Dynein heavy chain axonemal-like

Overview
NameDynein heavy chain axonemal-like
Smed IDSMED30033073
Length (bp)14078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain axonemal-like (SMED30033073) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain axonemal-like (SMED30033073) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain axonemal-like (SMED30033073) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain axonemal-like (SMED30033073) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033073

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033073SMESG000039073.1 SmedASXL_018386SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig4291uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig4291newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig18651uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig18651newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig38230uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig38230newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig49053uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig49053newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig44369uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033073SMESG000039073.1 Contig44369newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30033073SMESG000039073.1 dd_Smed_v6_4176_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033073SMESG000039073.1 dd_Smed_v6_4176_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30033073SMESG000039073.1 dd_Smed_v4_4176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH5 (dynein axonemal heavy chain 5 [Source:HGNC Symbol;Acc:HGNC:2950])

HSP 1 Score: 5509.88 bits (14292), Expect = 0.000e+0
Identity = 2802/4622 (60.62%), Postives = 3524/4622 (76.24%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVS------AHKKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSM-STKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYE-GVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL------------------KMNL-TESELK-----------NLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS-----NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDN--------------------KLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA----LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE----VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH ++F  +A   DL+ T+VEDA+L   +    ++ F+    + LMFYYQDV  E+       S+G V+         K+F+  G+   L G+C  FIR+   KA+T +NI  +++F MLDA+ G LL+++ R +S I  P L+     WG +   +D  N +  EF   L+ F+N L  AQ+++  ++ L   D  +L    E P+  L   N+ ET+ K+E+ +  WIKQ EQVL+E+ Q+ +EADDVGP AEL +WK R+S+FN LLEQ+K+  V  V+ +L  AKS+ L+ WRE+D RITDA NEAKDNVKYLYTL+K   PL   +P+ M++ IP+LINAI+MI+SIS YYN+SE++TSLFVKVTNQ+I+ CK ++   G + IW+  ++ + ++I    +L +EY+ CFHKTK+KL+++   KQF+FSE YIFGKFE F +RL KI ++   L++YS+LQ   IEG++ +  +Y+ I   IKKK Y+ LD RK +FD DY++F  Q   L  +++ F+D  F K    ++ L +LKKFE+++   L   DK+  +L+N+   +D + KLY K K DPPL RN PPIAGKI W+R LF +I+ PM LF++  P +L   EA  ++++YN+MAKVLLEFE++++  W + IE   +GL +SLL++ P       +  VNFD  IL L +E + +  + L++  +A+ L    +  K  +  MK +L EY  +   +P  +  ++ PH+ ++DE   PGL ALTWTS+ I  Y+E     ++   LL+ +V+D+++ RI+A+L++M+ T LC LP++EP+T EEFL MT+      ++ L  +S LVE AVN+++++L                   +N   ES  K           ++NA      L    +K +  E        +L++F  +N + L+K TR TL+ I++R+ SS      +  S   M ++  P +F+A + L IPNI+  P L+++Q  LNKAV+ I+ + + + QW+   L  K+IQE +  A ++N+D+                     LP P   K+  K +S++K++ K VS LS I+N+ K +V T +  F  Y+ +W++  +  +K F+   P+LSE  +QI YF ++E EI++ P    VG++  Y+  LK  L +E  +W     +  N K   EM++I  L +  +K+L+RP+KDLDD+R  MAAL E+RE +I I+  + PIEE+Y +L++Y +       ++VD+L Y + KL  +A  VQ+ L+ +QP FK ELI  V+ F ++   F  DYD  GPMA G+ P+EASDRL ++Q +FD ++RKY TY+GGEELFGL  T YP +  I+K+LNLLQK+Y LYN+V++TVNSYYDI WSE+NI+ IN +LL+FQN+CRKLP+ALK+WQA+ DL+K IDDF+E CPLLE M+  AMM RHWERI T+TGH  +V +++F LRN+MEAPLL  KEEIEDICISAVKE+DIE KLK V N+W  ++F+F SFK+RGELLL+GD+T EI++ MEDSLM LG+LLSNRYN PFK +IQ+WVQ L+ +T+IIE+W+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+P+VVQCC+GD+TL QLLPHLL+QLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN K+V F EK+YD+IL+I+SQE E ++LD+P+ A+GNVE+WL  LL+ S+ SLH VIR A+  I ++ F+L EF +SFP+QVGLLGIQMIWTRDSEEAL  +K DKKIMQ TNQ FL++LN LI VTT++L+  ER K+ETLITIHVHQRDIFDDL  + I +P DFEWLKQ RFYF ED+D+ ++ ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQIS++LTCKKE K  FIFTDGD V M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGF+ N VL++KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP + +    YP++ AAI +Q+E+A LINH PW+LK+IQLFETQRVRHGMMTLGPSGAGKT CI+ LMRAMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW+ILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KIIFE HNIDNASPATVSRNGMV+MSSSILDW PIL  +L      +A    +   +   F + YR+  Q L  KM  LE   I Q+I++L GL+   +   E+  +HL +L VF+++WS GA LEL+ R +L+ ++  +      LP P     DT F+Y V   G W HW  R  EYLYP+D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KG+  KY+PE  + KSLNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KMT+FIDD+NMP+INEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT+IVDIQ +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPS AS+DKIF ++G G++CT+RGF  +V+ +V  LV  TR+LWQ TKIKMLPTPAKFHYVFNLRDLSR+WQGML   S+VI   + L+ LWKHEC RVI DRFT  +D  WF+K L    EEE G E    V  G+ T  YFVDFL+DAPEA GE +EE + E PKIYEPIES+  L +RL  ++  YNE++RG  +D+VFF DAM HLVKISRVIRT +G+ALLVGVGGSGKQSLTRLASFI+GY +FQITLT         SYN SNLMEDLK+LYRT+GQ GKGITF+FTDNEIKDESFLE++NN+LSSGE++NLFARDE+DEI  +L SVMKKE+PR  P+NENL +Y+MSRV + LH+VLCFSPVGEKFRNR+L+FP LISGCTIDWF RWPKDAL+AVS +FL++++I  + E+KK VV  MG FQD VAE C++YFQRFRR THVTPKSYLSFI GYK +Y +K  E+ TLA RMNTGL+KL EA+ESV  LSKEL  KEKEL+VA  KA  VL +V +KA AA+KVK +VQ VKDRA+A+V++IS+DKAIAEEKLEAAKPAL+EAE AL+TI+P  IATV+ LGRPPHLIMRIMDCVL+LF++++ +V  D E+ C  P+W E++KLM+  NFL +L  FPKDTIN+EV++ + PYF M D+N+ +AK V G+VAGLCSWTKAMASFFSINKEVLPLKANL VQ+++   AM++L  AQ  LD KQ ELD+VQAEY +AM EKQ L +DAE CR KM  A  LI GLAGE+ERWTE S+ F  Q K+LVGDVL+ TAFLSY GPFNQ+FR++L   W+ E+    IPF  ++    ML D  TISEWN+QGLPND+LS+QNG+IVT+A RYPLLIDPQ QGK WI+NKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLE+NFIK+GSTFKVKVGDKEVDV+ GF+LY+TTKLPNP+YTPE+ A+TSIIDFTVT+KGLEDQLLG VILTEKQELE ERT LME+V  NKR+ KELEDNLLYRLTST+GSLVEDESLI VL  TK TAE+V QKL I  +TE++INSAREEYRPVATRGSILYFLI EM +VNEMYQTSL+QFLGLFD S+A S KSPITSKRI NIIE++TYEV++Y ARG YE  KF FT+LLT+KI ++  ++KHEEF   IKGGA+LDL A  PKP KWI D+TWLNLVELSKL  F  + +Q+++N+K WK WFD + PEE  +P+ YD +L+ F++LLLIRSWCPDRT+  A+KYI ++MG ++AEGVI +LE+  EE D  TP+IC LSMGSDPTD+I  L K+  ++   +SMGQGQEVHARKLL  +M  G W LLQNCHLGL+FMDE ++II  TE +H++FR W+TTE H +FPI +LQ+ IKF  DPP G+RAGL+RTY+ ++QD LD+++  QWKPML+ VAFLH+TVQERRKFG +GWNIPYEFNQ+DF +TVQF+QNHLDDMD+K+GVSW T+ YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MF P FSFY+GY IP   ++D Y  +I  LP  DSPE FGLH NADI Y++  A  +L TI+ IQPKD+ GG  ETRE+VV RLADDML++LP DY PFEVKE+LQKMG  +P+NIFL+QE+DRMQ+V+S+VRSTL +LKLAIDGTIIMSENL+DALD +FDARIP++W K SW S+TLGFWFT+L++RN QF SW++ GRP CFWMTGFFNPQGFLTAMRQEITR +KGWALD +VL N+VTK+MK+D++  P+EGVYV+GLYL+GAGW+ R+ KL E  PKVL+  +PV+ +YA   NN + D      RFY CP+YKKP RTDLNYI  ++L+T + P+HW+LRGVALLCD+K
Sbjct:   33 LDARHNYLFAIVASCLDLNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDV--EEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATSHGWGELEGLQDAANIR-QEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKE-PTDYLTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLLEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASIWNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEFCKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADIDMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQQ-HPAVLSTAEAKPIIRSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGT----GELFVNFDPQILILFRETECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEYQRVKSKIPAAIEQLIVPHLAKVDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPLCQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLP-IFRASVTLAIPNIVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVEMGENELQDTLEIASVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDCFKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTADLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAALKEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKLVSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPATQYPQLLEIKKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEA--EILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQGGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPPP-AGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDCGIDT--YFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTR--------SYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA--ENNTLRDP-----RFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALLCDVK 4624          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 5340.78 bits (13853), Expect = 0.000e+0
Identity = 2712/4606 (58.88%), Postives = 3465/4606 (75.23%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQ--DVMVEDYSRTDSTSIGPVSAHK--KLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL----------KMNLTESELKNL--NAEDG------YECL---------QPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS---NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLH---------------HKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIK-TSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +DP + +IF+ +A+   LD+  VE+ +L      AF  FF+ +  K L F YQ  DV   +  RT +   G     K  KL+I   + + LKGLC  F+R   D A+    I  +  F +LDAS G LL+ +   ++ I  P +     WG+++      S+   F E ++R+L+ L  A+ +++  ++L+  D+ +  +K+        A ++SET+ +LE +L  W KQIEQVL ESEQ+R+EA D GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIH +S+YYN+SERMTSLF+KVTNQM+T CK ++ +G ++ +WD     + K+I  C  L +EY+  FHKT+K + E S EK FE SE YIFGKFEAFCKRL+KI  +  ++++YS L    IEGID + +++++I   +KKK YDILD R++EFD D+ DFM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   LD  +KLY   K DPPL RN+PPIAGKI W R L+++I  P+  F +   +IL  P+   +++ YNK++ VL+EFE++Y+  W + I      L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A RL+  E+ +K     ++ +L  Y E+   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KK+SD+ ++ I+ VL ++A T L  LPE     +E+ L++ E   +E ++ L  +SK VE AV ++I I           K+     + K++   +E G      YE           + D  K  C E        +  +F+ +  ++L K TRL+LDT+KRR+  +S    K S D +      +  K+++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W    +                H+   +L K  EE + +  +P    +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++  E EI    P   VGA+  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ+ L+++QPKFK  L+E V+ F+E+VI+F   Y+  GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +LL+FQN+CRKLPK LK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD+F LRN+MEAPLL +K++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYNAPFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD+I+A+ S+E E + LD  + A+G VEIWL DLLKM   SLH++IRSA   I+DS F+L  F + FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +L+K +R KFETLITIHVHQRDIFDDLV + I +P DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE  IVMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++  A+  Q++   LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+A T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP+ K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL   + T   +   