP+L  KE++EDIC+ A KE DIEAKLK + +DWS  S     FK+RG+L+LKG  T EI+S +EDSLM + +L SNRYNAPFK  IQ W+ KL  T +I+E WL+VQNLWIYLEAVFVGGDI+KQLP EAKRF NIDKS+ KIM RA EIPN V CC GD++L+  L  LL+QLE CQKSLTGYLE KRL+FPRFFFVSDP LLEILGQASD  +IQ HLLS+FD   TV F EK  D I ++NS   E V+ +  +   G+VE+WLG LLK  + ++ +++   S+++ND +F   E   SF  Q G++G+Q++WT+DSE AL + +TDK IM+ TN +FL +LN  I +T ++LT ++R +FET++TIHVHQRDIFDDL  L+I +  DFEW KQ+RFY+ ED D  IV ITDV+F+YQNE+LG T+RL ITPLTDRCYITL+QA+GM +GGAPAGPAGTGKTETTKDMGR LGK VVVFNCSDQMD+RGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KE+++ FIF DGD+V ++PEFGIF+TMNPGYAGRQELPENLKI FRTVAMMVPDR IIIRVK+ASCGF +N VLS+K YTLYKLCEEQLSKQVHYDFGLRNILSVLRTLG+ KR NP+D+E  IVMRVLRDMN+SKL+DEDE LF+SL++D+FP +K++T  Y D+  AI K  ++   +N+  W LK++QL+ET  VRHG+M +GP+G+GKT C   ++R  T+ G  HKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRR+ KV + ++ W++LDGPVDA+WIENLNSVLDDNKTLTLANGDRI MA N+K++FE  N+DNASPATVSR GMV+ SSS+L W+  + +WLL        S      + +++ +A+ ++   L  KM  LE  YIRQ +D++ GL+  + ++  K   LE++ +FS+MWSLGA+LEL +R KL+EF+  H   L  P    ++TIFEY V+D G W+HW+ RV E+ YP D IPE+ SILVPNVDN RT FL++ I+KQ K VLLIGEQGTAKTV++K Y G Y+PE  IFKS NFSSATTPNM+QR +ESYV+KR GTT+GPP  R MTIFIDDINMPVINEWGDQITNEIVRQM+E  G YSLE+PGDF+TI+DIQ+++AMIHPGGGRNDIP RLKR   IFNCTLPSN S+D+IF+ +G GYF  +R    +V   +  LV  TR  WQ  K KMLPTPA FHYVFNLRDLSRIW+G+L V  +   S  +++ LW HEC RVI+DRFT + DK WF   + ++  E    E +     EP Y+VDFL+DAPE   EE+EE   E PKIYE I S++ +  +++ +M+Q+NE +RG  +DLVFF DA+ HL+ +SR+I   +G+ALLVGVGGSGKQSLTRL+SFI+GY+ FQ+TLT         SYN  NL EDLK LYRT+G  G G+TF+FT NEIK+ESFLEF+NN+LSSGEIANLFA+DE+DE+  EL+ VMKK  PRRP + +NL ++++SR    LH+ LCFSPVGEKFR RSL+FPGLISGC IDWFQ+WP+DA IAVS ++L+ ++IV + +VK  V++ M    + V E C++Y+ RFRR+T VTPKS +SF+  YK +Y  K++ I  ++ RM++GL KL EA  SV  L K+L    K + +A ++A +VLA VE   +AA+ VK +V   K +AE LV NIS  K +AE KLE A PAL+EAE AL+TIK   IATV+KLG+PP+LI  IMDCV ILF++++  +  D E+   + +WDE++K+MS ++FL  ++ +P D IN E+VD+M PYF    +   +AK   G+VAGL SWT AM+ +F +NKEVLPLKANLAVQ++K + A  +L  A+E+L  K+ EL  VQ     A+ +K A+ D+A+ C+ KM  A ALIGGLAGE+ RWTE   +F  +  +LVGDV+++TAFLSY GPFNQ+FR+ LQ  W  +++   IP + ++  I  LTD + I EWNIQGLP DELS+QNG+I T+A R+PLLIDPQ QGK WI+NKEK +++ VT LNHKYFRNHLED++S+G P++IEDV EE+DP LDN+L++N +K G+ +K+K+GDKEVD    F+ Y+TTKLPNP+YTPE+FA+TSIIDFTVT++GLEDQLLG VIL E++ELE ER +L+E V  N +K KELE NLL +L++T+GSL++D ++IEVL  +K TA +V++K+ I + TE KIN+AREEYR VATRGS+LYFL+  M+ VN MYQTSL QFL  FD SM  S K+ IT KRI  II YLT+E++RY +RG YE DKF F +L+ + I  +   I  +EFQ+FIKGGAAL+LN   P P +W  D TWLNLV+L+ L  F  I  +V+ N++ W TW+  DAPE   IPDGY++L+ F+K+LL+RSWC DRT+   +KYI  ++G RFAE V+ N EE+  E  E  PMICFLS+GSDP+ NIE LAKK  LKC  ISMGQGQE+HARKL+   +++G W+LLQNCHLGL +M E    I   E       ++ +FR W+TTE HPKFPI +LQ+ +K+T +PP GIRAGL+RTY  L+QD LD + +  + P+++ ++FLHT VQERRKFGP+GWNIPYEFN SD+ ++  FVQNHLDD++  +G+SW TV YM+GEVQYGGRVTDDYDKRLLNT+ + WF   +F   F F+KGY + S K  + Y A ID +  +D P+ +G H+NA+I Y+T+    +L  I++IQPK+S  G GE+RE  V R   +ML + P  ++ F+VK+ L  MG+   +NIFL+QE+DRMQ++I +VRS   DL LA++GTIIMSENL+DALDNIF+AR+P+ + + SW S++LGFWFT+LL+R+ QF++W +  RPV FWM+GFFNPQGFLTAMRQE+ R H+GWALD V + NDV K   E+    P EGV+V+GL++DGAGW+ R+++L E   KVL+T +PV+H+YA      +   A  N + Y CPVYKK  RTDLNYI  L L++N+ PDHW LRGVALLCD+K
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 5620.82 bits (14580), Expect = 0.000e+0
Identity = 2762/4467 (61.83%), Postives = 3481/4467 (77.93%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 5425.14 bits (14072), Expect = 0.000e+0
Identity = 2748/4593 (59.83%), Postives = 3479/4593 (75.75%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 3758.38 bits (9745), Expect = 0.000e+0
Identity = 1825/2680 (68.10%), Postives = 2203/2680 (82.20%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2006.49 bits (5197), Expect = 0.000e+0
Identity = 1216/3589 (33.88%), Postives = 1940/3589 (54.05%), Query Frame = 1
            K ++ +I   +++ K    ++  M T  S +QT L  +  +  +W+ E  + ++ + +  P ++  +A I  ++++   +        V  V+    PLK  L+  C+ W++ + Q L+   + ++  +       + RLS+P + L D+   +  L  L+    KIE  I PI E Y +L KYE+  +    E +++L   +   +         L + +   K  LI   + F++   +F+  + S GP    + P  A  +++  + + + L  +      G  +F +E     DI  + K+++ LQ+++++     D    +     + +  + ++           KL +A K+  W+  D  +  I+ F +  PL+  + ++A+  RHW +I       F+  S +F L  ++   L  + E I DI  +A KE  IE  L+ +   W   S   +  K +G   L+G  T E+   +ED+ + L  + ++R+   F+ ++  W + L+   E+IE  L VQ  W+YLE +F+  DI KQL +E   F  +  SW+ IM+R  +  N ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K++  ++       +   + S + E V    P+  +G VE WL D+ +  R +L   +R+ S+ +     K  ++   +P Q+ +   Q+ WT D   AL  SK   DK  +++  ++ + +LN+       NLTKI R K   L+T+ VH RD+   L          F+WL Q R Y+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +D++ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+      N F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF    VL+KK +TLY L  +QLSKQ HYDFGLR + S+LR  G  +R  PD  +  I++  ++DMN++KL   D  LF  +I+DLFP ++  T  Y  +  A++ ++ Q+ L        K+IQL+ET+  RH  M +G +G+GKT     L   ++     GEP     +E  +NPKA++  +++G  +++TN+WTDG+ S+L R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W+P ++SW   +E    V         L++    RY+ +TL+ K       +   E N +     L   L    + +K   + +  +++    +FS++WS+ A ++ E R K+  F+   + + P     + DTI+EY V+ K + W  +  ++P+      + P Y  I+VP VD  R  +L+  +      VLL G  GT KT + +      +       ++N SS T+ N  Q  +ES V+KR+   + P GG+KM +F+DD+NMP ++ +G Q   E++R  ++    Y  +K      I D+ ++ +M  PGGGR  I  RL+ +F++ N T P+ + I +I+     G   +++   F+ +V+     L  AT +L+     + LPTPAK HY+FNLRD+S+++QG+L  + D  ++   +  LW HEC RV +DR  + AD + F   L  K+    +     +   +  P F DFL+++                +IYE +  ++ L   +   +  YN T     + LV F+DA+ H+ ++ RVI   +G+ LLVG+GGSG+QSLTRLA++I  +  FQ+ +T          Y      ED+K LYR +G   K   FLF D +I DESFLE +NN+LSSGE+ NL+  DE+DEI   L    +K+     P  + +  Y + RV   LH+VLC SPVG+ FRNR  ++P L++  TIDWF  WP+DAL+ V+   L    + S   ++  V +        VA+         +R  +VTP +YL  +SGYK++  +KR+E+G   +++  GL K+ +    V  +S EL   +K++   +K+  E L  +  +   A + ++ V    ++ E       A+  N  RD       L+ A PAL+EA +ALE++  + +  +K  GRPP L+  +M  V+IL             R C +PTW EA + +   NF+  L+NF KD I+D V+  +  Y    DF       VS     LC W +AM  +  I + V P +A L    ++L      L  AQ  L    ++LD ++ +Y++ + +K+ L   +E    K+  A  L+ GLAGER RW E     +K +  LVGD L+  AFLSY GPF  + R+ ++   W  ++    +P +   +    L+    + EWNIQGLP+D  S +NG+IVTR  R+PL++DPQGQ   WI+N E    L+V  L    F   LE+A+  G P+L+++V EE+DP+L  +L K+  + G  F +K+GDKE++    F+ Y+TTKL NP YTPE+ +KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK +ELED +L  L    GSL++D  L+  L+ +K TA +V ++L I   TE +I++ARE YRP A R SIL+F++ ++  ++ MYQ SL  ++ LF  S+  S +S    +RINN+  + TY V+RYT RG +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F ++     +  + W  W+ +  PE+A +P  ++N     +K+L++RS   DR       ++   +G +F E  I +++ +  +    TP+I  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +L+   +  G W+ L NCHL L++M E  +++     +  H  FR W+++  HP+FPI ILQ GIK T +PP G++  ++R Y  +++ Q L  +    ++ +LF + F H+ + ERRKF  +GWNI Y FN SDF  +   +  +LD+ +    + W  + ++I  + YGG VTDD+D+RLL TY   +F P + +  F   S    Y +P   S   Y  +I +LP ++ PE FG + NADI  + + A  +  T++++QP+ +      AG +RE  V  L+ D+LQ++P + + +E   KL K   L PLN+ L QE+ R   ++  +R +L++L+  I G ++MS +L++  + I DAR+P  W K       L  W  DL  R EQF  W    R PV FW++GF  P GFLTA+ Q   R +   ++D +     VT     ++   P +GV + GL+L+GAGW+ +++ L E  P  L  P+P +H        PV  + +  +  Y CP Y  P R+      +++  ++LK+   P DHWI RG ALL  +

HSP 2 Score: 140.969 bits (354), Expect = 3.949e-32
Identity = 151/702 (21.51%), Postives = 303/702 (43.16%), Query Frame = 1
            FIR+ D  +T  +  + + F    +  G  ++ L R ++ +  P +     W   S K+ ++++       L RFL  L       DS+ +L       L   +E   +R   AV +   +++LE ++  W +QI+ VLS ++ +    D +GP  E+S+WKSR +  +++  Q++   V  +  IL    S  +  + +L  +I +++ +A+ NV +L  L +    L++  P ++   +  ++N IR+I   S Y+N+ +R+T+L  K++N++I  C         +   L R      +S  + LN+  + C      +    +L    + + +   +  IF   ++F +R   +  +    + ++  +  +   +     R  S  ++ +K  Y                DILD R   +  DY  F  + + LE  +Q  + + FE    +++ + LL  F+ +   + +K     K   V   F   L  +  +  +  S  P+   +P  AG+I W++ L  ++E  M + +     P +    E   +   Y K+ + L E     + +W +++ +     L   L+IR   K K G    +NF+  +L+L  E  Y   L  +IP   + +      + +    +  ++ +Y+ II  +      +    I  +D+   PGL  L W++   P
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2005.33 bits (5194), Expect = 0.000e+0
Identity = 1217/3589 (33.91%), Postives = 1940/3589 (54.05%), Query Frame = 1
            K ++ +I   +++ K    ++  M T  S +QT L  +  +  +W+ E  + ++ + +  P ++  +A I  ++++   +        V  V+    PLK  L+  C+ W++ + Q L+   + ++  +       + RLS+P + L D+   +  L  L+    KIE  I PI E Y +L KYE+   D   E +++L   +   +         L + +   K  LI   + F++   +F+  + S GP    + P  A  +++  + + + L  +      G  +F +E     DI  + K+++ LQ+++++     D    +     + +  + ++           KL +A K+  W+  D  +  I+ F +  PL+  + ++A+  RHW +I       F+  S +F L  ++   L  + E I DI  +A KE  IE  L+ +   W   S   +  K +G   L+G  T E+   +ED+ + L  + ++R+   F+ ++  W + L+   E+IE  L VQ  W+YLE +F+  DI KQL +E   F  +  SW+ IM+R  +  N ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K++  ++       +   + S + E V    P+  +G VE WL D+ +  R +L   +R+ S+ +     K  ++   +P Q+ +   Q+ WT D   AL  SK   DK  +++  ++ + +LN+       NLTKI R K   L+T+ VH RD+   L          F+WL Q R Y+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +D++ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+      N F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF    VL+KK +TLY L  +QLSKQ HYDFGLR + S+LR  G  +R  PD  +  I++  ++DMN++KL   D  LF  +I+DLFP ++  T  Y  +  A++ ++ Q+ L        K+IQL+ET+  RH  M +G +G+GKT     L   ++     GEP     +E  +NPKA++  +++G  +++TN+WTDG+ S+L R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W+P ++SW   +E    V         L++    RY+ +TL+ K       +   E N +     L   L    + +K   + +  +++    +FS++WS+ A ++ E R K+  F+   + + P     + DTI+EY V+ K + W  +  ++P+      + P Y  I+VP VD  R  +L+  +      VLL G  GT KT + +      +       ++N SS T+ N  Q  +ES V+KR+   + P GG+KM +F+DD+NMP ++ +G Q   E++R  ++    Y  +K      I D+ ++ +M  PGGGR  I  RL+ +F++ N T P+ + I +I+     G   +++   F+ +V+     L  AT +L+     + LPTPAK HY+FNLRD+S+++QG+L  + D  ++   +  LW HEC RV +DR  + AD + F   L  K+    +     +   +  P F DFL+++                +IYE +  ++ L   +   +  YN T     + LV F+DA+ H+ ++ RVI   +G+ LLVG+GGSG+QSLTRLA++I  +  FQ+ +T          Y      ED+K LYR +G   K   FLF D +I DESFLE +NN+LSSGE+ NL+  DE+DEI   L    +K+     P  + +  Y + RV   LH+VLC SPVG+ FRNR  ++P L++  TIDWF  WP+DAL+ V+   L    + S   ++  V +        VA+         +R  +VTP +YL  +SGYK++  +KR+E+G   +++  GL K+ +    V  +S EL   +K++   +K+  E L  +  +   A + ++ V    ++ E       A+  N  RD       L+ A PAL+EA +ALE++  + +  +K  GRPP L+  +M  V+IL             R C +PTW EA + +   NF+  L+NF KD I+D V+  +  Y    DF       VS     LC W +AM  +  I + V P +A L    ++L      L  AQ  L    ++LD ++ +Y++ + +K+ L   +E    K+  A  L+ GLAGER RW E     +K +  LVGD L+  AFLSY GPF  + R+ ++   W  ++    +P +   +    L+    + EWNIQGLP+D  S +NG+IVTR  R+PL++DPQGQ   WI+N E    L+V  L    F   LE+A+  G P+L+++V EE+DP+L  +L K+  + G  F +K+GDKE++    F+ Y+TTKL NP YTPE+ +KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK +ELED +L  L    GSL++D  L+  L+ +K TA +V ++L I   TE +I++ARE YRP A R SIL+F++ ++  ++ MYQ SL  ++ LF  S+  S +S    +RINN+  + TY V+RYT RG +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F ++     +  + W  W+ +  PE+A +P  ++N     +K+L++RS   DR       ++   +G +F E  I +++ +  +    TP+I  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +L+   +  G W+ L NCHL L++M E  +++     +  H  FR W+++  HP+FPI ILQ GIK T +PP G++  ++R Y  +++ Q L  +    ++ +LF + F H+ + ERRKF  +GWNI Y FN SDF  +   +  +LD+ +    + W  + ++I  + YGG VTDD+D+RLL TY   +F P + +  F   S    Y +P   S   Y  +I +LP ++ PE FG + NADI  + + A  +  T++++QP+ +      AG +RE  V  L+ D+LQ++P + + +E   KL K   L PLN+ L QE+ R   ++  +R +L++L+  I G ++MS +L++  + I DAR+P  W K       L  W  DL  R EQF  W    R PV FW++GF  P GFLTA+ Q   R +   ++D +     VT     ++   P +GV + GL+L+GAGW+ +++ L E  P  L  P+P +H        PV  + +  +  Y CP Y  P R+      +++  ++LK+   P DHWI RG ALL  +

HSP 2 Score: 107.071 bits (266), Expect = 7.075e-22
Identity = 147/704 (20.88%), Postives = 282/704 (40.06%), Query Frame = 1
            FIR+ D  +T  +  + + F    +  G  ++ L R ++ +  P +     W   S K+ ++++       L RFL  L       DS+ +L       L   +E   +R   AV +   +++LE ++  W +QI+ VLS ++ +    D +GP  E+S+WKSR +  +++  Q++   V  +  IL    S  +  + +L  +I +++ +A+ NV +L  L +    L++  P ++   +  ++N IR+I   S Y+N+ +R+T+L  K     I  C+              R E  +R+            CF     +L  + T+K       YI   F+   K L  + ++Q+IL                                    D R   +  DY  F  + + LE  +Q  + + FE    +++ + LL  F+ +   + +K     K   V   F   L  +  +  +  S  P+   +P  AG+I W++ L  ++E  M + +     P +    E   +   Y K+ + L E     + +W +++ +     L   L+IR   K    + +  K+    +T IL+                   L  E  Y   L  +IP   + +      + +    +  ++ +Y+ II  +      +    I  +D+   PGL  L W++   P
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: ENSXETT00000021690.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 5562.65 bits (14429), Expect = 0.000e+0
Identity = 2808/4621 (60.77%), Postives = 3544/4621 (76.69%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 5039.55 bits (13071), Expect = 0.000e+0
Identity = 2496/3647 (68.44%), Postives = 3001/3647 (82.29%), Query Frame = 1

HSP 2 Score: 321.627 bits (823), Expect = 1.246e-86
Identity = 169/344 (49.13%), Postives = 225/344 (65.41%), Query Frame = 1
            DG  N +I E+ + LD+F+  L +A+ N++ +++L+  D  + +  +  PS  + A  +SE +EKLE +L  WIKQIEQVL+ESEQ+R+EADD+GPS                                              D  +T+AANEAKDNVKYLYTLDKFFGPL K +PV    HI  L+N+IRMI+S SQYYN+SE MTSLF+KVTNQ ++TCK ++  GV KIWDL R+EL +RI  C  LNE+Y+  FHK K+KL+E   E+QFEFSENYIFGK + FCKRL+KI+++ N LES + LQT KIEG++ I +RY++I    K K+YD+LDHRK E

HSP 3 Score: 76.6406 bits (187), Expect = 1.432e-12
Identity = 33/84 (39.29%), Postives = 58/84 (69.05%), Query Frame = 1
            E  K++++YNKMA VL+EFEL+Y+  W K  +  K GL +SLL+R+P+ +    +  VN D M++E++ E KY++ +  ++P++
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 5034.93 bits (13059), Expect = 0.000e+0
Identity = 2500/3648 (68.53%), Postives = 3003/3648 (82.32%), Query Frame = 1

HSP 2 Score: 398.667 bits (1023), Expect = 5.826e-110
Identity = 230/551 (41.74%), Postives = 321/551 (58.26%), Query Frame = 1
            DG  N +I E+ + LD+F+  L +A+ N++ +++L+  D  + +  +  PS  + A  +SE +EKLE +L  WIKQIEQVL+ESEQ+R+EADD+GPS                                              D  +T+AANEAKDNVKYLYTLDKFFGPL K +PV    HI  L+N+IRMI+S SQYYN+SE MTSLF+KVTNQ ++TCK ++  GV KIWDL R+EL +RI  C  LNE+Y+  FHK K+KL+E   E+QFEFSENYIFGK + FCKRL+KI+++ N LES + LQT KIEG++ I +RY++I    K K+YD+LDHRK E        +V   T                   ++ +NLLKKFE+I    LD  +K+  VLQ +S+ LD VRKLYQK K +                                 T        E  K++++YNKMA VL+EFEL+Y+  W K  +  K GL +SLL+R+P+ +    +  VN D M++E++ E KY++ +  ++P++
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 4972.53 bits (12897), Expect = 0.000e+0
Identity = 2478/3647 (67.95%), Postives = 2976/3647 (81.60%), Query Frame = 1