L  ++ +F + Y Y+   L+PKM  LECNYI Q+++LL GL+   +   +    HL KL VF +MWSLGALLELE R KL+ F+  H+  L +P I K  + T++E+ V D G+WEHW  ++  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKR+G+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSNASIDKIF I+GCGYF   R FKP +   + NLV+  R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML + ++   S   L+SL+KHEC RVI DRF    D+ WF   L    EE  GS+  + +  EPYFVDFL++ PE TG+E E++  E PKIYE + S++ L+++L  Y  Q+NE +RG  LDLVFFKDAMTHL+KISR+IRT+ G+ALLVGVGGSGKQSL+RLASFI+GY+ FQITLT         SYNV+NL +DLK LY+ +G  GKGITF+FTD+EIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY++SR  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWP++ALIAV++YFLS + IV + E+K+ VV TMG+F D+V+E+C +YFQR+RR  HVTPKSYLSFI+GYK +Y +K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ K+K +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+ C KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AMA F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM+EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGD+L+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  ISML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+TFKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELEAER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK+WFD DAPEE  IPDGY D+L+T  KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D  TP+ICFLSMGSDPT+ I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+G W+LLQNCHLGL FM+E LE + TTE   +SFR W+TTE H +FPI +LQ  +KFT +PP G+RAGL+RT+A + QD LDI+N   WKPML+ VAFLH+TVQERRKFGP+GWNIPYEFN +DF+++VQF+QNHLD+ D+K+GVSW TV YMIGEVQYGGRVTDD+DKRLLN +A+ WFS +MF P F FY GY IP  K+LD+Y  +I  LP +D+PE FGLH NADI Y+++ A+ +L TI NIQPK+SGGG GETRE++VYRL++DML +LP DY P EVK +L KMG L  +NIFL+QE+DRMQ+VISI+RS+L DLKLAI+GTIIMSENL+DALDN++DARIP  W ++SW+S+TLGFWFT+LL+RN QF +W++EGRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD V + N+V +  KE++ + P EGVY++GLY+DGA W+ R+ KL E  PKVL+T LPV+H++A++   P       + + Y CP+YKKPRRTDL +I  + L+T  +PDHWILRGVALLCDIK
Sbjct:  144 IDPSYKYIFEILAENLGLDIVTVEELILDCPSLEAFTNFFAKDGCKTLKFLYQEGDVPGIECGRTIA---GATKGAKMMKLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKG-LLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNF-SKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNS-DILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETGEGENNDYEANIVNEFDTHDKEDEFKKECKE--------VFAFFSHQLLDSLQKATRLSLDTMKRRIFVASLYGRKQSEDII------SFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQIRPIKSVIPSPTTTDVTHQNTGKLLK-KEERSFEEAIPA-RKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWL--KKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTR--------SYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAP------KDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4707          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 5316.9 bits (13791), Expect = 0.000e+0
Identity = 2688/4528 (59.36%), Postives = 3428/4528 (75.71%), Query Frame = 1
Query:  544 KLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPM-ILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL----------KMNLTESELKNL--NAEDG------YECL---------QPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS---NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLH---------------HKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIK-TSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            KL+I   + + LKGLC  F+R   D A+    I  +  F +LDAS G LL+ +   ++ I  P +     WG+++      S+   F E ++R+L+ L  A+ +++  ++L+  D+ +  +K+        A ++SET+ +LE +L  W KQIEQVL ESEQ+R+EA D GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIH +S+YYN+SERMTSLF+KVTNQM+T CK ++ +G ++ +WD     + K+I  C  L +EY+  FHKT+K + E S EK FE SE YIFGKFEAFCKRL+KI  +  ++++YS L    IEGID + +++++I   +KKK YDILD R++EFD D+ DFM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   LD  +KLY   K DPPL RN+PPIAGKI W R L+++I  P+   FK +  +IL  P+   +++ YNK++ VL+EFE++Y+  W + I      L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A RL+  E+ +K     ++ +L  Y E+   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KK+SD+ ++ I+ VL ++A T L  LPE     +E+ L++ E   +E ++ L  +SK VE AV ++I I           K+     + K++   +E G      YE           + D  K  C E        +  +F+ +  ++L K TRL+LDT+KRR+  +S    K S D +      +  K+++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W    +                H+   +L K  EE + +  +P    +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++  E EI    P   VGA+  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ+ L+++QPKFK  L+E V+ F+E+VI+F   Y+  GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +LL+FQN+CRKLPK LK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD+F LRN+MEAPLL +K++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYNAPFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD+I+A+ S+E E + LD  + A+G VEIWL DLLKM   SLH++IRSA   I+DS F+L  F + FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +L+K +R KFETLITIHVHQRDIFDDLV + I +P DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE  IVMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++  A+  Q++   LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+A T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP+ K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL   + T   +   L  ++ +F + Y Y+   L+PKM  LECNYI Q+++LL GL+   +   +    HL KL VF +MWSLGALLELE R KL+ F+  H+  L +P I K  + T++E+ V D G+WEHW  ++  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKR+G+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSNASIDKIF I+GCGYF   R FKP +   + NLV+  R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML + ++   S   L+SL+KHEC RVI DRF    D+ WF   L    EE  GS+  + +  EPYFVDFL++ PE TG+E E++  E PKIYE + S++ L+++L  Y  Q+NE +RG  LDLVFFKDAMTHL+KISR+IRT+ G+ALLVGVGGSGKQSL+RLASFI+GY+ FQITLT         SYNV+NL +DLK LY+ +G  GKGITF+FTD+EIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY++SR  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWP++ALIAV++YFLS + IV + E+K+ VV TMG+F D+V+E+C +YFQR+RR  HVTPKSYLSFI+GYK +Y +K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ K+K +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+ C KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AMA F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM+EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGD+L+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  ISML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+TFKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELEAER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK+WFD DAPEE  IPDGY D+L+T  KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D  TP+ICFLSMGSDPT+ I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+G W+LLQNCHLGL FM+E LE + TTE   +SFR W+TTE H +FPI +LQ  +KFT +PP G+RAGL+RT+A + QD LDI+N   WKPML+ VAFLH+TVQERRKFGP+GWNIPYEFN +DF+++VQF+QNHLD+ D+K+GVSW TV YMIGEVQYGGRVTDD+DKRLLN +A+ WFS +MF P F FY GY IP  K+LD+Y  +I  LP +D+PE FGLH NADI Y+++ A+ +L TI NIQPK+SGGG GETRE++VYRL++DML +LP DY P EVK +L KMG L  +NIFL+QE+DRMQ+VISI+RS+L DLKLAI+GTIIMSENL+DALDN++DARIP  W ++SW+S+TLGFWFT+LL+RN QF +W++EGRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD V + N+V +  KE++ + P EGVY++GLY+DGA W+ R+ KL E  PKVL+T LPV+H++A++   P       + + Y CP+YKKPRRTDL +I  + L+T  +PDHWILRGVALLCDIK
Sbjct:    3 KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKG-LLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNF-SKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNS--DILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETGEGENNDYEANIVNEFDTHDKEDEFKKECKE--------VFAFFSHQLLDSLQKATRLSLDTMKRRIFVASLYGRKQSEDII------SFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQIRPIKSVIPSPTTTDVTHQNTGKLLK-KEERSFEEAIPA-RKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWL--KKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTR--------SYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAP------KDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4490          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4566.91 bits (11844), Expect = 0.000e+0
Identity = 2372/4080 (58.14%), Postives = 3037/4080 (74.44%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQ--DVMVEDYSRTDSTSIGPVSAHK--KLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPM-ILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL----------KMNLTESELKNL--NAEDG------YECL---------QPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS---NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLH---------------HKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIK-TSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQE---GRWMLLQN 12369
            +DP + +IF+ +A+   LD+  VE+ +L      AF  FF+ +  K L F YQ  DV   +  RT +   G     K  KL+I   + + LKGLC  F+R   D A+    I  +  F +LDAS G LL+ +   ++ I  P +     WG+++      S+   F E ++R+L+ L  A+ +++  ++L+  D+ +  +K+        A ++SET+ +LE +L  W KQIEQVL ESEQ+R+EA D GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIH +S+YYN+SERMTSLF+KVTNQM+T CK ++ +G ++ +WD     + K+I  C  L +EY+  FHKT+K + E S EK FE SE YIFGKFEAFCKRL+KI  +  ++++YS L    IEGID + +++++I   +KKK YDILD R++EFD D+ DFM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   LD  +KLY   K DPPL RN+PPIAGKI W R L+++I  P+   FK +  +IL  P+   +++ YNK++ VL+EFE++Y+  W + I      L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A RL+  E+ +K     ++ +L  Y E+   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KK+SD+ ++ I+ VL ++A T L  LPE     +E+ L++ E   +E ++ L  +SK VE AV ++I I           K+     + K++   +E G      YE           + D  K  C E        +  +F+ +  ++L K TRL+LDT+KRR+  +S    K S D +      +  K+++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W    +                H+   +L K  EE + +  +P    +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++  E EI    P   VGA+  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ+ L+++QPKFK  L+E V+ F+E+VI+F   Y+  GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +LL+FQN+CRKLPK LK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD+F LRN+MEAPLL +K++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYNAPFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD+I+A+ S+E E + LD  + A+G VEIWL DLLKM   SLH++IRSA   I+DS F+L  F + FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +L+K +R KFETLITIHVHQRDIFDDLV + I +P DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE  IVMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++  A+  Q++   LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+A T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP+ K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL   + T   +   L  ++ +F + Y Y+   L+PKM  LECNYI Q+++LL GL+   +   +    HL KL VF +MWSLGALLELE R KL+ F+  H+  L +P I K  + T++E+ V D G+WEHW  ++  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKR+G+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSNASIDKIF I+GCGYF   R FKP +   + NLV+  R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML + ++   S   L+SL+KHEC RVI DRF    D+ WF   L    EE  GS+  + +  EPYFVDFL++ PE TG+E E++  E PKIYE + S++ L+++L  Y  Q+NE +RG  LDLVFFKDAMTHL+KISR+IRT+ G+ALLVGVGGSGKQSL+RLASFI+GY+ FQITLT         SYNV+NL +DLK LY+ +G  GKGITF+FTD+EIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY++SR  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWP++ALIAV++YFLS + IV + E+K+ VV TMG+F D+V+E+C +YFQR+RR  HVTPKSYLSFI+GYK +Y +K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ K+K +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+ C KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AMA F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM+EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGD+L+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  ISML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+TFKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELEAER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK+WFD DAPEE  IPDGY D+L+T  KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D  TP+ICFLSMGSDPT+ I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+    R +LLQ+