HSP 2 Score: 371.703 bits (953), Expect = 8.201e-102
Identity = 213/495 (43.03%), Postives = 288/495 (58.18%), Query Frame = 1
            + + E +EKLE +L  WIKQIEQVL+ESEQ+R+EADD+GPS                                              D  +T+AANEAKDNVKYLYTLDKFFGPL K +PV    HI  L+N+IRMI+S SQYYN+SE MTSLF+KVTNQ ++TCK ++  GV KIWDL R+EL +RI  C  LNE+Y+  FHK K+KL+E   E+QFEFSENYIFGK + FCKRL+KI+++ N LES + LQT KIEG++ I +RY++I    K K+YD+LDHRK E        +V   T                   ++ +NLLKKFE+I    LD  +K+  VLQ +S+ LD VRKLYQK K +                                 T        E  K++++YNKMA VL+EFEL+Y+  W K  +  K GL +SLL+R+P+ +    +  VN D M++E++ E KY++ +  ++P++
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 4969.06 bits (12888), Expect = 0.000e+0
Identity = 2474/3648 (67.82%), Postives = 2970/3648 (81.41%), Query Frame = 1

HSP 2 Score: 558.525 bits (1438), Expect = 2.051e-158
Identity = 286/515 (55.53%), Postives = 383/515 (74.37%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 5479.45 bits (14213), Expect = 0.000e+0
Identity = 2786/4616 (60.36%), Postives = 3500/4616 (75.82%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 2004.95 bits (5193), Expect = 0.000e+0
Identity = 1227/3594 (34.14%), Postives = 1950/3594 (54.26%), Query Frame = 1
            L+   +D+ K  +Q+S  M    S +Q  L  +  Y  +W+    + ++ + +  P +S  +A I  ++++   +        +  V+     LK  L+  C+ W+  +   L    A  +  +       ++++S P + L+++   +  +  L+     +E  I PI E + +L KYE+   D   E ++SL   +   +      +  L + + KFK  LI     FK+   + + D++ +GP    +    A D++   +     +  +         +F +E     D+Q + KEL+ LQ+++++  +  ++ N +    +  +  + +         +  +L K  K+  W+  +  R  I+ F  T PL+  + + A+  RHW++++     +F+ +S++F L  +++  +  + E+I +I  SA KE  IE  L+ +   W +       +K +G   L+G  T E+   +ED+ +AL  + ++R+   F+  +  W + L+   E+IE  L VQ  W+YLE +F+G DI KQLP E+  F  ++ +W+ IM R ++  N ++       L + L  +   LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K +   +KV       + + + S + E +    P+  +G VE WLGD+ +  R +L  ++R+  + +     K  ++   +  QV +   Q+ WT D  + L  +K  +DKKI++ +      ILN+       NLTKI R K   L+TI +H RD+ + L    +     F+WL Q RFY+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +DY+ +GR+Y GLAQSG+WGCFDEFNRI + VLSV AQQI  +L+       +F F +G  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF    +L+KK YTLY L  +QLS+Q HYDFGLR + S+LR  G  +R  PD S+  +++  +RDMN++KL   D  LF ++++DLFP +++    Y  +   I+++I +  L    P+ L K++QL+ET+  RH  M +G +G+ KT    +L  ++T     GEP+    +E  +NPKA++  +++G  D+ TN+WTDGI S++ R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV N+  ASPATVSR GMVY     L W+P ++SWL      +    T +   + +F    +++ + LS K     CN             + +   +LA   +G++  + +  +  +E   VFSM+WS+ A ++ + R K+  ++   + + P     + DT++EY VN K   W  +  ++P+ + YP +    +  I+VP VD  R ++L++T+      VLL+G  GT KT I +         Q     +N S+ TT N  Q  +ES V+KR    + P GG+ M  F+DD+NMP  + +G Q   E++R  ++    Y   K      I D+ ++AAM  PGGGR  I  RL+ +F+I N T P+ +   +I RI G       + F+ +V+   N +  AT  ++     + LPTPAK HY+FNLRD+S+++QGML  N D  ++ + +  LW HEC RV +DR  + AD + F   L         +T    C +      +  P F DFL++                PK+YE +     L   +   + +YN +     + LV F++A+ H+ +I RVI   +G+ LLVG+GGSG+QSL RLAS I  Y TFQI +T     KH   Y      +D+K LYR +G   +  +FLF D +I DESFLE +NN+LSSGE+ NL+  DE +EI   ++   + E  + P S+++L  Y + RV   LH+VLC SPVG+ FRN   ++P L++  TI+WF  WP++AL+ V+  ++   ++ +   + + V          VA+         RR  +VTP +YL  +SGYK++  +KR+E+   A ++ TGL K+ E  E V  +S EL   +K++   +K+  E L  +  +   A + ++ V    ++        +AL +N  +D   A   LE A  AL+       ++  + I  +K  GRPP  +  +M  V+IL                 +PTW EA + +   NF+ SL+NF KD I+D+V+  +  Y    DF       VS     LC W +AM  +  + + V P +  +    ++L+     L  AQE L    ++L++++ +Y++ + +K+ L   +E    K+  A  L+ GLAGE+ RW E  +  ++ +  LVGD LI  AFLSY GPF  ++R+ I+ + W  ++    +P +      + LT+   + +WNIQGLP+D  S +NG+IVTR  R+ L+IDPQGQ   WI+N E N  L++  L  H Y R  LE A+  G P+L+++V E +DP L+ VL K+  + G    +++GDKEV+    F+ Y+TTKL NP Y PE  AKT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK KELED +L  L    GSL++D  L+  L+ +K TA +V ++L     TEI I+ ARE YRP A R S+L+F++ +M  ++ MYQ SL  ++GLF  S+  S +S     RI  + +Y TY V+RYT R  +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F  +     +  + W  W+ + +PE+A +P  ++N     +++L++RS   DR       +I   +G RF E  + N++ + E+    +P++  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +LL   + +G W+ L NCHL L++M   D+ +E +   E+ H SFR W+++  HP FPI+ILQ  IK T +PP G++A + R Y L+T+ Q    +   ++K +LF + F H+ + ER+KF  +GWNI Y FN SDF  +   +  +LD+ +      W  + Y+I  V YGG VTDD+D+RLL TY  ++F        F   S    Y IP   SL  Y+ +I  LP +D PE FG H NAD+  + + A  +  T++++QP+ +     G++RE  V  LA D+ Q++PE  + +E   KL  +    PLN+ L QE+ R  K++  +  +L DL+  I G I+MS +L++  + IFDA +P  W K+      L  W  DL  R EQF +W    R PV FW++GF  P GFLTA+ Q   R +   ++D++     V+     ++   P +GV+V GLYL+GAGW+ +++ L E  P  L   +P +H        P   + K+ +  Y CP Y  P R   TD  +++  ++L++     DHWI RG ALL  +

HSP 2 Score: 103.99 bits (258), Expect = 6.000e-21
Identity = 78/275 (28.36%), Postives = 135/275 (49.09%), Query Frame = 1
            FIR     +T  N    + +  +    G  + AL R +S +  P +   + W          S  + F   L RFL +L       D++ +LE          + IP+  +     V V   E +++LE  +  W +QI++VLS  E +    +++GP  E+ +W +R    +++ +Q+  K V  + +IL  AKS  L  +R+L  +I D + +A+ N+ +L  L + +  L+   P D+ E +P LI+ IR+I   S +YN+ ER+T+LF KV
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q8TE73|DYH5_HUMAN (Dynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3)

HSP 1 Score: 5509.88 bits (14292), Expect = 0.000e+0
Identity = 2802/4622 (60.62%), Postives = 3524/4622 (76.24%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q8VHE6|DYH5_MOUSE (Dynein heavy chain 5, axonemal OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2)

HSP 1 Score: 5479.45 bits (14213), Expect = 0.000e+0
Identity = 2786/4616 (60.36%), Postives = 3500/4616 (75.82%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q91XQ0|DYH8_MOUSE (Dynein heavy chain 8, axonemal OS=Mus musculus OX=10090 GN=Dnah8 PE=1 SV=2)

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q96JB1|DYH8_HUMAN (Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2)

HSP 1 Score: 5316.9 bits (13791), Expect = 0.000e+0
Identity = 2688/4528 (59.36%), Postives = 3428/4528 (75.71%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|M0R8U1|DYH5_RAT (Dynein heavy chain 5, axonemal (Fragment) OS=Rattus norvegicus OX=10116 GN=Dnah5 PE=1 SV=1)

HSP 1 Score: 3834.65 bits (9943), Expect = 0.000e+0
Identity = 1994/3455 (57.71%), Postives = 2554/3455 (73.92%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A267GIL0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012039g4 PE=4 SV=1)

HSP 1 Score: 6548.76 bits (16989), Expect = 0.000e+0
Identity = 3232/4635 (69.73%), Postives = 3853/4635 (83.13%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A267GLR3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012039g1 PE=4 SV=1)

HSP 1 Score: 6546.84 bits (16984), Expect = 0.000e+0
Identity = 3231/4635 (69.71%), Postives = 3853/4635 (83.13%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A1I8IQE7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 6496.38 bits (16853), Expect = 0.000e+0
Identity = 3206/4646 (69.01%), Postives = 3828/4646 (82.39%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A1S3K0Z9 (dynein heavy chain 5, axonemal-like OS=Lingula unguis OX=7574 GN=LOC106177909 PE=4 SV=1)

HSP 1 Score: 6468.26 bits (16780), Expect = 0.000e+0
Identity = 3215/4636 (69.35%), Postives = 3836/4636 (82.74%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A2R2MR46 (dynein heavy chain 5, axonemal OS=Lingula unguis OX=7574 GN=LOC106157149 PE=4 SV=1)

HSP 1 Score: 6458.63 bits (16755), Expect = 0.000e+0
Identity = 3186/4562 (69.84%), Postives = 3797/4562 (83.23%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4672.46 bits (12118), Expect = 0.000e+0
Identity = 2366/3670 (64.47%), Postives = 2884/3670 (78.58%), Query Frame = 1