Sbjct:  144 IDPSYKYIFEILAENLGLDIVTVEELILDCPSLEAFTNFFAKDGCKTLKFLYQEGDVPGIECGRTIA---GATKGAKMMKLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKG-LLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNF-SKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNS--DILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETGEGENNDYEANIVNEFDTHDKEDEFKKECKE--------VFAFFSHQLLDSLQKATRLSLDTMKRRIFVASLYGRKQSEDII------SFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQIRPIKSVIPSPTTTDVTHQNTGKLLK-KEERSFEEAIPA-RKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWL--KKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTR--------SYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQVCDKRLLLLQH 4186          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1986.85 bits (5146), Expect = 0.000e+0
Identity = 1218/3591 (33.92%), Postives = 1940/3591 (54.02%), Query Frame = 1
Query: 3373 LNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKE--WQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYD-----KILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSK--TDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRL-KLIQLFETQRVRHGMMTLGPSGAGKTKCINVL---MRAMTDCGEPH----KEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV---HGMDIK--EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITH-KKALPVPICKDDDTIFEYVVNDK-GEWEHWTARVPE-YLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLK--------VTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXD-------RAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKP-KKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNL--KCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFM---DEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLD-ITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKF---SFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGA-GETRESVVYRLADDMLQRLPE--DYNPFEVKEKLQKMGSL--KPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGR-PVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTD----LNYIFPLNLKTNE-APDHWILRGVALLCDI 13956
            +  ++   +D+ K  +Q+S  M    S +Q  L  +  Y  +W+    + +  + +  P +S   A I  ++++   +        +  V+     LK  L+  C+ W+  +A  L    A  +  +       ++++SRP + L+++   +  +  L+     +E  I PI E + +L KYE+   D   E +DSL   +   +      +  L + + KFK  LI     FK+   + + D++ +G     +    A D++T  +     +  +  +      +F +E     D+Q + KEL+ LQ+++++  +  +  N +    +  +  +T+         +  KL K  K+  W+  +  R  I+ F  T PL+  + + A+  RHW+++      +F+ +S++F L  ++E  +  + E+I +I  SA KE  IE  L+ +   W         +K +G   L+G  T E+   +ED+ +AL  + ++R+   F+  +  W + L+   E+IE  L VQ  W+YLE +F+G DI KQLP E+  F  ++ +W+ IM R ++  N ++       L   L  +   LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K +   +KV       + + + S + E +     +  +G VE WLGD+ +  R +L  ++R+  + +     K  ++   +  QV +   Q+ WT D  + L  +K   DKKI++   +  + ILN+       NLTKI R K   L+TI +H RD+ + L    +     F+WL Q RFY+++D D C++  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +DY+ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV A QI  +L+        F F DG  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF    +L+KK YTLY L  +QLS+Q HYDFGLR + S+LR  G  +R  PD ++  +++  +RDMN++KL   D  LF ++++DLFP +++    Y  +   ++++I    L    P+ L K+ QL+ET+  RH  M +G +G+GKT    +L   + ++   G+P+    +E  +NPKA++  +++G  D++TN+WTDGI S++ R     +K +  W++ DGPVD +WIEN+NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   + L W+P ++SWL   +   A    +   F+ + ++   +        +   E + I     L + L    +G++    E   + +E   VFSM+WS+ A ++ E R ++  ++   + + P     + DT++EY V+ K   W  +  ++P+ + YP +    +  I+VP VD  R ++L++++      +LL+G  GT KT I +         Q     +N S+ TT N  Q  +ES V+KR    + P GG+ M  F+DD+NMP  + +G Q   E++R  ++    Y   K      I ++ ++AAM  PGGGR  I  RL+ +F+I N T P+ +   +I RI G       + F+ +V+   N +  AT  ++     + LPTP K HY+FNLRD+S+++QGML  N D  ++ S +  LW HEC RV +DR  + AD + F   +         +T    C S      +  P F DFL++                PK+YE +     L   +   + +YN +     + LV F++A+ H+ +I RVI   +G+ LLVG+GGSG+QSL RLAS I  Y TFQI +T     KH   Y      +D+K LYR +G   K  +F+F D +I DESFLE +NN+LSSGE+ NL+  DE +EI   ++   + E  + P S+++L  Y + RV   LH+VLC SP+G+ FRN   ++P L++  TI+WF  WP++AL+ V+   L   ++ +   + + V          VA+         RR  +VTP  YL  +SGYK++  +KR+E+   A ++ TGL K+ E  E V  +S EL   +K++   +K+  E L  +  +   A + ++ V    +       + +AL +N  +D       LE A PAL+EA  ALE++  + I  +K  GRPP  +  +M  V+IL                 +PTW EA + +   NF+ SL+NF KD I+D+V+  +  Y    DF       VS     LC W +AM  +  + + V P +  +    ++L      L  AQE L    ++L++++ +Y++ + +K+ L   +E    K+  A  L+ GLAGE+ RW E  +  ++ +  LVGD L+  AFLSY GPF  ++R+ I+ + W  ++    +P +      + L +   + +WNIQGLP+D  S +NG+IVTR  R+ L+IDPQ Q   WI+N E    L++  L    +   LE A+  G P+L+++V E +DP L+ +L K+  + G    +++GDKEV+    F+ Y+TTKL NP Y+PE  AKT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK KELED +L  L    GSL++D  L+  L  +K TA +V ++L     TEI  + ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF  S+  S +S     RI+ + +Y TY V+RYT R  +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F  +     +  + W  W+ + APE+A +P  ++N     +++L++RS   DR       +I   +G RF E  + N++ + E+    +P++  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +LL   + +G W+ L NCHL L++M   D+ +E +   E+ H SFR W+++  HP FPI+ILQ+ IK T +PP G++A + R Y L+++ Q    +   ++K +LF + F H+ + ER+KF  +GWNI Y FN SDF  +   +  +LD+ +      W  + Y+I  + YGG VTDD+D+RLL TY  ++F  +  +  F   S  + Y IP   SL  Y+ +I  LP +D PE FG H NAD+  + + A  +  T++++QP+ +   A G+TRE  V  LA D+ Q++PE  DY      E  QK+ +L   PLN+ L QE+ R   ++  +  +L DL+  I G I+MS +L++  + IFDA +P  W K       L  W  DL  R EQF  W    R PV FW++GF  P GFLTA+ Q   R +   ++D++     V+     ++   P +GV+V GLYL+GAGW+ +++ L E  P  L   +P +H        P   + K+ +  Y CP Y  P R       +++  ++L++    PDHWI RG ALL  +
Sbjct:  924 IQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRG--TEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTH-HPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRI-QKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHF-DGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGL-QSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWL--EKRPKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREIEGSFP-----NKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPN--APFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTK-QTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKS---QIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPS------KRPPIFGDFLKE----------------PKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVT-----KH---YRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVE--QVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKD-------LEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGN--------------EPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQL-QVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYE---ETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDY------EGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNV-SVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHF------RPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSL 4425          

HSP 2 Score: 100.138 bits (248), Expect = 1.283e-19
Identity = 76/277 (27.44%), Postives = 133/277 (48.01%), Query Frame = 1
Query:  598 FIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRL-----VAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTN 1413
            FIR     +T  N  A + F  +    G  + AL R +  +  P +     W          S  + F   L +FL  L       D++ +LE          + IP+  +     + +   E +++LE  +  W +QI+++LS  E +    +++GP  E+ +W++R    + + +Q+  K V  V +ILH AKS  L  + +L  +I D + +A+ N+ +L  L + +  L+   P D+   +P LI+ IR+I   S +YN+ ER+TSLF KV +
Sbjct:  141 FIRQAPVPITWENFEATVQFGTVR---GPYIPALLRLLGGVFAPQIFANTGWPE--------SIRNHFASHLHKFLACLT------DTRYKLEGH------TVLYIPAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEMLSAQETVE-TGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVCD 393          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 904/3421 (26.43%), Postives = 1638/3421 (47.88%), Query Frame = 1
Query: 4000 TVQDHLLEIQPKF--KGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYP-----DIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVG-GDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDK-ILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSL-HSVIRSASITINDSQFKLFEFET-----------SFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQ------CIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDD---------SEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDP-------WRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC----GEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGE---HIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSIL--------------------------------------DWQP-----ILRSWLLILETTDAVSNTILNTFKLIFSEAYRYV---TQTLSPKMVTLECNYIRQAIDLLAGLV-HGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRM---GTTFGPPG-GRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGG-GRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVIN-----SGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGS--EVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRP----PSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFE------------------IVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELD----IVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPIT--SKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQ-------------------IKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLE--------TFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAE--GVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVH-ARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLF-CVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKR------GVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFN------PKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKD---SGGGAGETRESVVYR---LADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSW-ESATLGFWFTDLLDRNEQFHSWLYEG-----RPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVL--------SNDVTKFMKEDVNNSPSEG 13662
            ++Q  ++ +Q KF  + EL+E      +  +  + +++   P+     P+EA + +T ++ K ++L  +            L  + +       +    +EL  ++ +++    V   ++   +  W  +    I Q L +  N+ ++LP   + +++Y+ +++ +  + +   L+ ++   A+  RHW ++  +   +   +  +  L  + +A +L ++  I+ I + A  E  +E  L+ +   W        +++++  L+   D   ++ + +++   +L A+  + Y   F+   Q W +KL     + + W+ VQ  W+YLE +F G  +I+  LP E+ RF  I      +M++    P ++   +      +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F     +  +E+  D+ I A +S+E E V L + ++ +   ++ + D L+     + H++ R  + ++  + F     +T            FP+QV  L  ++ W  + E+ L   K  + + QA     +  L  L     +    I R K E LIT  VH+RD    LV +KI    DF WL+  RFYF  D  Q      C+V + +  F Y  E+LG  +RLV TPLTDRCY+T++QAL   LGG+P GPAGTGKTE+ K +G  LG+FV+VFNC +  D++ +GRI  GL Q G+WGCFDEFNR+E  +LS  +QQI  +    +   +  +   G  ++++   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDR +I +V L S GF     L+ K   L+ LC+EQLS Q HYDFGLR +  VL + G  KR+  D          +E  ++++ + +  + KLV+ED AL  SL+ D+FP +  +     ++   +    ++  LI  D        W  K++QL++   + HG+M +G SG+GKT    VL++A+       G  H    ++ KA++   ++G +D  T +WTDG+F+++ R+     +GE     W+I DG VD  W+ENLNSVLDDNK LTL NG+R+ + PN +IIFEV ++  A+ ATVSR GMV+ S  ++                                      D +P     I R+  L L+T  +    +  + K   SE    +    Q L     ++    IR+ +    GL+   ++I +I++  L  ++  +++W+     + + R  + +FI     + +P       + +Y V   G+W+ W ++VP  +    H      ++VP +D  R + L+     ++K ++L G  G+ KT+ +     +   E ++  ++NFSS+TTP +  RT + Y + R    G    P    + + IF D+IN+P  +++G Q     +RQ++E+ G Y       + ++  IQ + A   P   GR+ +  R  R   I     P   S+ +I+               P V+   + L  A   ++  ++ +      + HYV++ R+L+R  +G+    S+ I      S  +L+ LW HE +R+  DR   + +++W +K +  T E   G+   +   L+    +  +L                  P   E ++ Y  +S RL  +   Y E +    + LV F   + H+++I R+ R ++GH LL+G  G+GK +L+R  ++++G   FQ+        K +  Y  ++  ED++ + R +G   + + F+  ++ + D  FLE LN +L++GE+  LF  DE   ++ ++     KE  +R      S++ L +++  +V++ LHVV   +P G   R R+   P L + C ++WF  W ++AL  V +    T +                  + S P  + AVVNT+ +    V +      ++  R+   TP+ +L FI  +  ++ +KR ++      +N GL K+ E  E V EL K L +K  EL+  ++ A   L ++      A++ K+  + ++      +  ++  K   E  L   +PA+ EA+ A++ IK   +  VK +  PP  +   ++ + IL     ++V  D         W    ++M   +F+T +L F  + +  E++  ME Y    D+        S     +  W +A   + ++  +V PL+  L     +LE    +     +++D +  EL+      + EY + + + + ++ D  + + K+  +  L+  L  ER+RW+  S  F +Q+  LVGD L+ +AFL+Y G ++Q  R+ +   W + +V  G+ F  D+  I  L+      +W +  LP D+L  +N +++ R  RYPL+IDP GQ   +I  +     +Q T+   + FR +LE AL  G  LL++DV E  DP L+ VL +   ++G    + +GD+++D+   FQ+++ T+     ++P++ ++ + ++FTVT   L  Q L  V+ +E+ +++ +R  L++   E   + + LE  LL  L  ++G +++D S+IE L   K  A +V QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T  +KR+  I   L   VFR  +RG   +DK    +LL M+I ++S                      K++E    I GG  LD   VE K           ++ +  K+  F+ +   +  N     +W  +D P E+++P  +D+ +            L+++ +  PDR +  A + +       F +   V+  L  +  E   + P++   + G D +  IE LA + N +  SI++G  +  + A   L  + + GRW+LL+N HL  +++ + LE    +   H  FR ++T E HPK P +IL+      ++P  G++A L R+ + +   +L  T A   +  L+  V +LH  VQER ++ P+GW+  YEF+ +D       +   +D +   R       + W T+  ++ +  YGG++ + +D+ LL+   +N F+ + F       PK+        P+    D+   ++++L     P   GL  NA+ +  T     ML  ++ +  ++   +  G  E +   + +   LA   LQ LP++     VK +        PL  F ++EV+   +++  +R  L ++          +   +    ++    +P+ W + +     T+  W TDL   NE+    +  G     +   FW+ G F+P+ ++TA RQ++ + +  W+L+ + L        S DV +    D+  + S G
Sbjct:  266 SIQTQMMNLQTKFAQEDELVE------KRTVETLTEWNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQM--MKEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEE--DRSITAFHSREGEKVDLVKIVSTK---DVRINDWLQALEAEMKHTLARQLAASL--THFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAV----VKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYF--DPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLT-NLVWAFSGDGKWKSREMMSDFIRQATTISLP-PNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAAL-RSQQEMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAML----KMTPAVRGLADQLTNAMVDVYLASQ-EHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLS-------------RNYVPVTREELQDY--VSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQL--------KVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLG---ENVGTD---------WKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNEL----KRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNP-ESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQ-LEKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRL--TKAPTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI----VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDL---NERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNLHIHIGRTDSTDVFRISGIDIRGAKSVG 3567          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1153.27 bits (2982), Expect = 0.000e+0
Identity = 904/3421 (26.43%), Postives = 1638/3421 (47.88%), Query Frame = 1
Query: 4000 TVQDHLLEIQPKF--KGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYP-----DIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVG-GDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDK-ILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSL-HSVIRSASITINDSQFKLFEFET-----------SFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQ------CIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDD---------SEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDP-------WRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC----GEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGE---HIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSIL--------------------------------------DWQP-----ILRSWLLILETTDAVSNTILNTFKLIFSEAYRYV---TQTLSPKMVTLECNYIRQAIDLLAGLV-HGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRM---GTTFGPPG-GRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGG-GRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVIN-----SGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGS--EVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRP----PSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFE------------------IVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELD----IVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPIT--SKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQ-------------------IKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLE--------TFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAE--GVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVH-ARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLF-CVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKR------GVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFN------PKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKD---SGGGAGETRE---SVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSW-ESATLGFWFTDLLDRNEQFHSWLYEG-----RPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVL--------SNDVTKFMKEDVNNSPSEG 13662
            ++Q  ++ +Q KF  + EL+E      +  +  + +++   P+     P+EA + +T ++ K ++L  +            L  + +       +    +EL  ++ +++    V   ++   +  W  +    I Q L +  N+ ++LP   + +++Y+ +++ +  + +   L+ ++   A+  RHW ++  +   +   +  +  L  + +A +L ++  I+ I + A  E  +E  L+ +   W        +++++  L+   D   ++ + +++   +L A+  + Y   F+   Q W +KL     + + W+ VQ  W+YLE +F G  +I+  LP E+ RF  I      +M++    P ++   +      +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F     +  +E+  D+ I A +S+E E V L + ++ +   ++ + D L+     + H++ R  + ++  + F     +T            FP+QV  L  ++ W  + E+ L   K  + + QA     +  L  L     +    I R K E LIT  VH+RD    LV +KI    DF WL+  RFYF  D  Q      C+V + +  F Y  E+LG  +RLV TPLTDRCY+T++QAL   LGG+P GPAGTGKTE+ K +G  LG+FV+VFNC +  D++ +GRI  GL Q G+WGCFDEFNR+E  +LS  +QQI  +    +   +  +   G  ++++   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDR +I +V L S GF     L+ K   L+ LC+EQLS Q HYDFGLR +  VL + G  KR+  D          +E  ++++ + +  + KLV+ED AL  SL+ D+FP +  +     ++   +    ++  LI  D        W  K++QL++   + HG+M +G SG+GKT    VL++A+       G  H    ++ KA++   ++G +D  T +WTDG+F+++ R+     +GE     W+I DG VD  W+ENLNSVLDDNK LTL NG+R+ + PN +IIFEV ++  A+ ATVSR GMV+ S  ++                                      D +P     I R+  L L+T  +    +  + K   SE    +    Q L     ++    IR+ +    GL+   ++I +I++  L  ++  +++W+     + + R  + +FI     + +P       + +Y V   G+W+ W ++VP  +    H      ++VP +D  R + L+     ++K ++L G  G+ KT+ +     +   E ++  ++NFSS+TTP +  RT + Y + R    G    P    + + IF D+IN+P  +++G Q     +RQ++E+ G Y       + ++  IQ + A   P   GR+ +  R  R   I     P   S+ +I+               P V+   + L  A   ++  ++ +      + HYV++ R+L+R  +G+    S+ I      S  +L+ LW HE +R+  DR   + +++W +K +  T E   G+   +   L+    +  +L                  P   E ++ Y  +S RL  +   Y E +    + LV F   + H+++I R+ R ++GH LL+G  G+GK +L+R  ++++G   FQ+ + S         Y  ++  ED++ + R +G   + + F+  ++ + D  FLE LN +L++GE+  LF  DE   ++ ++     KE  +R      S++ L +++  +V++ LHVV   +P G   R R+   P L + C ++WF  W ++AL  V +    T +                  + S P  + AVVNT+ +    V +      ++  R+   TP+ +L FI  +  ++ +KR ++      +N GL K+ E  E V EL K L +K  EL+  ++ A   L ++      A++ K+  + ++      +  ++  K   E  L   +PA+ EA+ A++ IK   +  VK +  PP  +   ++ + IL     ++V  D         W    ++M   +F+T +L F  + +  E++  ME Y    D+        S     +  W +A   + ++  +V PL+  L     +LE    +     +++D +  EL+      + EY + + + + ++ D  + + K+  +  L+  L  ER+RW+  S  F +Q+  LVGD L+ +AFL+Y G ++Q  R+ +   W + +V  G+ F  D+  I  L+      +W +  LP D+L  +N +++ R  RYPL+IDP GQ   +I  +     +Q T+   + FR +LE AL  G  LL++DV E  DP L+ VL +   ++G    + +GD+++D+   FQ+++ T+     ++P++ ++ + ++FTVT   L  Q L  V+ +E+ +++ +R  L++   E   + + LE  LL  L  ++G +++D S+IE L   K  A +V QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T  +KR+  I   L   VFR  +RG   +DK    +LL M+I ++S                      K++E    I GG  LD   VE K           ++ +  K+  F+ +   +  N     +W  +D P E+++P  +D+ +            L+++ +  PDR +  A + +       F +   V+  L  +  E   + P++   + G D +  IE LA + N +  SI++G  +  + A   L  + + GRW+LL+N HL  +++ + LE    +   H  FR ++T E HPK P +IL+      ++P  G++A L R+ + +   +L  T A   +  L+  V +LH  VQER ++ P+GW+  YEF+ +D       +   +D +   R       + W T+  ++ +  YGG++ + +D+ LL+   +N F+ + F       PK+        P+    D+   ++++L     P   GL  NA+ +  T     ML  ++ +  ++   +  G  E +    + +  LA   LQ LP++     VK +        PL  F ++EV+   +++  +R  L ++          +   +    ++    +P+ W + +     T+  W TDL   NE+    +  G     +   FW+ G F+P+ ++TA RQ++ + +  W+L+ + L        S DV +    D+  + S G
Sbjct: 1198 SIQTQMMNLQTKFAQEDELVE------KRTVETLTEWNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQM--MKEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEE--DRSITAFHSREGEKVDLVKIVSTK---DVRINDWLQALEAEMKHTLARQLAASL--THFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAV----VKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYF--DPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLT-NLVWAFSGDGKWKSREMMSDFIRQATTISLP-PNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAAL-RSQQEMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAML----KMTPAVRGLADQLTNAMVDVYLASQ-EHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLS-------------RNYVPVTREELQDY--VSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSK--------YTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLG---ENVGTD---------WKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNEL----KRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNP-ESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQ-LEKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRL--TKAPTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI----VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDL---NERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNLHIHIGRTDSTDVFRISGIDIRGAKSVG 4499          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1153.27 bits (2982), Expect = 0.000e+0
Identity = 904/3421 (26.43%), Postives = 1638/3421 (47.88%), Query Frame = 1