HSP 2 Score: 511.146 bits (1315), Expect = 2.803e-144
Identity = 274/665 (41.20%), Postives = 411/665 (61.80%), Query Frame = 1
            M+D +G  LL + E+ +S++  P L+N+   WG +++      K  +F   L+ F++ L  AQ++++ ++   N       A +     R +++   E         H      EQVL+ES+Q+R+E DD+GP AEL +WK RMSRFN LL+Q+K+  V  V+ +L  AKS+ ++ WRELD RITD+ANEAKDNVKYLYTL++FF PL   NPV M+E I  LINAIRMIHSIS+YYN+SE++TSLFVKVTNQMIT CK ++   G + IWD  ++ +A++I    RLNEEY+ CFHKTK+KL++  +E+QF+FSE YIFGKF+ F +RL+KI  + + + +YS LQ  KIEG++++  R ++I   +KKK Y  LD R+++FD DY++F  Q   L              S+P                  L  ++K+ K  QN+S+ ++ V ++Y K K +PP+ RNLPP+AGKI WSR L+ +IE PM LF++  P +L  PEA ++++NYN++AK L+E+E+IY+  W   +   ++GL +SLL+R PD      +  VNFD  IL  I+E   I  + L+IP  A+ L   +N++K  Y  ++  L         + P    M+ PH+ ++DE   PGL +L W+S+ I  ++ +V  +L
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3679.8 bits (9541), Expect = 0.000e+0
Identity = 1823/2682 (67.97%), Postives = 2185/2682 (81.47%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 3658.61 bits (9486), Expect = 0.000e+0
Identity = 1835/2680 (68.47%), Postives = 2183/2680 (81.46%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2023.44 bits (5241), Expect = 0.000e+0
Identity = 1231/3602 (34.18%), Postives = 1949/3602 (54.11%), Query Frame = 1
            K ++ +I   +++ K  + ++  M    S +Q  L  +  +  +W+    + ++ +    P +S  ++ I  +S++   +        V  V+    PLK  L+  C+ W+  + Q L+   +  +  +       + RLS+P + L ++   +  L  L+    KIE  I PI E + +L KYE+       + +++L   +   +         L + + KFK  L    + FK+ + + + D++S GP    +    A +++++ + + + L  +  T   G  +F  E     D+Q + K+++ L ++++        ++  +D  W E            N+++  Q +    NK  +  K  K+W+  +  +  I+ F  T P++  +   AM  RHW +I+      F+ +S  F L  ++   L  + E I +I  +A KE  IE  L+ +   W   S   + +K +G        T E+   +ED+ + L  + ++R+   F+ ++  W + L+   E+IE  L VQ  W+YLE +F+G DI KQLP E+  F +I+ SW+ IM R ++  N ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K++  ++   +K  A    S + E V+   P+  +G VE WL D+ +  R +L   +R+    +     K  ++   +P Q+ +   Q+ WT D  + L   K   DK  +++  ++ + +L+        NL+KI R K   L+T+ VH RD+ D L          F+WL Q R Y+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCSD +DY+ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+        FIF   D+  +    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L   GF    VL+KK +TLY L  +QLSKQ HYDFGLR + S+LR  G  +R  PD ++  I++  ++DMN++KL   D  LF  +I+DLFP ++  T  Y  +   I++++ Q+ L        K+IQL+ET+  RH  M +G +G+ K+    +L +A++     GEP      E  +NPKA++  +++G  D++TN+WTDG+ S+L R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W+P ++SW+      D      ++  K +F    RY+ +T+S K           E N +    +  D LA   +G++    E     +E   +FS++WS+ A ++ + R K+  F+   +        + DTI+EY V+ K + W  +  ++P+ + YP++    +  I+VP VD  R  FL+N++      VLL G  GT KT + +      +P +    ++N SS TT N  Q  +ES V+KR   T+ P GG+KM  F+DD+NMP ++++G Q   E++R  ++    Y      D    +D+ ++A+M  PGGGR  I  RL+ +F++ N T P+ + I  IF   G       + F+ +V+   + L  AT +L+     + LPTPAK HY+FNLRD+S+++QG+L  + D  ++   +  LW HEC RV +DR  +QAD + F   L     E+ GS        +   + +P F DFL++                P +YE +  ++ L   +   +  YN T     + LV F+DA+ H+ ++ RVI   +G+ LLVG+GGSG+QSL+RLA++I  Y  FQ+ +T          Y      ED+K LYR +G   K   FLF D +I DESFLE +NN+LSSGE+ NL+  DE +E+   L    +KE      + + +  Y + RV   LH+VLC SPVGE FRNR  ++P L++  T+DWF  WP+DAL+ V+  +L    + +  +++  V          VA+         +R  +VTP +YL  +SGYK++  +KR E+G   +++  GL K+ +    V  +S EL   +K++   +K+  E L  +  +   A + +  V    +       + +A+  N  RD       L+ A PAL+EA +ALE++  + +  +K  GRPP L+  +M  V+IL             R C +PTW EA + +  SNF+  L++F KD I+D V+  +  Y    DF       VS     LC W +AM  +  I + V P +A L    ++L   + A+ E  N +  ++ K K+L   + +Y++ +++K+ L   +E    K+  A  L+ GLAGER RW +  ++ +K +  LVGD L+  AFLSY GPF  ++R  +L   W  +     +P +      + L+    + +WNIQGLP+D  S +NG+IVTR  R+PL++DPQGQ   WI+N E    L+V  L    F   LE+A+  G P+L+++V EE+DP+L  +L K+F   G    +K+GDKEV+    FQ Y+TTKL NP YTPE+  KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK +ELED +L  L    GSL++D  L+  L+ +K TA +V  +L     TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+ S+  SQ+S    +RI N+ +Y TY V+RYT RG +E  K  F+  +  KI   +G++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F  +     K  K W  W+ S  PE A +P  ++ +    +K+L++RS   DR       +I   +G RF E  + +++ + E+    TP+I  LS G DPT  + +LA+   +     ++S+GQGQ   A +++   ++ G W+ L NCHL L++M +  +++     E+ H  FR W+++  HP+FPI ILQ GIK T +PP G+++ ++R Y L+T+ Q    +    ++ +LF + F H+ + ER+KF  +GWNI Y FN SDF  +   +  +LD+ +    + W  + Y+I  V YGG VTDD+D+RLL TY  ++F     N  F   S    Y IP   S D YR +I +LP ++ PE FG H NADI  + S    +  T++++QP+    +  GAG +RE  V  ++ D+ Q++PE  +    ++ LQ   S  PLN+ L QE+ R   ++  +R++L +L+  I G ++MS +L++    I DAR+P  W K       L  W  DL  R EQF  W      PV FW++GF  P GFLTA+ Q   R H   ++D +     V+     ++   P +GV++ GLYL+GAGW+ +++ L E  P  L  P+P +H        PV ++ K  +  Y CP Y  P R+      +++  ++LK+     +HWI RG ALL  +

HSP 2 Score: 86.6557 bits (213), Expect = 8.449e-16
Identity = 50/159 (31.45%), Postives = 86/159 (54.09%), Query Frame = 1
            VA    E ++++E ++  W +QI++VL+  E +    D  GP  E+ +WKSR S  + + +Q++   V  +  IL  AKS  +  +  L  +I D   +A+ N+ +L  L +    L+   P ++   +  +IN  R+I   S YYN+ ER+T+LF KV

HSP 3 Score: 66.2402 bits (160), Expect = 1.093e-9
Identity = 76/336 (22.62%), Postives = 140/336 (41.67%), Query Frame = 1
            +++     ILD R + + + Y  F  + + LE  +Q  ++T F+    +++ + LL  F+ +   + +K     K   V    SK +  V K L Q +                  W+R + ++I+G M +        L   E  K V+    ++ + L E     Y+ W ++++   L  L   L+IR   KEK G    +NFD  +L++  E  Y   L  +IP   S        ++     +  ++ +Y+ II ++      + R  I  +D+   PGL  L W+S    ++       +   RL   KV  I+D   E    ++A++  C
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1937.15 bits (5017), Expect = 0.000e+0
Identity = 1346/4430 (30.38%), Postives = 2247/4430 (50.72%), Query Frame = 1
            S R+  +     +  +E+++  W  QI  VL  +S +   E  +  P  EL++WK+R +    + +Q K+ KVT +  +L   +S     +R +   +  A  EA D       ++ F  PL +     + E + S           +++ N  ER+  L   V   +    KH  Y   +++  L +E                 FC    ++ + ED      ++  N                  ++ +L   +++   K+E ++   VR +S++  +               +K+YD LD    EF+ D+ DF  + E  + ++ A     F+ S  ++    +         +++   +     L  +S                 P+ +N+P +AG + W++ L ++I+                  A K V                         E  +  L   L+ R+P          VNF+  ++ +++E KY+++  + DIP++ + +  N+ ++      +  ++  Y+++I +V  V FP+++  +  ID         + WTS  I +Y++ VRE++      ++K  D +D  I++++   A  V    D   D  + +E+     E+T  +     AK           I  +LK NL+                + DP            + + + Y  +           + +D     + SS  KF +D  N D++P    LF+A L L + +++  P+L     D    ++   +  + ++S  + +   H    H Q  ++E +A+             +  + +L+ +   V + ++Q     N F+          +  + +F  Y   L  EE +    E + +  P L     Q+  +  M  E+    P +   G +   +   K  L++    W   + Q L +     +  + E        L   V++ D   +   M  L  ++E +   +   +P++    +L  YE    D   ++++ L   +  ++ QA  V+ H+  +Q      L      F      F   +   GP    IV P E  D       + + +  K    +G   LF + + DY  +++ RKE+++L++L+ + + V   + ++    W EIN++ +  +   F  + R L K  + W A+  L  T+ +   +   + ++ + A+ PRHW+++ T TG +F +D ++  L +L+   L   ++E+  I   AVKE  +E  L  +   W+A  F + S       LLK D   ++V  +ED+ + L  L+S+++ A F  ++  W ++L+    +I  W  VQ  W +LE++F+G  DI  QLP+++KRF  ID  ++++   AH+ PNVV+       L   L  +  +L LC+K+L  YL+ KRL FPRF+F+S   LL+IL   +D H +Q HL  +FDNT  + F    D K     + + S+E E V  +EP +  G VE+WL  +L   R ++   +  A +   D   + + F+  +P+QV L   Q+ WT D   A ++ +   +  M+   ++ +  LN LI +    L+  +R K  T+ TI VH RD+   ++  K+   + F WL Q R  + E    C  +I D  F+Y  E+LG T RLVITPLTDRCYITL+Q+L +++ GAPAGPAGTGKTETTKD+GR LG  V VFNCS+QMDY+  G IYKGLAQ+G+WGCFDEFNRI + VLSV A Q+  +    +++K +F F  G+ +++ P  GIF+TMNPGYAGR ELPENLK  FR  AM+VPD  +I  + L + GF++  +L++KF TLY+LC+E LSKQ HYD+GLR I SVL   G+ KR +P+  E  ++MR LRD N+ K+V +D  +F+ LI DLFP + V  K   D    + + +   KL   D + LK++QL E   VRH +  +G +G GK++ +  L +   +         +NPKA+T  ++FG ++ AT +W DG+FS + R    V      W++LDG +D +WIE+LN+V+DDNK LTLA+ +RIP+ P  +++FE+ ++  A+PATVSR G++Y++ + L W P + SW+   E     +N       ++F +       TL  +   +     +  + +L  L+  +   E       K       VF+ +W+ G  L   +L D R++  + ++T  K +  P      T+F+Y ++ +  ++E W+  VP +   +  IP   + LV   +  R  + +  + ++ + ++L+G  GT K+V+V G  G  +P++   K++ F+  TT  M Q  LE  ++K+ G  +GPPG +++  FIDD+NMP ++ +G    + ++RQ M+    Y   K      I  +Q ++ M +P  G   I  RL+R FS+F  + P   +++ I+  +  G   +  GF   VQ +   LV       Q+     LPT  KFHY+FNLRDLS I+QGML   S+ + +   L+ ++ HE  RV  D+  E  D   F+K           SE+V     +    + L++A       +    +  P+ Y P++S+E L+  L++ +  YNE      ++LV F DAM+H+ +I+R++ + +G+ALLVGVGGSGKQSLTRLA+FIS  E FQITL           Y +++L  DL  L   +G    G  FL TD ++ DE FL  +N++L+SGEI +L+  DE++ I+  + + ++ +      S EN  ++++ RV + L V LCFSPVG K R RS +FP +++   IDWF  WP++AL +VS  FL   E +  PEVK +V   M      V +   +Y    RR  + TPKS+L  I  Y+ +   KR+++     R+  GL+KL   +  V++L  +LA +E +L+   + A  ++  V V+     + K      +++  ++   ++R +   EE L  A+PAL  A+EAL T+   ++  +K  G P   +  +   V++L           P    PK  +W  A  +M+  + FL SL+NF K+ I++  +  ++PY    +F        S   AGLCSW   +  F+ +  EV P +  L    ++L  A ++L+  +  ++   + L  + A++ KA  +K   + +AE   R ++ A  L+GGLA E  RW EA   F +Q + L GDVL++TAF+SY G F + +R+ ++  +WK  L  +   IP T  +  +SML D+A ++ W  +GLP D +S +N  I+T   R+PL++DPQ QG  WI+NK  ++ LQV  +  + + + +E ALS G  +LIE++ E +DP L  +L +  IK G    +K+GDKE +    F+L + TKL NP Y PE+ A+ ++++FTVT  GLEDQLL  V+  E+ +LE  ++ L ++    K   K LEDNLL RL+S  G+ + D  L+E L +TK TA ++++K+   + TE KIN ARE YRP A R S+LYF++ +++ ++ MYQ SLK F  +F K++  +       +R+ N+I+ +T  VF+YT RG +E DK T+T  L  +I + + +I   E    ++         V+P    P  ++   +W  +  L  +  F+ +   +  + K WK + + + PE+   P  + N  + +KL ++R+  PDR     + ++EE +G ++  G   +     EE    TPM   LS G DP  ++E+  +       N    ++S+GQGQEV A + L ++ +EG W++LQN HL    L  +++ LE     E   ++FR +++       EGH   P  IL+  IK T +PPLG+ A L +      QD L++     ++K +LF + + H  V ERRKFGP GWN  Y FN  D T +V  + N+L   +    V +  + Y+ GE+ YGG +TDD+D+RL  TY + +  PEM   +     G+P+P     + Y  +ID     +SP  +GLH NA+I + T  + ++  T++ +QP+D  SG G+G +R+  V  + ++ L++LPE++N  E+  K+++     P  +   QE +RM  +   ++ +L +L L + G + M+ ++++  + I+  ++P  W K ++ S   L  WFTDLL+R  +  SW  +   P   W+ GFFNPQ FLTA+ Q   R ++ W LD + L  DV K  +ED ++ P EG YVHGL+++GA W+ ++  + +   K L   +PV+ + AV V+       +     Y+CPVYK  R+    Y++  NLKT E P  W L GVALL  I
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 4032.64 bits (10457), Expect = 0.000e+0
Identity = 2064/3470 (59.48%), Postives = 2637/3470 (75.99%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2659.4 bits (6892), Expect = 0.000e+0
Identity = 1362/2030 (67.09%), Postives = 1636/2030 (80.59%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2657.86 bits (6888), Expect = 0.000e+0
Identity = 1362/2030 (67.09%), Postives = 1638/2030 (80.69%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001365.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2633.98 bits (6826), Expect = 0.000e+0
Identity = 1368/2041 (67.03%), Postives = 1643/2041 (80.50%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001375.1 (pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2613.18 bits (6772), Expect = 0.000e+0
Identity = 1359/2044 (66.49%), Postives = 1624/2044 (79.45%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 644/2685 (23.99%), Postives = 1217/2685 (45.33%), Query Frame = 1
            +D L   +S LR     V+  L + +      L EGV+       S    +  R P++  + P EA   L  +     +L +K  + +   ++  + V     +  + +E+     +++   N+ + V   ++  W  +++  +   L +F  +  +LP+A+K+++ Y  L   ++       +L ++   A+ PRHW  I    G     K  +D   F L+++M   L  N+  +  I   A KE  IE  L  +   W    +      S  +L+ + D   +     ++ L  L ++ ++ Y   F+    +   KLT  +EI  NW+ VQ  W+ L  +     DI   LP E  +F ++   ++ I  RA ++   ++  +        L   ++ L++ + SL+ +LE++R  FPRF+F+ +  LL+I+G       +   +  +F + +++ F E   D I  + S E E + L+E I  + +++   WL  L    + S+ +  R     + D    +    + +  Q  LL  Q++WT   E+ L  ++  K  K +    +  LD LN+    ++ N+ K    K E L+  ++H  ++   L            W K  +FY K DT    +   +S +     Y+ E++G  +RL+ TPL    + TL+ +L    GG   GPAGTGKTET K  G+ LG+ VVVFNC D  DY+ L R+  G+ Q G+WGCFDEFNR++  VLS  +  I  +    +  K+     + +   + P   +F+T+NPGY GR ELPENLK +FR  +M  P    I  + L   GF  +  L+ K     +L   + S   HY FGLR +  VLR       E  +  +   V+  L+ + L  L D DE +F   +  +F        +   +    D   +++     + +  K +Q +  Q+ +  ++ +G +G GKT     ++ AM    G  +    ++ K +T   ++G +  AT +W DG+F+++ RR +       K   IW++ D  +D  ++E +NSVLDDNK LTL NG+R+P+ PN +I+FE  N+D+ +PAT++R G+++ S+ +      +    L+ ++ +A+ N +    L+  K + S+++   +     T S  +V +      N +  A+ L   L+         +D K +K   +  LI  S++++L      E +    + I            D  TI   + NDK  +  + + +P  +    H      I++P +D  + + +   +    + ++L G  G+ KT+I+       N        +NFS  TT       L    +YV    G T  P    + + +F D+IN+P ++++G Q     +RQ+ME  G +   +   + TI  I I+ A   P   GR  + +R  R  +I     PS  S+ +I+ I    Y+       P+ +        A+  L+ + K +   T  + HY+F+ R+L+R+ +G+       IN+G +     L+ LW +E  R+  DR     +K+ FE+ L  T ++   ++ +  + +                                ++  E     L+ ++ +  +T    +L+  +V  +  + H+++I R ++  +GH +L+G   +GK  LTR  ++++G +  Q  +  +S        N+S+    LK               +  ++ I + +FLE +N +L++ +I +LF  +E D++L  L +   +       + + L ++++  + K LHVV           +  +  P L + C I+W   W    +  V+N  +    +  T    PEV K +V T  I   +D V    I    N++Q+ +    V P+S   FI G +   ++   K +++      +N GL+KL E+   VNEL+K L+ K  EL    K+A   L ++ ++ + +++ +E  + +K   +    +I + K +  + ++  +P + EA+  ++ IK Q +  ++ +  PP  +  +M+ V  +   +  +             W +  + +   +F+ +++++       P+     E   L +P F  E  N AS          L  W  A  +F  + + V PL+  +     ++EF  + L     +L A++   D+ +A    +  +   L  D EA + +M+N +A       L+  L  E+ERW   +K F K  ++L+G+ +I + + +Y G  N+  R  +    K  L    + +  +   I  L       +W   GL  ++  ++N  IV  +    P L+DP     + I N   N  + ++ L   + +  LE+A+  G  ++I+D GE  DP +  ++ + F  +G+   V++GD EVDV   F+L++ +  P+      + ++  ++ F    + +E ++  + +  E  E++ +R  L++   E K K K LE  LL  L +++G+++E++ L+  L   K+ A ++++KL    +   + ++  EEY  +      ++ ++ +    +  Y  S+ QFL  F +  +  S+++     R++ I+  L  EV+   +       KF   + +TM

HSP 2 Score: 60.4622 bits (145), Expect = 8.229e-9
Identity = 54/224 (24.11%), Postives = 99/224 (44.20%), Query Frame = 1
            + +M S    D T  +  LAK        I +G  + + +A++ +S S  EG W+LLQN  + L+++  +L      T     HE F+ ++T      K P  +LQ   +F Y+   GI   ++  +     T     + + +      F +++ H  +  R +  P G++  Y FN  DF     +++N L   +    + W  V   I  + YGG++ ++ D
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 5635.07 bits (14617), Expect = 0.000e+0
Identity = 2833/4643 (61.02%), Postives = 3535/4643 (76.14%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO42024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L5])

HSP 1 Score: 5088.09 bits (13197), Expect = 0.000e+0
Identity = 2552/3927 (64.99%), Postives = 3141/3927 (79.98%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO32004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB3])