Query: 4000 TVQDHLLEIQPKF--KGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYP-----DIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVG-GDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDK-ILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSL-HSVIRSASITINDSQFKLFEFET-----------SFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQ------CIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDD---------SEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDP-------WRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC----GEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGE---HIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSIL--------------------------------------DWQP-----ILRSWLLILETTDAVSNTILNTFKLIFSEAYRYV---TQTLSPKMVTLECNYIRQAIDLLAGLV-HGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRM---GTTFGPPG-GRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGG-GRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVIN-----SGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGS--EVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRP----PSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFE------------------IVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELD----IVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPIT--SKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQ-------------------IKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLE--------TFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAE--GVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVH-ARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLF-CVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKR------GVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFN------PKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKD---SGGGAGETRE---SVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSW-ESATLGFWFTDLLDRNEQFHSWLYEG-----RPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVL--------SNDVTKFMKEDVNNSPSEG 13662
            ++Q  ++ +Q KF  + EL+E      +  +  + +++   P+     P+EA + +T ++ K ++L  +            L  + +       +    +EL  ++ +++    V   ++   +  W  +    I Q L +  N+ ++LP   + +++Y+ +++ +  + +   L+ ++   A+  RHW ++  +   +   +  +  L  + +A +L ++  I+ I + A  E  +E  L+ +   W        +++++  L+   D   ++ + +++   +L A+  + Y   F+   Q W +KL     + + W+ VQ  W+YLE +F G  +I+  LP E+ RF  I      +M++    P ++   +      +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F     +  +E+  D+ I A +S+E E V L + ++ +   ++ + D L+     + H++ R  + ++  + F     +T            FP+QV  L  ++ W  + E+ L   K  + + QA     +  L  L     +    I R K E LIT  VH+RD    LV +KI    DF WL+  RFYF  D  Q      C+V + +  F Y  E+LG  +RLV TPLTDRCY+T++QAL   LGG+P GPAGTGKTE+ K +G  LG+FV+VFNC +  D++ +GRI  GL Q G+WGCFDEFNR+E  +LS  +QQI  +    +   +  +   G  ++++   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDR +I +V L S GF     L+ K   L+ LC+EQLS Q HYDFGLR +  VL + G  KR+  D          +E  ++++ + +  + KLV+ED AL  SL+ D+FP +  +     ++   +    ++  LI  D        W  K++QL++   + HG+M +G SG+GKT    VL++A+       G  H    ++ KA++   ++G +D  T +WTDG+F+++ R+     +GE     W+I DG VD  W+ENLNSVLDDNK LTL NG+R+ + PN +IIFEV ++  A+ ATVSR GMV+ S  ++                                      D +P     I R+  L L+T  +    +  + K   SE    +    Q L     ++    IR+ +    GL+   ++I +I++  L  ++  +++W+     + + R  + +FI     + +P       + +Y V   G+W+ W ++VP  +    H      ++VP +D  R + L+     ++K ++L G  G+ KT+ +     +   E ++  ++NFSS+TTP +  RT + Y + R    G    P    + + IF D+IN+P  +++G Q     +RQ++E+ G Y       + ++  IQ + A   P   GR+ +  R  R   I     P   S+ +I+               P V+   + L  A   ++  ++ +      + HYV++ R+L+R  +G+    S+ I      S  +L+ LW HE +R+  DR   + +++W +K +  T E   G+   +   L+    +  +L                  P   E ++ Y  +S RL  +   Y E +    + LV F   + H+++I R+ R ++GH LL+G  G+GK +L+R  ++++G   FQ+ + S         Y  ++  ED++ + R +G   + + F+  ++ + D  FLE LN +L++GE+  LF  DE   ++ ++     KE  +R      S++ L +++  +V++ LHVV   +P G   R R+   P L + C ++WF  W ++AL  V +    T +                  + S P  + AVVNT+ +    V +      ++  R+   TP+ +L FI  +  ++ +KR ++      +N GL K+ E  E V EL K L +K  EL+  ++ A   L ++      A++ K+  + ++      +  ++  K   E  L   +PA+ EA+ A++ IK   +  VK +  PP  +   ++ + IL     ++V  D         W    ++M   +F+T +L F  + +  E++  ME Y    D+        S     +  W +A   + ++  +V PL+  L     +LE    +     +++D +  EL+      + EY + + + + ++ D  + + K+  +  L+  L  ER+RW+  S  F +Q+  LVGD L+ +AFL+Y G ++Q  R+ +   W + +V  G+ F  D+  I  L+      +W +  LP D+L  +N +++ R  RYPL+IDP GQ   +I  +     +Q T+   + FR +LE AL  G  LL++DV E  DP L+ VL +   ++G    + +GD+++D+   FQ+++ T+     ++P++ ++ + ++FTVT   L  Q L  V+ +E+ +++ +R  L++   E   + + LE  LL  L  ++G +++D S+IE L   K  A +V QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T  +KR+  I   L   VFR  +RG   +DK    +LL M+I ++S                      K++E    I GG  LD   VE K           ++ +  K+  F+ +   +  N     +W  +D P E+++P  +D+ +            L+++ +  PDR +  A + +       F +   V+  L  +  E   + P++   + G D +  IE LA + N +  SI++G  +  + A   L  + + GRW+LL+N HL  +++ + LE    +   H  FR ++T E HPK P +IL+      ++P  G++A L R+ + +   +L  T A   +  L+  V +LH  VQER ++ P+GW+  YEF+ +D       +   +D +   R       + W T+  ++ +  YGG++ + +D+ LL+   +N F+ + F       PK+        P+    D+   ++++L     P   GL  NA+ +  T     ML  ++ +  ++   +  G  E +    + +  LA   LQ LP++     VK +        PL  F ++EV+   +++  +R  L ++          +   +    ++    +P+ W + +     T+  W TDL   NE+    +  G     +   FW+ G F+P+ ++TA RQ++ + +  W+L+ + L        S DV +    D+  + S G
Sbjct: 1198 SIQTQMMNLQTKFAQEDELVE------KRTVETLTEWNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQM--MKEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEE--DRSITAFHSREGEKVDLVKIVSTK---DVRINDWLQALEAEMKHTLARQLAASL--THFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAV----VKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYF--DPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLT-NLVWAFSGDGKWKSREMMSDFIRQATTISLP-PNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAAL-RSQQEMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAML----KMTPAVRGLADQLTNAMVDVYLASQ-EHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLS-------------RNYVPVTREELQDY--VSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSK--------YTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLG---ENVGTD---------WKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNEL----KRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNP-ESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQ-LEKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRL--TKAPTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI----VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDL---NERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNLHIHIGRTDSTDVFRISGIDIRGAKSVG 4499          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 456.833 bits (1174), Expect = 6.819e-128
Identity = 321/996 (32.23%), Postives = 515/996 (51.71%), Query Frame = 1
Query: 4372 IDTINQQ-LLDFQNKCRKLPKALKEW---------QAYDDLR--KTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAP--LLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXX--XXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLT-KIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNP---GYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLL 7299
            +DT++Q+  + F++K     + L++W         Q +  +R  K ++ F E    L+    + +   HW  +    G       +     +L+     ++ N ++++ +   A  E  I   ++ +T  W+AQ+    +    S G+ L       E ++ ++DS   L +L S+ Y + F  K   W  +L      +     +Q  WIYLE +F  G     LP EA RF  +D  ++ I+    +   +V  C    +L + L  +++QL  CQK+L  +LE+KR  FPRF+F+ D  LLEILGQ+++   IQ H+  +F     V F     + I+++ S E E V L + +     VE WL +L    R++L  +   A   + D+Q  L      +PSQV  L  ++ ++   E  L  S          N     +L +L A T   +  K+   K ++LI   +H  D+ D L+  +  +   + W +Q RFY        ++     +F Y  E+ G   +LV TPLTD+CY+TL+QA+ M LGG P GPAGTGKTE+ K +   +G+ V+VFNC + +D   +GRI+ G+ + G+WGCFDEFNR++  VLS  + QI  +    K R     F  G  V ++P   IF+T+NP   GY GRQ++P+NLK  FR V M  PD  +I    L S GF+  T L++K  ++++L  + LSKQ HYD+GLR +  VL   GA +R   + +E  +V++ L    LSKL   D   F SLI+D+F  +      + ++   +    ++  +   D    K+ QL+E  R R G++ +G +G+GK+    +L R++    +P K  + NPKA+   ++ G +D+ T +W+DGI +   R   K     H W++ DG +D  W+E LNSVLDDN+ LT+ +G+RI    N   +FE  ++  ASPATVSR GM+Y+S   +  + I+ SWL+
Sbjct: 1102 LDTMSQEEWIVFRSKTYLFDEFLQKWMEKLKGTGSQTHMSVRLMKDVEHFKEVSSALKFCRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTL-WAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRG----ALPSEASRFSRVDSEYRAILNDVSKDARLVSLC-SRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFS-STGETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQA---VADAQPSL----AKYPSQVLCLAEEVKFSASIENNLNGSSD-------LNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNGG--IVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTF-GGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTSVHH-WIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLV 2072          

HSP 2 Score: 410.994 bits (1055), Expect = 5.428e-114
Identity = 425/1718 (24.74%), Postives = 781/1718 (45.46%), Query Frame = 1
Query: 8866 ISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDE----VVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRN-KEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVEL-SKLP-YFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFS--FYKGYPIPSGKSLDEYRAFIDK-LPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESV--VYRLADDMLQR--LPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYE--------GRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPS-EGVYVHGLYLDGAGWEARSAKLRE-PLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALL 13947
            I RV+    GH  L G  G G++   RL + +   + F   +T+N        ++      +LK     +    + +  +  D++++   FL+ +N++L+SG +  LF + E+D ++  LVS    E   +      LQ++   R+   +HVVL        F+      P ++  C + +  R+ +++L+ +    + +  I +T  +       +  F D++    +N  +       + P  Y  F+  + ++   KR  +     R+  G+ KL EA + V ++ K+   K K L   + +A E L  +    S A+  K  ++ +K   E     I   KA  +E+L+  +P + EA  A+ +IK + ++ ++ L  PP  +  I+  VL LF   LD+            +W+   K +S S     ++NF  + I +E    V  L++   N   F  A+AK  S   A L +W KA   +  I +++ PL+         L+ A K++ N  + L +  + +  ++ ++   M E   ++ D +  +  +  A  L+  L+GE ERW    +TF ++  ++    LI +AF++Y G  ++  R  L +S     + N  P    ++  S+ T+      W  +GLP D+LS++NG I+  +   PL+ID  GQ   ++    EK+   +    +       +E A+  G+ ++I+D+ E  D AL  +L K+    G    +  G K +D    F++Y  T+       P  + + +I++FT TI  L  QLL V I  EK ELE   + L+ +    K + + LE  LL +L S++G+L+E+ +L++ L  +KE+AE + + ++       ++ + ++ Y P++   S L+F    +   N MY  S+   + LF K++   +    +S R+  +   +   VF + +RG +  D+  F +        K  Q K  E    +    + DL+A+     +WI      +L  + + LP  F     Q   +D  W  +  +   E A   +    +  F+K+L I++  P+R       ++ +T+ I         L+ + +E +   P++  L+ G+DP+  +   A   N+   SISMGQGQE+ A + +  S  +G W+ L N HL L  +    + ++ T   HE+FR W+TTEG  +FP  +LQ  +K T++PP G+R  L RTY  + +   ++         +F +A+LH  +QERR F P GW   YEF  SD      FV+    +        W+ V  ++  V YGGR+ +D+D ++L++Y    F  E  N +      KG  + +  ++ EY   I K +P +D P  FGL  N    ++   A++ +++I  +   D+     +  + +  +  L   + Q   LP+   P  ++       S  P++  L  E      +I  +  ++  +  ++    + S  ++  + ++   + P  W  + W   +    + +++ +  +    L+E          P+ F  +  F P  FL A+RQ  +R  K   LD ++LS+  T       +  P+ + V V GL L GA +++    LRE  +    Y+  P+V +   S ++      +      + PVY    R+DL  I  +N+    A D W +  VAL 