HSP 1 Score: 4429.78 bits (11488), Expect = 0.000e+0
Identity = 2240/3500 (64.00%), Postives = 2732/3500 (78.06%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 2021.13 bits (5235), Expect = 0.000e+0
Identity = 1370/4447 (30.81%), Postives = 2286/4447 (51.41%), Query Frame = 1
            +  +E+++  W  QI+ VL  S  Q   E  + GP  EL +WK+R +    + EQ+   KV  +  +L   +S     ++++   +  A +EA+D   +L  L +    + + +  ++ + +P++++   ++ + S++Y S+ R+  L  ++ N +I   + ++   E      +   E++ K I +C    + +E       K   E +  K +EF+   +F + + F +RL  + ++      +  L+  +I GI        +V  ++  N+   +    TYD L+    EF +D+  F  +   L+ ++ + +   F+     +  L LL      DCL           D + K+  +L+ F K LD  + +Y +       +   P+ +N+P +AG + WS  L ++I  PM   K       L+  EA+ +   Y++M K+L   +   Y +W + + N  +  L   L++R+P+ +       VNFD  ++ +++E KY+   + +    IPE A+ +             +   +  Y+++ +++  V FP++   +  ID        +L W S  + +Y+EK R+ +      ++   D     IEA+   M   +   L E +    E  L++     EE      K   ++  +   I  +LK NL              E  Q D            ++ A ++       +    C   +L+ +   L+ +  K + +        ALF+A L LH P+++  P+LD  +       V+ I+    +I         +K    +++LAE N  ++       +  L+++  D  D      +++GIMN    +     S F  YS LW ++    +++F+                    ++ P L +   QI  +  +  E+        F   ++V A      P KQ L++    W   + Q L +     ++ +          L++ V+  D + + + M  L  +++ +   +   +P+++   +L  Y     +    ++  L   ++  +  A TV+  +  +Q      +      F      F  D+    P A      +  DRL     +   +  +    S    LF +   DY  ++  R+E+ LL++L+ +   VL ++  +    W+EI+++ +  +   F  + R L K ++ W  +  L  T+ +   +   + ++ + A+  RHW+++   T  KF +D D   L +L+   L   ++E+  I   A KE  +E  LK +   WS   F           LLK  ++ E++  +ED+ ++ L  L++++Y   F  ++  W +KL+    +I  W  VQ  W +LE++F+G  DI  QLP+++KRF  ID  ++++     +IPNVV+CC     L + L +L E+L LC+K+L  YLE KRL FPRF+FVS   LL+IL   +    +  HL  +FDN   + F E     V    + + S+E E V+ D   +  G VEIWL  ++   R ++      + ++  +   + + F+  FP+QV L G Q+ WT  +E  +   + ++    A    +   +  L+ LI +   +L+K +R K  T+ TI VH RD+   L+  K+++ + F WL Q R  + +    C  +I D  F Y  E+LG T RLVITPLTDRCYITL+Q+L +++ GAPAGPAGTGKTETTKD+GR LG  V VFNCS+QMDY+  G IYKGL+Q+G+WGCFDEFNRI + VLSV A Q+  +    +++K +FIF   D+  + P  G+F+TMNPGYAGR ELPENLK  FR  AM+VPD  +I  + L + GFL+   L++KF TLY LC+E LSKQ HYD+GLR I SVL   G+ KR +    E  ++MR LRD N+ K+V +D  +F+ LI DLFP + V  K  PD  A + K +   KL   D + LK++QL E   VRH +  LGP+G GKT+ I  L +   +         +NPKA+TA ++FG ++ AT +W DG+FST+ R    +      W++LDG +D +WIE+LN+V+DDNK LTLA+ +R+P+ P+ +++FE+ ++  A+PATVSR G+++++ + + W P + SW+   E     +N   + + +  +  +  R   + ++P     MVT  C Y+ + +     L       +      E   VF+ +W+ G  +  +D+L     EF    +T  K +  P      T+F+Y ++ +  ++  WT +V ++ L P   +P   ++LV   + TR  F ++ + +  + V+L+G  GT KTV+V  Y    +P+  +  ++ F+  TT  M Q+ LE  ++K+ G  +GPPG +K+  FIDD+NMP+++ +G    + ++RQ ++ +  +   K      I + Q IA M +P  G   I  RL+R F++F  + P   ++  I+  +  G+      F   V      +  A   + QK     LPT  KFHYVFNLRDLS I+QG+L    + I +      LW HEC RV  D+  +  D + F+K  + +T +  EE   E    +  +P                     +  PK Y  +  +E LS  L + +  YNE      ++LV F+DAM H+ +I+R++ + +G+ALLVGVGGSGKQSL RLA+FIS  E FQITL           Y + ++  DL  L   +G    G  FL TD ++ +E+FL  +N++L+SGEI  L+  DE++ I+  + + +K    +   + EN   +++ RV + L VVLCFSPVG   R RS +FP + +   IDWF  WP++AL++VS  F+   E +   E K  V   M      V E    Y    RR  + TPKS+L  I+ Y+ +  KK +E+     R+  GL KL    + V++L  +LA +E EL+   + A +++ +V V+     K K      + + + +  ++S  +   EE L  A+PAL  A+EAL T+   ++  +K  G PP  ++ +   V++L           P    PK    +A K+M G    FL  L+N+ K+ I++  +  ++PY +  +F     K  S    G+C+W   +  F+ I  +V P +  L    ++L  A ++L+  +  +    + L  + A + +A  EK   + +AE+  + +  A  L+GGLA E  RW E+ K+F +Q K L GDVL+ TAF+SY G F + +R N+L   W   L +    IP T+ +  +S+LTDNATI+ WN + LP D +S +N  I+T   R+PL+IDPQ QG  WI+ +E N +L++  L  K + + +E A+S G  +LIE++GE +DP LD ++ +N IK G    +K+GDKEV+    F++ + TKL NP Y PE+ A+T++I+FTVT +GLEDQLL  V+  E+ +LE  +       L ++      K KELED+LL RL++  G+ + D +L+E L +TK TA +++ ++   + TEIKIN ARE YRP A R S+LYF++ +++ +N MYQ SLK F  +F K++  ++ +     R+ N+I+ +TY VF YT RG +E DK  FT  +  ++ +   +I   E    ++  A +++ +    P  ++ +L+W  +  LS +  F+ +   +  + K WK + +S+ PE+   P  + N    +KL ++R+  PDR       ++EE +G ++ E   T      EE    TP+   LS G DP  ++E   KK       KN    ++S+GQGQE+ A + L ++ +EG W++LQN HL  N++ +  + +   +E  +  +R +++ E  G P     P  IL+  IK T +PP G+ A L +      QD L++     ++K +LF + + H  V ERRKFGP GWN  Y FN  D T +V  + N+L   +    V W  + Y+ GE+ YGG +TDD+D+RL  TY + +  PEM   + +   G+P+P       Y  +ID+    +SP  +GLH NA+I + T+ ++ +  T++ +QP+D+GGG G  +TRE  V ++ DD+ ++LPE++N   V E + ++    P  +   QE +RM  + + ++++L  L L + G + ++  ++D  + +F   +P  W + ++ S   L  WF DLL R ++   W  +   P   W++GFFNPQ FLTA+ Q + R ++ W LD + L  DVTK  KED N+ P EG YVHGL+++GA W+ ++  + +   K L   +PV+ + A+ V+       +  +  YECPVYK  R+    Y++   LKT E P  W L GVALL
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1933.69 bits (5008), Expect = 0.000e+0
Identity = 1249/3819 (32.70%), Postives = 2012/3819 (52.68%), Query Frame = 1
            I+K     ILD + + + +D+  F    + LE  +Q  + + FE    +++ + +L  F+ +   + ++     K  +V Q F++ L+ V+K +     D PPL    P  AG  SW+R L ++I+  M +  +    P+I    E   +   Y ++A+ L EF    +N W  T++     L    L+R    E+ G   L NFD ++L+L  E  Y   L L+ P   S +   +  ++     +  ++ +Y+ II  + P    + R  I  +D+   PGL  L+W S  I DY       +   R    KV  I+D    A   ++ ++  C       I I E L   +  + V +  E+  ++ K              M L ++ L+  + E      + YE  + D ++         V    L Y T++    + +  RL    +K  LQ  S   + D   +     L +  +VL    +   P L ++  +++     +    +  ++   +    K I+E   L  E +++ K                     K  + +   M+   S +Q+ LS + GY  +W+ +    ++ + +  P +S  +A I  ++++            +  V+    PLK  L+S C+ W+  +   L    +Q++  +       +K+LS P + LD++   ++ L +L+     IE    P+ + + +L KYE+   +     +D+L  G   L  Q     D +L+  + KFK  LI   + FK+ V     D+ S+GP +  I  +EA +++T Y  +   L  + T+   G  +F +E     D+Q + K+L  L++++ +     +  +++    + E+   +++T  Q L    NK  +  K  K W+  D ++  I+ F  T PL++ + ++AM  RHW +I+T     F+   D+F L  ++E  L    E+I +I  +A KE  IE  +  + + W   S     +K RG   LK   T E+   +ED+ + L  + ++RY   F+ ++ +W + L+   E++E  L VQ  W+YLE +F+G DI KQLP+E+  F +++ +W+ IMQR ++ PN ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN KT+        +DK  A+   S E E V+    +  +G VE WL D+ +  R +L  +++   + +  S  K  ++   +P Q+ +   QM WT D  +AL+ SK   DKK +++  ++ + +LN+   +   +LTK++R K   L+TI VH RD+ + L+    N    FEWL Q R Y+ +D D C+V  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +D++ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+       +F+F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M VPD  +I  + L + GF    VL+KK +TLY L  +QLSKQ HYDFGLR + SVLR  G  KR NPD S+  I++  ++DMN++KL  +D  LF  ++ DLFP ++     Y  +  AI  +++           LK+IQL+ET+  RH  + +G +G+GK+    VL  AMT     GEP     +E  +NPKA++  +++G  D+ TN+WTDG+ S++ R+T   +K E  W++ D PVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY     L WQP + SWL       +V + +   F+    +   +        + T E N +       D LA   +G  M   E     LE   +F ++WS+ A ++ + R K+  F+   +   P       DT++EY V+ K + W  W  ++      N  +P Y  I++P VD  R DFL+  + +  + VLL G  GT KT + +    K +P+      +N S+ T+ N  Q  +ES V+KR    + P GG++M  F+DD NMP  + +G Q   E++R  ++    Y   K      + D+ ++A+M  PGGGR  I +RL+ +F++ N T P  + I +IF   G       + F+ DV+   + +  AT +++     KMLPTP + HY+FNLRD+S+I+QG+L  N D+ ++ + +  LW HEC RV +DR  +  D++ F   L  K+    +     +   +  P F +F++D                  +YE +  ++ +   +   M  YN       ++LV F+DA+ H+ +I RVI   +G+ LLVG+GGSG+QSLTRLAS+I  Y+ FQI +T     KH   Y      +DLK LY  +G   K   FLF D +  +E FLE +NN+LSSGE+ NL+  DE +E+   L  +  KE  +  P  E++  +++ RV   LH+VLC SPVG+ FRNR   +P  ++  TIDWF  WP DAL+ V+  +L   E+    E K  V          V +         +R  +VTP +YL  +SGY+ +  +K++E+G  A+++  GL K+ +    V  +S EL     ++   +K+  E L  +  +   A + ++ VQ          D+   +  N   D       L+ A PALQEA +ALE++  + +  +K  GRPP L+ ++M+ V+IL +               +PTW EA + +   NF+  L+N+ KD + D ++  +  Y    DF       VS     LC W +AM  +  I + V P K  L    ++LE     L  A+  L      ++ ++ +Y++   +K+ L   AE    K+  A  L+ GLAGER+RW  +    ++ I  LVGD LI  AF+SY GPF  ++R+ ++ ++W  ++   G+    + +    L    T+ EWNIQGLP+D  S +NG++VTR  R+PL+IDPQGQ   WI+N E    L++  L    +   LE+A+  G P+L+++V EE+DP+L  +L K+ +K G  + +K+GDKEV+    F+ Y+TTKL NP YTPE+  KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  K+K +ELED +L  L + +GSL++DE L+  L  +K T+++V ++L +   TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+ S+  SQ+SP    RI N+ EY TY V++YT RG +E  K  F+  +  KI   +G++  +E+  F++GG  LD       P  +W+ D +W N+ EL KLP F  I     +  + W  W+ S  PE   +P  ++N     +++L++RS  PDR    A  +I   +G +F E  + ++  + ++    TP+I  LS G DPT  + +LA+     CG      ++S+GQGQ   A +++   +++G W+ L NCHL L++M +  +++     E+ H  FR W+++  HP+FPI+ILQ+GIK T +PP G++A ++R Y L+T+ Q    +   ++K +LF + F H+ + ERRKF  +GWNI Y FN SDF  +   +  +LD+ +      W  + Y++  V YGG VTDD+D+RLL++Y    F+ +       K S    Y +P    L  YR  +  L  I +   F  H++

HSP 2 Score: 90.1225 bits (222), Expect = 2.691e-17
Identity = 53/175 (30.29%), Postives = 95/175 (54.29%), Query Frame = 1
            A  + E +++LE  +  W +QI++VLS S+     A++ GP  E+ +W+SR +  + + EQ+    V  +   L  +KS  +  + +L   I D +++A+ N+K+L TL      L++  P D+   +P +++ IRM+   S++Y S ER+T +  KV    +    HF  MY G
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4583.48 bits (11887), Expect = 0.000e+0
Identity = 2286/3482 (65.65%), Postives = 2804/3482 (80.53%), Query Frame = 1

HSP 2 Score: 397.127 bits (1019), Expect = 1.069e-109
Identity = 220/610 (36.07%), Postives = 365/610 (59.84%), Query Frame = 1
            F MLD +   L  ++E+ +S++  P L+     WG + + +    K  E+  + + F + L+ A++ +  +++  N  D+ L      P +           +K  +L++       Q+LSES Q+R+  DD+GP AEL+YWK RMSRF+ LLEQ+K+  V  ++ +L  AKS+ +  W E+D RIT A+NEAK+NVKY+Y+L+ F+ PL KC+PV     IPSLINAIR IH++S+YYN SE++T+LF+ VTNQM+++CK ++   G   IWD  R+E+ ++I     LN+  +       ++L++   E+QF+FSE YIF KF+AF  R++KI  + NI+ +YS+LQ  KIEG+++I  R+K I   +K K+Y  LDH  + F+ D++ F    +    Q++ F++   E      + L++L +FE++    L    K+  +L  + + ++ V  +++K K DPP  R+LPP+AG+I W+R L ++I  PM  F++ +P +L   EA  ++KN+N+M ++LLE+E ++++NW   + + +LGL ++LL+R      +  +  VNFD  +L  I E   +  +NL IP  A+ L   E  +K     M+
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4543.41 bits (11783), Expect = 0.000e+0
Identity = 2450/4578 (53.52%), Postives = 3154/4578 (68.89%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3604.68 bits (9346), Expect = 0.000e+0
Identity = 1796/2689 (66.79%), Postives = 2185/2689 (81.26%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1636.31 bits (4236), Expect = 0.000e+0
Identity = 1098/3253 (33.75%), Postives = 1708/3253 (52.51%), Query Frame = 1
            I  F +  P++  + +  +  RHWE++  + G      + NF   LR L++  L    EE E I ++A KE  +E  ++T+T  W   SF     K  G  +    A  +I  +++D ++    ++ + +  PF+ ++++W ++L    E I+ WL +Q  W+YLE +F   DI +Q+P+E + F  +D++W++IM    +   V+Q       L + L      LE   K L  YLEKKRL FP +                                                 S E E V+L + I+   A G VE WL  L      S+  +I   R+   T  +   K       +P QV L   Q+ WT +  +AL      K   Q  NQ     LNE++ +    L K  RT    L+TI VH RD+  DL+  K++   DFEWL Q R+Y+  D  +  V I + D  Y  E+LG + RLVITPLTDRCY TL  A  ++LGGAP GPAGTGKTETTKD+ + L    VVFNCSD +DY  +G+ +KGLA SG+W CFDEFNRIEL VLSV AQQ+  +      +   F F +G ++ ++P   + +TMNPGYAGR ELP+NLK+ FRTVAMMVP+ A+I  + L S GFL    LS K    Y+LC EQLS Q HYD+G+R + +VL   G  K + P+++E  +++R ++D+N  K +  D  LF  +  DLFP + +    Y     A +   E  K+ N  P ++   KLIQ +E   VRH M+ +G S AGKTK ++VL   +  M + G   +E      +NPK+IT  Q+FG+ D+ +++WTDG+ +  +R     +  +  W++ DGP+D +WIE++N+VLDDNK L L +G+ I M+    +IFE +++  ASPATVSR GM+YM  S L W+P++ SW+  L    ++ D  S  IL+ F  +   +        R V  T +   V   C   +  +D    +  G D + I+T  +      S++WS+G   + + R K  +FI        K  P+P           +   +++Y     +KG W HW   + E +   +   +   I+VP +D  R  +L++    Q   +L +G  GT K+V VK       + +  +   +NFS+ T+ N  Q  + S +DKR    FGPP G++  +F+DD+NMP   ++G Q   E++RQ ++  G Y L+     + +VD+Q IAAM  PGGGRN +  R  R  +I +    S+ ++  IF  +   +   +  F P+     N +VTA  ++++K    +LPTPAK HY FNLRD SR+ QG L++    +     L+ L+ HE  RV  DR  +  D+ W  + +             +V G+ + G ++         F D++                   ++Y  + S E  ++ +   + +YN+ +   +++LV F   + HL +ISRV++   G+ALLVGVGGSG+QS+TRLA+ ++    FQ  ++ N        Y ++   +DLK +L R +G  G+   FL TD +IKDE+FLE ++++L++GE+ NLFA DE  EI++ +  + +        S   L  ++++R  + LHVV+ FSP+G+ FR R  +FP LI+ CTIDWFQ WP++AL  V+N FL + E+  +   ++ V+     F    + N ++ FQ    R  ++TP SYL  I+ ++++  +KRE I     R   GL +L  A   V ++ KEL   + +LE A+    +++  +EV++   +     V V ++ A    N     K+  E  L  A PAL+ A  AL+T+K P  I+ VK +  PP  +  +M  V ++   + D +  DP     K    W  + KL+   NFL  L  + KD I   V+  +   F    DF+ +   N S    GLC W  AM  +  + K V P KA LA  Q  L      L+  +  L   +  L  +Q  + +  +EK  LE   E+C RK+  A+ LIGGL+GE+  W++A+         L GDVLI    ++Y GPF   FR    + W     +  IP +DD +    L +   I  WNI GLPND  S+ NG+IV R  R PL+IDPQGQ   W++N EK++ L V  L    +   LE+ +  G PLL+E+VGEE+DP+L+ +L K   K G    +K+G++ ++    F+ YVTT+L NP Y PEV  K S+++F +T +GLEDQLLG+V+  E  ELE ERT L+ + A NKR+ KE+ED++L  L S++G+++EDES I++L   K  + ++  +Q++ I   TE+KI  +RE YR VA   SIL+F I +++ ++ MYQ SL  F+ L+  S+    KS +  +R+  + ++ TY ++    R  +E DK  F+ LL   +  +  +I+H +    + GG  L      P P  W+QD +W  +   S+LP FQ + E   KN + +K  +DS  P    +P  + + L   +K+++ R   PD  VP   K++   +G +F +    +L +   + +   P++  LS G+DP   ++  + KK    +  SIS+GQGQ   A K++  +MQ G W+ LQNCHL +++M    +I    +    H+ FR W+T+   PKFP+ ILQ G+K T + P G+R  L ++Y  LT D +   N F         W+ +LF + F H  VQER+KFGP+GWNIPY FN+SD   +++ +Q  +++ D    V ++ + Y+ GE  YGGRVTDD+D+RLL T   +++  ++   F    S    Y  P   S ++Y  FI+ LP+   PE FGLH N DI  +      +  +++  Q   + GG     ++ +Y +A+++L Q+LP  ++   V  K   +   + +N  L QE++R   + S +  +L +L  A+ G ++M   L+    N+   ++P  W K S+ S   LG + TD L R +    W   G+P  FW++GFF  Q FLT + Q   R ++   +D +    +V    K +    P +GVYV+GL+LDGA W+ +   L E  P++L+  +P++ V       P        +  Y CP+YK   R           N++  + L T + P HWI RGVA+L  +
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 948.732 bits (2451), Expect = 0.000e+0
Identity = 734/2505 (29.30%), Postives = 1227/2505 (48.98%), Query Frame = 1
            VNF   + E++ E +Y+  L   +PE+A S  +  E+ +      +  ++  Y+ I++ +      M+ P I    +    G        + I D++ + ++++ +F  ++ ++  + + R IE+ L  +    L  C +P+             E  + E  ++L +E  K V +   +  DI L + +TE  + + N+            K   +E     YY    Y+ +R   +L K   L++ T    L   +              ALF+ + +L  P I  +P   EI ++L + V+  ++ ++   +W                        + P P  V   ++L++     DV ++ SQ+S    T    ++ LL     + T WK        +  T+++ F +  P  +  + +++YF ++  E+           +     PL   L +   S  +     LN    +E+  + + F  L +++ +     +D++S +  +S++R+  + +E+ +  I+E Y M+  Y+        E V ++   +S L  +++ V   L +++  F    +E ++AFK+++  F   +++ GP   G    E  + +  ++ +  ++  K    +   +L  L++ +YP+I  I+K L+ L ++Y +Y    +    +    W   +I  +   +  F     +L K ++       L   + +F  +  LL  + + A+   HW ++   TG  F+++   F L  L    L     +I++I  SA+KE  IE   K    +   Q         +  + L G A   I+  +++ +M L  +  +R+  PF   IQ+W + LT  +E IE WL VQ+ W+ LE +F G DI  QLP+EAK+   I K + +IM+     PN+ +CC         L  L   LE  QK+L  +L+ KR  FPRFF +SD  LL +LG   D   IQ H++ ++DN +++    D      + A+ S E E ++  +P+  +  VE W+  +L+  +       R++ +   ++ +   ++  S+   + L   ++ WT + E A+   +K DK  ++   ++    ++EL+    +   + +R K   ++   VH RDI D+ V   I    DFEW  Q RFY+ ++ D   V   +    Y  E++G   RL ITPLT R Y+TL+QAL M LGGA AGPAG GKTET KD+ + LG F VV +C++ MD   LG+I  GLA+ G WGCFDEFNRI   VLSV + QI  +          F F +G  + +D   GI++TMNP Y  R ELPE++K+ FR V ++ PD   I  + L S GFLQ   L+KK   LYK    QLSKQ HYDFGL +  SVL+  G  KR++ + SE  ++MR LRD+NL KLV ED  +FL LI D+FP +  S   +P     +++ ++++          K++Q++E    +   M +G +  GK+  IN L +A T  G   K   +NPKA +  +++G  D  T DWTDGIFS L+R  ++    +  +++ DG VD+ W+EN+NSVLDDNK LTLANGDRI +  +  ++FEV ++ +ASPATVSR  +V++    L + P  + W+          N +   F+       +YV   +    VTL    I  R  +++++ L   +D+  E K S  E L  +   ++  SLGA L    RLK  + +   K+L      DD+             T++++  ++  E W  W++ VPEY+    H P    + ++P VD TRT +++  + K  + VLL+GE GT+KT I++      + +  I  ++NFSS TT    QR LE+ ++KR   T+GPP G+K+ +F DDINMP ++++G Q    ++R +++  G+Y  ++   F TI D+  IAAM   GGGRN++  R    FS+FN   P+  S+  I+  +  G+    R FK  +Q     +   T KL+      + PTP+KFHY F+ R+LSRI+ G+ +   D    +  + + +W++EC+R   DR T++ DK      +K   EE   ++  A L     F D+               E    ++YE I  Y+ +S  + Q                  F+DA+ HL ++ R++R+ +GHALL+G  GS  Q+LT+LA+F +  E F+I L           YN  N   DLK LY   G   +   FLFTD  I +E FLE +NNML S  +  LFA DE + I++++ S   +E      S E++ +Y++ +    LH+VLC S  G+  + R   FP L+S   IDW+  W   AL AV+        ++  P + K    AV++ + +    + +       + +R  + T KS+L FIS Y  +  +K E +      +   L +L EA E ++