Sbjct: 2550 IDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTAN--------FSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVA-LVS----EAANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMESQGITTTDAI-------LTGFNDVL----VNLPEHL----SIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVL-LFMGILDT------------SWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSN--SFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSMCK--MFNMPPTFKPLSFASLETEQLN---WKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLEKSETFKAAQPD---LMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDK--SSTRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKEWELFTGVLVDESTDLSALRV---QWISPDRLQSLARIRTHLPSLFNNFQIQ---DDATWNEFSKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLSLT-TPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVITC----QSIFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQLTAN-----KADWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKISQIVSLWKKLCQSDDLPKRELPTAIR-------SADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSM-WAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSRQIK-IPLDQLILSSAWTP------SQLPAKQCVQVQGLLLQGATFDSF---LRETTVSSAAYSQAPIVFLAWTSESSSTITGEQ-----IQVPVYSSSERSDL--ICSVNMPCRGA-DQWNIAAVALF 4169          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 97.0561 bits (240), Expect = 3.537e-19
Identity = 111/489 (22.70%), Postives = 211/489 (43.15%), Query Frame = 1
Query: 4471 TIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPIN---AQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSF--PSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQN-----LTKIERTKF-ETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGC 5904
             + +F +  P+L  +S  AM  RHW+ I   +    +V+  N L+  L+E   +   ++ E +   A KE+ +E  ++ + + W   +F        GELL     T E+   M+  L     +LS+ +       I+ W+  L      +  +      W  +E VF   DIA Q+P E + F  I   W  I  +  E   +++       L+  L  L       +     YL KKR +FPR F +SD  +L ++  + +    ++++  +F +    TFD+    +I+++ S + E + L +P+N   ++ +VE W+ +L    + +L + IR   + I    +KL   ET    P QV  + +++ +T   E ++ Q+              L IL   + +  ++     L K +R +F   L  I+     + + L+  ++    D+ W  Q R+Y+  +     V      + Y+ + + C
Sbjct:  684 VLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEG-NPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATFVTHQG---GELL-----TTELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPS--LTTFDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIR---LLIEKMNYKLSPVETILNEPIQVAAVYLKIAFTWQMENSMKQNS-------------LTILASELKICIRDCQHAVLHKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWHLENVFIRVGTVSTRYDYEVQGVDC 1144          

HSP 2 Score: 83.9593 bits (206), Expect = 4.066e-15
Identity = 52/205 (25.37%), Postives = 104/205 (50.73%), Query Frame = 1
Query: 9967 TIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLM-EPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERW 10578
            T+    ++++K +  PP+ +   M+ V IL   +   +T +         W    KL+S  +FL  + +F +DT++ + V L+ E Y + E+F+  + K  S    GLC W  A+  +  I+K V P +  L   +  ++  +K+L   ++ L    ++L  +  ++++   +KQ LE    +C  +M  A+ L+  L+GE+++W
Sbjct: 2222 TMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVV-NDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKW 2425          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 4636.63 bits (12025), Expect = 0.000e+0
Identity = 2462/4707 (52.31%), Postives = 3213/4707 (68.26%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDV------MVEDYSRTD------------------STSIGPVSAHKKLFIATGSSEPLKGLC-FLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALER-----HISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSK-IWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDS---TEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDI------IKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQ----IDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPI-TIEEFLSMTE--------------QTVEEASEYLAK-----ESKLVEIAVNDIIDILKMNLTESELKNLNAEDG----------------------------------YECLQPD----------PKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPG------------------PGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTK-VKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVG-AVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV-----------------HGMDI--------KE--IKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALP----VPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +DPR  F FQ + D + L   Q+ D +   +      + F PN   KL+++YQ+        V D ++                    S S  P   HKKLF+  G +    G+C ++F  +T K L       D+   ++DA    L+ ++ER      +  + FP L+  EE  S     G      +    L  F +AL   ++  D        D  D+  KI+          + E   +LE  ++ W K I ++L ESEQ+R+E D  GP  EL YWK R ++F+ LL  ++ K+V   +  L  A SR +++W+E D +IT   NEA+DN K++  ++     L   +PV M E I SL+  +R+I+S+SQ+YN+SER ++L VK+TNQMI TCK ++     + IW   R  +  ++S+C +LN  Y    H+T   ++E      +  F FSEN++FGKF+ FC+RL KI ++ N+++ Y+ L   ++EG+        + N        +  + YD LDHR S+F+ D++ F+ +  +L+  I   ++  F+      + +  L +FE+    I   ++D  +K+ ++L+   K +D + K ++K + DPPL RN PPIAG+I W R L   I   M    E    +  +P A  L   Y+ +  +L E+E    + W        + +A + L++ P     G K  VN    I  LI+EAK +  L++++P +A+ L+  +         +  ++  +   + +V   V P+  P + R+     PGL  + WT+    ++ E+ +++++SF +L+ +V DI   RI  VL  M   +L  LP D+ I T++EFL  +E              Q V EA E +        +   EIA +D+I +      + +    N+  G                                  + C +            PK  + + C   V   M  Y++++  + LIK  R  LDT++RR  +  N+         K+P +F     L IP+++ KPNLDE+Q IL  A + I  +++ + QW+      +    ++     N++++   G                  P  +KS    I D+K+VAKAV+QL+      K ++QT +  +  Y  LWK +  T+ + EF      L E    ++  SD++A +   P     G  V  Y+E LK GL  E  S      Q +  K  +EMD +  + + + ++L RP++DLDDVR  M  L ++RE E+ +E+ I PIEEA+ +L +YE+       + VD+L   +  L   A   Q  LL++QP F+ +L   +  FK++ IS+V +Y + GPM  G+ PREASDRL ++Q +F+ +WR+  TY  GEELFGL  TDYP++ +IRKELNLLQKLY+LYN+V+D V+SYYDI W+E++I+ IN +L++FQN+CRKLPK LKEW A+  L+KTIDDFN+ CPLLE M++ AM PRHW+RI  VT + FE DS+ F L+N++EAPLL +KE+IEDICISA+KEKDIEAKLK VTN+WS     F SF +RGELLL+GD T E +  +EDSLM LG+LLSNRYNAPF+ +IQ+WV  L+ + EI+E WLLVQN+W+YLEAVFVGGDIAKQLP+EAKRF  IDKSWQKIMQRAHE P VV CC+GDD L QLLPHL EQLE+CQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASDSHTIQ HLL++FDNTK+V F +  Y+K++AI S E E +QLD  I A+G+VE WL  LL  ++ SLHS+IR+A  TIND  F L  F    P+Q+GLLGIQM+WTRD+E AL + + ++K+M  TN +FL++LN LI  TT+NLTK ERT FETLITIHVHQRDIFD L  + I +  DFEWLKQ RFYFKED D+  +S+TDV F YQNE+LGCTDRLVITPLTDRCYITL+QAL +S+GGAP GPAGTGKTET KDMG+ L K+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQ++VVLT KKE++  F+FTDGD ++M+PEFGIF+TMNPGYAGR+ELPENLKI FRTVAMMVPDR IIIRVKLASCGFL+N  L++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLGA KR N  D+E  IVMRVLRDMNLSKL+D+DE LF+SL+ DLFP   +    YP++ AAI +Q ++A L+ H PW LKLIQL+ETQ VRHG+MTLGPSGAGKT CI+ LM+AMT  G+ H+EMRMNPKAITA QMFGRLDVATNDWTDGIFS LWR+T K+K GEH+WL+LDGPVD+IWIENLNSVLDDNKTLTLANGDR+ MAP  KIIFE HNIDNASPATVSRNGMVYMSSS LD +PI+++WL          +T  + F   F E Y +  Q +  +M  L+CN ++Q + +L GL+                 H  D+        KE      HL +L +F++ W LG  L   DR ++  F+  K++ P          ++TIF++ V+  G W+ W   V  Y+YP    P+Y+SILVP VDN R D+LI TI+ Q +AV++IGEQGT KTVI+K +  K N E  + +S NFSSAT+P  FQRT+ESYV+KR+G TFGPPGGRK+ +FIDDIN+P INEWGDQITNEIVRQ M+M G YSLEKPGDFTTIVD+Q +AAM  PGGGRNDIP RLKRQF +FNC +P N SIDKIFR++G G++  +RGF P+++  V  L+  TR LWQ+T+ K+LPTPAKFHYVF+LRDLSRIWQGM+   S VI S S LM+LWKHEC RV  DRFT   DK+WF   L     EE G      +   P FVDF++DAPE TGEE E+T++E PK+YEP+ S+E L +RL+ ++ Q+NE VRG  +DLVFF DAM HLVKISR+IR  +G  +LVGVGGSGKQSLT+LASFI+GY+TFQI LT         SYNV+N +EDLKLLYRT G  GKG TFLFTD +IK+E FLE+LNN+LSSG I+NLF+RDE  EI+QEL  VMK+E  R+  + E++ +++++R    LHV  CFSPVGE FR+R  RFP L+SGCTIDW   WPKDAL++V+ +FLS FEI  TP VK+ +VN +G  QD+VAE    YFQRFRR THVTPKSYL+FI+GYK +Y  K++E+     +M+TGL+KL EA+ SV  L K+L V E+EL  A K A  VL +V  +A  A+ VK QV +VKD+AEALV  I+ +KA+AEEKLEAAKPAL+EAE AL TIKP HIATV+KLGRPPHLIMRIMDCVLILFK++L     D   PCPKP+W E++K+M+ + FL  L N+PKDTINDE++DL++PYF MED+N+  A+ V GDVAGL SWTKAM+ F S+NKEVLPLKANL +Q+++L+ AM +L  A+E L  +++ L  V+ +Y+KA+ EKQ L D A  C RKMT A ALI GL+ E+ RWT  SK F  Q+ +LVGDVL+ T FLSYCGP+NQ+FR  L ++W   L    IPFT  +  I+ML D++T+SEW +QGLPNDELSVQN LI T++  YPLL+DPQ QGK WI+ KE  +ELQ+T+LNHKYFR HLED+LSLGRPLLIEDVG ++DP +DNVLEKNFIKSGS  KV VGDKE DVM GF LY+TTKLPNP+++PEV AKTSIIDFTVT++GLEDQLLG VIL EK +LEAER  L E V +N+R  KELE NLL RL+S++GSLV+DE+LIEVLRVTK TAE+V QKL I   TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SLKQFL +F+ S+  S KS +T +RIN I+ YLTYEV+++T R  YE  K  FT++L +KI   +G I HEEF  FIKGGA+LDLNAV PKP +WI D+TWLNLVE+SKL  F  + + +  N+K W+ W++ + PE   IP GY+  L+ F+KLLLIRSWCPDRT+  AKKYIEE++G  ++E  I +LEEM  E +  TP +C LS+GSDPT  I  LAK+K++   S+SMGQGQE HARK++  SM  G W+LLQN HL L F  E ++++  +E+I +SFR WVTTE H +FPI +LQ+ +KFT +PP GIRA L+R+Y   TQD LD T+A QW P+L+ VAFLHT VQERRKFGP+GWNIPYEFNQ+DF ++VQF+QNHLD+MD K+GVSW+T+ YMIGEVQYGGRVTDD+DKRLL T+   WF   + +  F FYKGY +P  KSL  +  +I+ LP  D+PE FGLH+NADI Y+ ++A  +L TI+++QPK+ GGG GETRES+VY+LADDML++LP  YN +EV+E L +MG L P+NIFL+QE+DRMQ+VI  V + L DLKLAIDGTI+MS  LK++LD ++DARIP  WMK+SWES TLGFW+T+LL+RN QF +W+   RP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD+VVL N +T++ KED+   P+EGVYVHGL+L+GA  + RS KL E   KVLY  +PV+++YA++        A  + + YECP+Y+KP+RTDL Y+  ++ +T   P HW LRGVALLCDIK
Sbjct:   51 MDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQALAFPSLEGDEEDVSCGLIKG------QLLPGLRSFCSALRVCEQVCDHHNVFA--DGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMD--EKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAVME-HVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQ----DVSVADACLLQ-PLLSLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLVDRATAAFKEIAGDDVITLFDAATPKGD----NSGSGGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSILWSCFENPLSLLSTTESLPKGMQDMVCNAVV--EMRRYYSRKVIDVLIKVIRAALDTLRRRFIADENETVF------KKP-VFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPQVSMTVQPRVGRNHNESTGGGKSRRRKIYCLASEERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKNDRTTRQLMEFG-----LQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLK--NRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFV--KESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTR--------SYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTT------AGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4700          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 4632.78 bits (12015), Expect = 0.000e+0