HSP 2 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 443/1333 (33.23%), Postives = 722/1333 (54.16%), Query Frame = 1
              +PP  +  + +C+L+L  K+             +  W  A K+MS + FL SL+    D+I++  +  ++   N++  ++   +++S   +G+  + ++  S++ I KEV P K  +   + +   +  EL   +  L+  QKE   ++ +Y  A  EK+   D+A+   R++T A  L+ GL  ERE WT+  +   +Q + L+GD LI  AFLSY G FN DFRN ++   W  ++   GIP +      + LT+   IS W  +GLP DE SVQNG++ T+  R+PL IDPQ Q  +WI+NKEK++ L QV++LN   F   LE ++  G P L++DV E+IDP + NVLE+N + S     + +GDKEV+    F+L++ T L NP Y+P VF K  +I+++ T++GLEDQLL V     ++  + +   L+EE++ENK   K L D+LL  L ++ G+++++  LI+ L  TK  A +  +KL + +   ++  + RE YRPVA RG++L+F + +M++VN MYQ SL  +L LF+ S+  S   P   +R+ NII  LTY V  Y     +   K  F++ +T+KI    G +  +E    IK  +  D   V+ KP +WI D  W ++ +L++L    F  +   + +N   WK+W+D  APE+A  P  Y ++L  F+KLLL+R    DR       Y+  TMG       + N   + E     +P++  +S GSDPT ++ + A+K   K   I++GQGQE    KLL  ++  G W++LQNCHL + ++ +  + +    N + +FR W+TT     FPI ILQ   K   +PP  I+  ++ TY+ ++Q  L       +  +++ +AF H  VQER K+G  GW++P  FN SDF+++++ +  +L     ++G   + W+++ Y+IGEV YGGR  D +D+R+L  Y   +F   +F+P   F F++    GY IP       Y   I+K+PLI +PE  GL +  +I Y T    +M T +  +QP ++  G G   +  +  +A D+ ++LPE ++   V E+L     L P ++ L QE+ R  K++  ++ ++V+L  A+ G + MS+   D      +  +P+ W +L+ E+  +L  W + L  R EQ+ +W + EG P   W++G   P+ +L A+ Q   R  KGW LD      +VT++  ED  +   +  Y+ GL+L+GA W+  +  L    PKVL   LP++ V       PV   +         PVY    R + +    +F  +L T     HW+L GV L

HSP 3 Score: 90.1225 bits (222), Expect = 6.948e-17
Identity = 79/372 (21.24%), Postives = 173/372 (46.51%), Query Frame = 1
            + S + +E LE  +  W  QI  VL E  Q  ++ +  GP  EL+ W+ R +    L EQ+K   V  ++ +L  A +   + +      +T+   E+  N +YL T+++ F  L +     + +E IP+L+  ++ +   S++YNS+ERM  L  ++  Q+   C++   E   +     ++E+  ++   K++ E+++  + + + ++++     ++EF    +F   +        I+N+  +LE    + + +++G+       K IN++I +    +L  ++  F+              +DF V  + +E +    +D +F  ++      ++L +F+Q    D + L    K   VL  + K ++
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000039073.1 (SMESG000039073.1)

HSP 1 Score: 9222.82 bits (23931), Expect = 0.000e+0
Identity = 4613/4622 (99.81%), Postives = 4613/4622 (99.81%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 5415.89 bits (14048), Expect = 0.000e+0
Identity = 2739/4648 (58.93%), Postives = 3499/4648 (75.28%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 5409.34 bits (14031), Expect = 0.000e+0
Identity = 2735/4651 (58.80%), Postives = 3503/4651 (75.32%), Query Frame = 1
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4045.35 bits (10490), Expect = 0.000e+0
Identity = 2051/3520 (58.27%), Postives = 2602/3520 (73.92%), Query Frame = 1

HSP 2 Score: 395.201 bits (1014), Expect = 3.619e-109
Identity = 251/860 (29.19%), Postives = 441/860 (51.28%), Query Frame = 1
            +D RH ++ + + +   +    +ED +    +  A + F +PN + KL  Y  ++ + +  ++         +    L    GS    KG          + +T  N+  DI    L   GG   LL +    I+K+  P ++  E E G +     H+ K   +   +  F N+L TA   ++ ++ L  +    ++  +E  +    A N  ET+ K E L  +W+KQI++ ++E E +R E+  +GP  EL +WK +M+RFN L+ Q+K K V +V+ IL  A S++L KW +LD ++T A  E+K+N K+L  ++K+  PL   N   MIE +P L+ ++ MI+  S YY +   MT LFVK+TNQMI TCK F+ +     +WD   E   KR+  C  LN  Y+ C+ K +K+++ ++  + F+FSE  IFG F  F  RL K+  +   +++YS+L+   +EG D+I+ RY  I   I  K YD L+ R   FD DY++F  Q E L   +   + ++F +S  +   L +  K E+I   +LD   ++ ++ ++F      ++ ++ +++ +PPL R++P  AG+I+W+R+L+  +E  M LF  T PE+  + E  ++V  YN   ++L+ +E+  Y+ W + I +   G+ SS+ I   D+     + ++N D  +L L++E   +  L   +  +   +    + +K     ++    E+  I+  VP     ++ P   +I      G+    W  + + +Y+E + + +  F LL+ +  DI D RI  +L  +A T L   PE+ EP  I +FL +T +   + S+ +   S  +  A ND +DIL
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4043.43 bits (10485), Expect = 0.000e+0
Identity = 2051/3520 (58.27%), Postives = 2601/3520 (73.89%), Query Frame = 1

HSP 2 Score: 395.201 bits (1014), Expect = 2.982e-109
Identity = 251/860 (29.19%), Postives = 441/860 (51.28%), Query Frame = 1
            +D RH ++ + + +   +    +ED +    +  A + F +PN + KL  Y  ++ + +  ++         +    L    GS    KG          + +T  N+  DI    L   GG   LL +    I+K+  P ++  E E G +     H+ K   +   +  F N+L TA   ++ ++ L  +    ++  +E  +    A N  ET+ K E L  +W+KQI++ ++E E +R E+  +GP  EL +WK +M+RFN L+ Q+K K V +V+ IL  A S++L KW +LD ++T A  E+K+N K+L  ++K+  PL   N   MIE +P L+ ++ MI+  S YY +   MT LFVK+TNQMI TCK F+ +     +WD   E   KR+  C  LN  Y+ C+ K +K+++ ++  + F+FSE  IFG F  F  RL K+  +   +++YS+L+   +EG D+I+ RY  I   I  K YD L+ R   FD DY++F  Q E L   +   + ++F +S  +   L +  K E+I   +LD   ++ ++ ++F      ++ ++ +++ +PPL R++P  AG+I+W+R+L+  +E  M LF  T PE+  + E  ++V  YN   ++L+ +E+  Y+ W + I +   G+ SS+ I   D+     + ++N D  +L L++E   +  L   +  +   +    + +K     ++    E+  I+  VP     ++ P   +I      G+    W  + + +Y+E + + +  F LL+ +  DI D RI  +L  +A T L   PE+ EP  I +FL +T +   + S+ +   S  +  A ND +DIL
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH50.000e+060.62dynein axonemal heavy chain 5 [Source:HGNC Symbol;... [more]
DNAH80.000e+058.88dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+059.36dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+058.14dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH21.283e-1933.92dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-10.000e+026.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-36.819e-12832.23Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-33.537e-1922.70Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94920.000e+052.31gene:FBgn0037726 transcript:FBtr0309029[more]
CG94920.000e+052.00gene:FBgn0037726 transcript:FBtr0344344[more]
CG94920.000e+052.09gene:FBgn0037726 transcript:FBtr0309028[more]
CG94920.000e+051.79gene:FBgn0037726 transcript:FBtr0309027[more]
kl-30.000e+048.94gene:FBgn0267432 transcript:FBtr0346771[more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah5l0.000e+061.83dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah50.000e+059.83dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah5l0.000e+068.10dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah23.949e-3233.88dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah27.075e-2233.91dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021690.10.000e+060.77dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
nifk1.246e-8668.44nucleolar protein interacting with the FHA domain ... [more]
nifk5.826e-11068.53nucleolar protein interacting with the FHA domain ... [more]
nifk8.201e-10267.95nucleolar protein interacting with the FHA domain ... [more]
nifk2.051e-15867.82nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah50.000e+060.36dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah80.000e+058.85dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+058.85dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+058.85dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah26.000e-2134.14dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TE73|DYH5_HUMAN0.000e+060.62Dynein heavy chain 5, axonemal OS=Homo sapiens OX=... [more]
sp|Q8VHE6|DYH5_MOUSE0.000e+060.36Dynein heavy chain 5, axonemal OS=Mus musculus OX=... [more]
sp|Q91XQ0|DYH8_MOUSE0.000e+058.85Dynein heavy chain 8, axonemal OS=Mus musculus OX=... [more]
sp|Q96JB1|DYH8_HUMAN0.000e+059.36Dynein heavy chain 8, axonemal OS=Homo sapiens OX=... [more]
sp|M0R8U1|DYH5_RAT0.000e+057.71Dynein heavy chain 5, axonemal (Fragment) OS=Rattu... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5