Identity = 2460/4731 (52.00%), Postives = 3213/4731 (67.91%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDV------MVEDYSRTD------------------STSIGPVSAHKKLFIATGSSEPLKGLC-FLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALER-----HISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSK-IWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDS---TEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDI------IKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQ----IDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPI-TIEEFLSMTE--------------QTVEEASEYLAK-----ESKLVEIAVNDIIDILKMNLTESELKNLNAEDG----------------------------------YECLQPD----------PKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPG------------------PGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTK-VKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVG-AVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV-------------------------HGMDIKEIKTS--------------------------HLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALP----VPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +DPR  F FQ + D + L   Q+ D +   +      + F PN   KL+++YQ+        V D ++                    S S  P   HKKLF+  G +    G+C ++F  +T K L       D+   ++DA    L+ ++ER      +  + FP L+  EE  S     G      +    L  F +AL   ++  D        D  D+  KI+          + E   +LE  ++ W K I ++L ESEQ+R+E D  GP  EL YWK R ++F+ LL  ++ K+V   +  L  A SR +++W+E D +IT   NEA+DN K++  ++     L   +PV M E I SL+  +R+I+S+SQ+YN+SER ++L VK+TNQMI TCK ++     + IW   R  +  ++S+C +LN  Y    H+T   ++E      +  F FSEN++FGKF+ FC+RL KI ++ N+++ Y+ L   ++EG+        + N        +  + YD LDHR S+F+ D++ F+ +  +L+  I   ++  F+      + +  L +FE+    I   ++D  +K+ ++L+   K +D + K ++K + DPPL RN PPIAG+I W R L   I   M    E    +  +P A  L   Y+ +  +L E+E    + W        + +A + L++ P     G K  VN    I  LI+EAK +  L++++P +A+ L+  +         +  ++  +   + +V   V P+  P + R+     PGL  + WT+    ++ E+ +++++SF +L+ +V DI   RI  VL  M   +L  LP D+ I T++EFL  +E              Q V EA E +        +   EIA +D+I +      + +    N+  G                                  + C +            PK  + + C   V   M  Y++++  + LIK  R  LDT++RR  +  N+         K+P +F     L IP+++ KPNLDE+Q IL  A + I  +++ + QW+      +    ++     N++++   G                  P  +KS    I D+K+VAKAV+QL+      K ++QT +  +  Y  LWK +  T+ + EF      L E    ++  SD++A +   P     G  V  Y+E LK GL  E  S      Q +  K  +EMD +  + + + ++L RP++DLDDVR  M  L ++RE E+ +E+ I PIEEA+ +L +YE+       + VD+L   +  L   A   Q  LL++QP F+ +L   +  FK++ IS+V +Y + GPM  G+ PREASDRL ++Q +F+ +WR+  TY  GEELFGL  TDYP++ +IRKELNLLQKLY+LYN+V+D V+SYYDI W+E++I+ IN +L++FQN+CRKLPK LKEW A+  L+KTIDDFN+ CPLLE M++ AM PRHW+RI  VT + FE DS+ F L+N++EAPLL +KE+IEDICISA+KEKDIEAKLK VTN+WS     F SF +RGELLL+GD T E +  +EDSLM LG+LLSNRYNAPF+ +IQ+WV  L+ + EI+E WLLVQN+W+YLEAVFVGGDIAKQLP+EAKRF  IDKSWQKIMQRAHE P VV CC+GDD L QLLPHL EQLE+CQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASDSHTIQ HLL++FDNTK+V F +  Y+K++AI S E E +QLD  I A+G+VE WL  LL  ++ SLHS+IR+A  TIND  F L  F    P+Q+GLLGIQM+WTRD+E AL + + ++K+M  TN +FL++LN LI  TT+NLTK ERT FETLITIHVHQRDIFD L  + I +  DFEWLKQ RFYFKED D+  +S+TDV F YQNE+LGCTDRLVITPLTDRCYITL+QAL +S+GGAP GPAGTGKTET KDMG+ L K+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQ++VVLT KKE++  F+FTDGD ++M+PEFGIF+TMNPGYAGR+ELPENLKI FRTVAMMVPDR IIIRVKLASCGFL+N  L++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLGA KR N  D+E  IVMRVLRDMNLSKL+D+DE LF+SL+ DLFP   +    YP++ AAI +Q ++A L+ H PW LKLIQL+ETQ VRHG+MTLGPSGAGKT CI+ LM+AMT  G+ H+EMRMNPKAITA QMFGRLDVATNDWTDGIFS LWR+T K+K GEH+WL+LDGPVD+IWIENLNSVLDDNKTLTLANGDR+ MAP  KIIFE HNIDNASPATVSRNGMVYMSSS LD +PI+++WL          +T  + F   F E Y +  Q +  +M  L+CN ++Q + +L GL+                         H   ++E +                            HL +L +F++ W LG  L   DR ++  F+  K++ P          ++TIF++ V+  G W+ W   V  Y+YP    P+Y+SILVP VDN R D+LI TI+ Q +AV++IGEQGT KTVI+K +  K N E  + +S NFSSAT+P  FQRT+ESYV+KR+G TFGPPGGRK+ +FIDDIN+P INEWGDQITNEIVRQ M+M G YSLEKPGDFTTIVD+Q +AAM  PGGGRNDIP RLKRQF +FNC +P N SIDKIFR++G G++  +RGF P+++  V  L+  TR LWQ+T+ K+LPTPAKFHYVF+LRDLSRIWQGM+   S VI S S LM+LWKHEC RV  DRFT   DK+WF   L     EE G      +   P FVDF++DAPE TGEE E+T++E PK+YEP+ S+E L +RL+ ++ Q+NE VRG  +DLVFF DAM HLVKISR+IR  +G  +LVGVGGSGKQSLT+LASFI+GY+TFQI LT         SYNV+N +EDLKLLYRT G  GKG TFLFTD +IK+E FLE+LNN+LSSG I+NLF+RDE  EI+QEL  VMK+E  R+  + E++ +++++R    LHV  CFSPVGE FR+R  RFP L+SGCTIDW   WPKDAL++V+ +FLS FEI  TP VK+ +VN +G  QD+VAE    YFQRFRR THVTPKSYL+FI+GYK +Y  K++E+     +M+TGL+KL EA+ SV  L K+L V E+EL  A K A  VL +V  +A  A+ VK QV +VKD+AEALV  I+ +KA+AEEKLEAAKPAL+EAE AL TIKP HIATV+KLGRPPHLIMRIMDCVLILFK++L     D   PCPKP+W E++K+M+ + FL  L N+PKDTINDE++DL++PYF MED+N+  A+ V GDVAGL SWTKAM+ F S+NKEVLPLKANL +Q+++L+ AM +L  A+E L  +++ L  V+ +Y+KA+ EKQ L D A  C RKMT A ALI GL+ E+ RWT  SK F  Q+ +LVGDVL+ T FLSYCGP+NQ+FR  L ++W   L    IPFT  +  I+ML D++T+SEW +QGLPNDELSVQN LI T++  YPLL+DPQ QGK WI+ KE  +ELQ+T+LNHKYFR HLED+LSLGRPLLIEDVG ++DP +DNVLEKNFIKSGS  KV VGDKE DVM GF LY+TTKLPNP+++PEV AKTSIIDFTVT++GLEDQLLG VIL EK +LEAER  L E V +N+R  KELE NLL RL+S++GSLV+DE+LIEVLRVTK TAE+V QKL I   TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SLKQFL +F+ S+  S KS +T +RIN I+ YLTYEV+++T R  YE  K  FT++L +KI   +G I HEEF  FIKGGA+LDLNAV PKP +WI D+TWLNLVE+SKL  F  + + +  N+K W+ W++ + PE   IP GY+  L+ F+KLLLIRSWCPDRT+  AKKYIEE++G  ++E  I +LEEM  E +  TP +C LS+GSDPT  I  LAK+K++   S+SMGQGQE HARK++  SM  G W+LLQN HL L F  E ++++  +E+I +SFR WVTTE H +FPI +LQ+ +KFT +PP GIRA L+R+Y   TQD LD T+A QW P+L+ VAFLHT VQERRKFGP+GWNIPYEFNQ+DF ++VQF+QNHLD+MD K+GVSW+T+ YMIGEVQYGGRVTDD+DKRLL T+   WF   + +  F FYKGY +P  KSL  +  +I+ LP  D+PE FGLH+NADI Y+ ++A  +L TI+++QPK+ GGG GETRES+VY+LADDML++LP  YN +EV+E L +MG L P+NIFL+QE+DRMQ+VI  V + L DLKLAIDGTI+MS  LK++LD ++DARIP  WMK+SWES TLGFW+T+LL+RN QF +W+   RP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD+VVL N +T++ KED+   P+EGVYVHGL+L+GA  + RS KL E   KVLY  +PV+++YA++        A  + + YECP+Y+KP+RTDL Y+  ++ +T   P HW LRGVALLCDIK
Sbjct:   51 MDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQALAFPSLEGDEEDVSCGLIKG------QLLPGLRSFCSALRVCEQVCDHHNVFA--DGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMD--EKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAVME-HVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQ----DVSVADACLLQ-PLLSLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLVDRATAAFKEIAGDDVITLFDAATPKGD----NSGSGGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSILWSCFENPLSLLSTTESLPKGMQDMVCNAVV--EMRRYYSRKVIDVLIKVIRAALDTLRRRFIADENETVF------KKP-VFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPQVSMTVQPRVGRNHNESTGGGKSRRRKIYCLASEERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKNDRTTRQLMEFG-----LQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLK--NRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFV--KESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTR--------SYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTT------AGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4724          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 4630.08 bits (12008), Expect = 0.000e+0
Identity = 2463/4728 (52.09%), Postives = 3216/4728 (68.02%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDV------MVEDYSRTD------------------STSIGPVSAHKKLFIATGSSEPLKGLC-FLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALER-----HISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSK-IWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDS---TEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDI------IKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQ----IDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPI-TIEEFLSMTE--------------QTVEEASEYLAK-----ESKLVEIAVNDIIDILKMNLTESELKNLNAEDG----------------------------------YECLQPD----------PKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTH--------------------MHLHHKQIQ-ELEKLAEENNDDNKLPG------------------PGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTK-VKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVG-AVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV-----------------HGMDI--------KE--IKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALP----VPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +DPR  F FQ + D + L   Q+ D +   +      + F PN   KL+++YQ+        V D ++                    S S  P   HKKLF+  G +    G+C ++F  +T K L       D+   ++DA    L+ ++ER      +  + FP L+  EE  S     G      +    L  F +AL   ++  D        D  D+  KI+          + E   +LE  ++ W K I ++L ESEQ+R+E D  GP  EL YWK R ++F+ LL  ++ K+V   +  L  A SR +++W+E D +IT   NEA+DN K++  ++     L   +PV M E I SL+  +R+I+S+SQ+YN+SER ++L VK+TNQMI TCK ++     + IW   R  +  ++S+C +LN  Y    H+T   ++E      +  F FSEN++FGKF+ FC+RL KI ++ N+++ Y+ L   ++EG+        + N        +  + YD LDHR S+F+ D++ F+ +  +L+  I   ++  F+      + +  L +FE+    I   ++D  +K+ ++L+   K +D + K ++K + DPPL RN PPIAG+I W R L   I   M    E    +  +P A  L   Y+ +  +L E+E    + W        + +A + L++ P     G K  VN    I  LI+EAK +  L++++P +A+ L+  +         +  ++  +   + +V   V P+  P + R+     PGL  + WT+    ++ E+ +++++SF +L+ +V DI   RI  VL  M   +L  LP D+ I T++EFL  +E              Q V EA E +        +   EIA +D+I +      + +    N+  G                                  + C +            PK  + + C   V   M  Y++++  + LIK  R  LDT++RR  +  N+         K+P +F     L IP+++ KPNLDE+Q IL  A + I  +++ + QW+                     +    +Q+   ++     N++++   G                  P  +KS    I D+K+VAKAV+QL+      K ++QT +  +  Y  LWK +  T+ + EF      L E    ++  SD++A +   P     G  V  Y+E LK GL  E  S      Q +  K  +EMD +  + + + ++L RP++DLDDVR  M  L ++RE E+ +E+ I PIEEA+ +L +YE+       + VD+L   +  L   A   Q  LL++QP F+ +L   +  FK++ IS+V +Y + GPM  G+ PREASDRL ++Q +F+ +WR+  TY  GEELFGL  TDYP++ +IRKELNLLQKLY+LYN+V+D V+SYYDI W+E++I+ IN +L++FQN+CRKLPK LKEW A+  L+KTIDDFN+ CPLLE M++ AM PRHW+RI  VT + FE DS+ F L+N++EAPLL +KE+IEDICISA+KEKDIEAKLK VTN+WS     F SF +RGELLL+GD T E +  +EDSLM LG+LLSNRYNAPF+ +IQ+WV  L+ + EI+E WLLVQN+W+YLEAVFVGGDIAKQLP+EAKRF  IDKSWQKIMQRAHE P VV CC+GDD L QLLPHL EQLE+CQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASDSHTIQ HLL++FDNTK+V F +  Y+K++AI S E E +QLD  I A+G+VE WL  LL  ++ SLHS+IR+A  TIND  F L  F    P+Q+GLLGIQM+WTRD+E AL + + ++K+M  TN +FL++LN LI  TT+NLTK ERT FETLITIHVHQRDIFD L  + I +  DFEWLKQ RFYFKED D+  +S+TDV F YQNE+LGCTDRLVITPLTDRCYITL+QAL +S+GGAP GPAGTGKTET KDMG+ L K+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQ++VVLT KKE++  F+FTDGD ++M+PEFGIF+TMNPGYAGR+ELPENLKI FRTVAMMVPDR IIIRVKLASCGFL+N  L++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLGA KR N  D+E  IVMRVLRDMNLSKL+D+DE LF+SL+ DLFP   +    YP++ AAI +Q ++A L+ H PW LKLIQL+ETQ VRHG+MTLGPSGAGKT CI+ LM+AMT  G+ H+EMRMNPKAITA QMFGRLDVATNDWTDGIFS LWR+T K+K GEH+WL+LDGPVD+IWIENLNSVLDDNKTLTLANGDR+ MAP  KIIFE HNIDNASPATVSRNGMVYMSSS LD +PI+++WL          +T  + F   F E Y +  Q +  +M  L+CN ++Q + +L GL+                 H  D+        KE      HL +L +F++ W LG  L   DR ++  F+  K++ P          ++TIF++ V+  G W+ W   V  Y+YP    P+Y+SILVP VDN R D+LI TI+ Q +AV++IGEQGT KTVI+K +  K N E  + +S NFSSAT+P  FQRT+ESYV+KR+G TFGPPGGRK+ +FIDDIN+P INEWGDQITNEIVRQ M+M G YSLEKPGDFTTIVD+Q +AAM  PGGGRNDIP RLKRQF +FNC +P N SIDKIFR++G G++  +RGF P+++  V  L+  TR LWQ+T+ K+LPTPAKFHYVF+LRDLSRIWQGM+   S VI S S LM+LWKHEC RV  DRFT   DK+WF   L     EE G      +   P FVDF++DAPE TGEE E+T++E PK+YEP+ S+E L +RL+ ++ Q+NE VRG  +DLVFF DAM HLVKISR+IR  +G  +LVGVGGSGKQSLT+LASFI+GY+TFQI LT         SYNV+N +EDLKLLYRT G  GKG TFLFTD +IK+E FLE+LNN+LSSG I+NLF+RDE  EI+QEL  VMK+E  R+  + E++ +++++R    LHV  CFSPVGE FR+R  RFP L+SGCTIDW   WPKDAL++V+ +FLS FEI  TP VK+ +VN +G  QD+VAE    YFQRFRR THVTPKSYL+FI+GYK +Y  K++E+     +M+TGL+KL EA+ SV  L K+L V E+EL  A K A  VL +V  +A  A+ VK QV +VKD+AEALV  I+ +KA+AEEKLEAAKPAL+EAE AL TIKP HIATV+KLGRPPHLIMRIMDCVLILFK++L     D   PCPKP+W E++K+M+ + FL  L N+PKDTINDE++DL++PYF MED+N+  A+ V GDVAGL SWTKAM+ F S+NKEVLPLKANL +Q+++L+ AM +L  A+E L  +++ L  V+ +Y+KA+ EKQ L D A  C RKMT A ALI GL+ E+ RWT  SK F  Q+ +LVGDVL+ T FLSYCGP+NQ+FR  L ++W   L    IPFT  +  I+ML D++T+SEW +QGLPNDELSVQN LI T++  YPLL+DPQ QGK WI+ KE  +ELQ+T+LNHKYFR HLED+LSLGRPLLIEDVG ++DP +DNVLEKNFIKSGS  KV VGDKE DVM GF LY+TTKLPNP+++PEV AKTSIIDFTVT++GLEDQLLG VIL EK +LEAER  L E V +N+R  KELE NLL RL+S++GSLV+DE+LIEVLRVTK TAE+V QKL I   TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SLKQFL +F+ S+  S KS +T +RIN I+ YLTYEV+++T R  YE  K  FT++L +KI   +G I HEEF  FIKGGA+LDLNAV PKP +WI D+TWLNLVE+SKL  F  + + +  N+K W+ W++ + PE   IP GY+  L+ F+KLLLIRSWCPDRT+  AKKYIEE++G  ++E  I +LEEM  E +  TP +C LS+GSDPT  I  LAK+K++   S+SMGQGQE HARK++  SM  G W+LLQN HL L F  E ++++  +E+I +SFR WVTTE H +FPI +LQ+ +KFT +PP GIRA L+R+Y   TQD LD T+A QW P+L+ VAFLHT VQERRKFGP+GWNIPYEFNQ+DF ++VQF+QNHLD+MD K+GVSW+T+ YMIGEVQYGGRVTDD+DKRLL T+   WF   + +  F FYKGY +P  KSL  +  +I+ LP  D+PE FGLH+NADI Y+ ++A  +L TI+++QPK+ GGG GETRES+VY+LADDML++LP  YN +EV+E L +MG L P+NIFL+QE+DRMQ+VI  V + L DLKLAIDGTI+MS  LK++LD ++DARIP  WMK+SWES TLGFW+T+LL+RN QF +W+   RP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD+VVL N +T++ KED+   P+EGVYVHGL+L+GA  + RS KL E   KVLY  +PV+++YA++        A  + + YECP+Y+KP+RTDL Y+  ++ +T   P HW LRGVALLCDIK
Sbjct:   22 MDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQALAFPSLEGDEEDVSCGLIKG------QLLPGLRSFCSALRVCEQVCDHHNVFA--DGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMD--EKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAVME-HVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQ----DVSVADACLLQ-PLLSLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLVDRATAAFKEIAGDDVITLFDAATPKGD----NSGSGGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSILWSCFENPLSLLSTTESLPKGMQDMVCNAVV--EMRRYYSRKVIDVLIKVIRAALDTLRRRFIADENETVF------KKP-VFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPVRTAPLNSFAMFSKILSYQPQQVSMTVQPRVGRNHNESTGGGKSRRRKIYCLASEERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKNDRTTRQLMEFG-----LQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLK--NRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFV--KESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTR--------SYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTT------AGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4692          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 4622.38 bits (11988), Expect = 0.000e+0
Identity = 2461/4752 (51.79%), Postives = 3216/4752 (67.68%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDV------MVEDYSRTD------------------STSIGPVSAHKKLFIATGSSEPLKGLC-FLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALER-----HISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSK-IWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDS---TEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDI------IKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQ----IDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPI-TIEEFLSMTE--------------QTVEEASEYLAK-----ESKLVEIAVNDIIDILKMNLTESELKNLNAEDG----------------------------------YECLQPD----------PKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTH--------------------MHLHHKQIQ-ELEKLAEENNDDNKLPG------------------PGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTK-VKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVG-AVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV-------------------------HGMDIKEIKTS--------------------------HLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALP----VPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +DPR  F FQ + D + L   Q+ D +   +      + F PN   KL+++YQ+        V D ++                    S S  P   HKKLF+  G +    G+C ++F  +T K L       D+   ++DA    L+ ++ER      +  + FP L+  EE  S     G      +    L  F +AL   ++  D        D  D+  KI+          + E   +LE  ++ W K I ++L ESEQ+R+E D  GP  EL YWK R ++F+ LL  ++ K+V   +  L  A SR +++W+E D +IT   NEA+DN K++  ++     L   +PV M E I SL+  +R+I+S+SQ+YN+SER ++L VK+TNQMI TCK ++     + IW   R  +  ++S+C +LN  Y    H+T   ++E      +  F FSEN++FGKF+ FC+RL KI ++ N+++ Y+ L   ++EG+        + N        +  + YD LDHR S+F+ D++ F+ +  +L+  I   ++  F+      + +  L +FE+    I   ++D  +K+ ++L+   K +D + K ++K + DPPL RN PPIAG+I W R L   I   M    E    +  +P A  L   Y+ +  +L E+E    + W        + +A + L++ P     G K  VN    I  LI+EAK +  L++++P +A+ L+  +         +  ++  +   + +V   V P+  P + R+     PGL  + WT+    ++ E+ +++++SF +L+ +V DI   RI  VL  M   +L  LP D+ I T++EFL  +E              Q V EA E +        +   EIA +D+I +      + +    N+  G                                  + C +            PK  + + C   V   M  Y++++  + LIK  R  LDT++RR  +  N+         K+P +F     L IP+++ KPNLDE+Q IL  A + I  +++ + QW+                     +    +Q+   ++     N++++   G                  P  +KS    I D+K+VAKAV+QL+      K ++QT +  +  Y  LWK +  T+ + EF      L E    ++  SD++A +   P     G  V  Y+E LK GL  E  S      Q +  K  +EMD +  + + + ++L RP++DLDDVR  M  L ++RE E+ +E+ I PIEEA+ +L +YE+       + VD+L   +  L   A   Q  LL++QP F+ +L   +  FK++ IS+V +Y + GPM  G+ PREASDRL ++Q +F+ +WR+  TY  GEELFGL  TDYP++ +IRKELNLLQKLY+LYN+V+D V+SYYDI W+E++I+ IN +L++FQN+CRKLPK LKEW A+  L+KTIDDFN+ CPLLE M++ AM PRHW+RI  VT + FE DS+ F L+N++EAPLL +KE+IEDICISA+KEKDIEAKLK VTN+WS     F SF +RGELLL+GD T E +  +EDSLM LG+LLSNRYNAPF+ +IQ+WV  L+ + EI+E WLLVQN+W+YLEAVFVGGDIAKQLP+EAKRF  IDKSWQKIMQRAHE P VV CC+GDD L QLLPHL EQLE+CQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASDSHTIQ HLL++FDNTK+V F +  Y+K++AI S E E +QLD  I A+G+VE WL  LL  ++ SLHS+IR+A  TIND  F L  F    P+Q+GLLGIQM+WTRD+E AL + + ++K+M  TN +FL++LN LI  TT+NLTK ERT FETLITIHVHQRDIFD L  + I +  DFEWLKQ RFYFKED D+  +S+TDV F YQNE+LGCTDRLVITPLTDRCYITL+QAL +S+GGAP GPAGTGKTET KDMG+ L K+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQ++VVLT KKE++  F+FTDGD ++M+PEFGIF+TMNPGYAGR+ELPENLKI FRTVAMMVPDR IIIRVKLASCGFL+N  L++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLGA KR N  D+E  IVMRVLRDMNLSKL+D+DE LF+SL+ DLFP   +    YP++ AAI +Q ++A L+ H PW LKLIQL+ETQ VRHG+MTLGPSGAGKT CI+ LM+AMT  G+ H+EMRMNPKAITA QMFGRLDVATNDWTDGIFS LWR+T K+K GEH+WL+LDGPVD+IWIENLNSVLDDNKTLTLANGDR+ MAP  KIIFE HNIDNASPATVSRNGMVYMSSS LD +PI+++WL          +T  + F   F E Y +  Q +  +M  L+CN ++Q + +L GL+                         H   ++E +                            HL +L +F++ W LG  L   DR ++  F+  K++ P          ++TIF++ V+  G W+ W   V  Y+YP    P+Y+SILVP VDN R D+LI TI+ Q +AV++IGEQGT KTVI+K +  K N E  + +S NFSSAT+P  FQRT+ESYV+KR+G TFGPPGGRK+ +FIDDIN+P INEWGDQITNEIVRQ M+M G YSLEKPGDFTTIVD+Q +AAM  PGGGRNDIP RLKRQF +FNC +P N SIDKIFR++G G++  +RGF P+++  V  L+  TR LWQ+T+ K+LPTPAKFHYVF+LRDLSRIWQGM+   S VI S S LM+LWKHEC RV  DRFT   DK+WF   L     EE G      +   P FVDF++DAPE TGEE E+T++E PK+YEP+ S+E L +RL+ ++ Q+NE VRG  +DLVFF DAM HLVKISR+IR  +G  +LVGVGGSGKQSLT+LASFI+GY+TFQI LT         SYNV+N +EDLKLLYRT G  GKG TFLFTD +IK+E FLE+LNN+LSSG I+NLF+RDE  EI+QEL  VMK+E  R+  + E++ +++++R    LHV  CFSPVGE FR+R  RFP L+SGCTIDW   WPKDAL++V+ +FLS FEI  TP VK+ +VN +G  QD+VAE    YFQRFRR THVTPKSYL+FI+GYK +Y  K++E+     +M+TGL+KL EA+ SV  L K+L V E+EL  A K A  VL +V  +A  A+ VK QV +VKD+AEALV  I+ +KA+AEEKLEAAKPAL+EAE AL TIKP HIATV+KLGRPPHLIMRIMDCVLILFK++L     D   PCPKP+W E++K+M+ + FL  L N+PKDTINDE++DL++PYF MED+N+  A+ V GDVAGL SWTKAM+ F S+NKEVLPLKANL +Q+++L+ AM +L  A+E L  +++ L  V+ +Y+KA+ EKQ L D A  C RKMT A ALI GL+ E+ RWT  SK F  Q+ +LVGDVL+ T FLSYCGP+NQ+FR  L ++W   L    IPFT  +  I+ML D++T+SEW +QGLPNDELSVQN LI T++  YPLL+DPQ QGK WI+ KE  +ELQ+T+LNHKYFR HLED+LSLGRPLLIEDVG ++DP +DNVLEKNFIKSGS  KV VGDKE DVM GF LY+TTKLPNP+++PEV AKTSIIDFTVT++GLEDQLLG VIL EK +LEAER  L E V +N+R  KELE NLL RL+S++GSLV+DE+LIEVLRVTK TAE+V QKL I   TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SLKQFL +F+ S+  S KS +T +RIN I+ YLTYEV+++T R  YE  K  FT++L +KI   +G I HEEF  FIKGGA+LDLNAV PKP +WI D+TWLNLVE+SKL  F  + + +  N+K W+ W++ + PE   IP GY+  L+ F+KLLLIRSWCPDRT+  AKKYIEE++G  ++E  I +LEEM  E +  TP +C LS+GSDPT  I  LAK+K++   S+SMGQGQE HARK++  SM  G W+LLQN HL L F  E ++++  +E+I +SFR WVTTE H +FPI +LQ+ +KFT +PP GIRA L+R+Y   TQD LD T+A QW P+L+ VAFLHT VQERRKFGP+GWNIPYEFNQ+DF ++VQF+QNHLD+MD K+GVSW+T+ YMIGEVQYGGRVTDD+DKRLL T+   WF   + +  F FYKGY +P  KSL  +  +I+ LP  D+PE FGLH+NADI Y+ ++A  +L TI+++QPK+ GGG GETRES+VY+LADDML++LP  YN +EV+E L +MG L P+NIFL+QE+DRMQ+VI  V + L DLKLAIDGTI+MS  LK++LD ++DARIP  WMK+SWES TLGFW+T+LL+RN QF +W+   RP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD+VVL N +T++ KED+   P+EGVYVHGL+L+GA  + RS KL E   KVLY  +PV+++YA++        A  + + YECP+Y+KP+RTDL Y+  ++ +T   P HW LRGVALLCDIK
Sbjct:   22 MDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQALAFPSLEGDEEDVSCGLIKG------QLLPGLRSFCSALRVCEQVCDHHNVFA--DGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMD--EKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAVME-HVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQ----DVSVADACLLQ-PLLSLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLVDRATAAFKEIAGDDVITLFDAATPKGD----NSGSGGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSILWSCFENPLSLLSTTESLPKGMQDMVCNAVV--EMRRYYSRKVIDVLIKVIRAALDTLRRRFIADENETVF------KKP-VFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPVRTAPLNSFAMFSKILSYQPQQVSMTVQPRVGRNHNESTGGGKSRRRKIYCLASEERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKNDRTTRQLMEFG-----LQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLK--NRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFV--KESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTR--------SYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTT------AGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4716          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Match: kl-3 (gene:FBgn0267432 transcript:FBtr0346771)

HSP 1 Score: 4217.54 bits (10937), Expect = 0.000e+0
Identity = 2209/4514 (48.94%), Postives = 3059/4514 (67.77%), Query Frame = 1
Query:  607 STDKALTSNNIAADITFQMLDAS-GGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKL-ENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKS-RSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFE--QIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDI----IDIL------------------KMNLTESELKNLNAEDGYECLQPDPKKPRCLECQP-------------------------CVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPN-ILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENN-DDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSE-FSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEP-YFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTEN------IHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            + +K++ + +++ ++   M+ A      L+ ++  +  ++ P ++ + E+G          +  +FF IL+ +   L +++  + S++    D   +L   + +  +++ A +   T  +L E    +W++QI+ +L E +QI+R+  DVGP   L  W+  ++R+  + E + ++   +    L  ++S + L +W E+D+++T A NEAKDNV+Y+ +L KF+ PL + +P  +I  +P L+ AIR +   + Y+N+   +T L VK++NQ+  T K+++ +                  H K + E Y+  +  T  +++ +S E+ +  S  YI    + F +RL+K+  + N   +YS+L    I G++      K     I  + YD L++R   FD D++ F+ + E  E  +Q F+     +       + +LK+FE   ++CL LD   ++ +V +   + +  ++ +Y + + +P + RNLPP+AG+I W R +FKKI+ PM   K  R  +L   +A + V+ YN M  ++  +E+ Y+  WF  +E  +  L + ++  N    K+ A ++VN D  IL+LI E +++  LNL++P +A+ + + ++ +      +K +L  Y  +  S+ PV   +MR  +  I     P L  +TW S  + DY+EKV   ++        + DI D+RI   +  ++      +PE EP++  EF+  + +   E    L K+S  +E AV DI    ID+L                  K+N T    +     D ++ +Q   K  R +   P                         C+   + +Y+  +    L+  ++ +LD +++ +  ++  +  +PM    +P L   DL +   N    +PNL+ +Q   N AV    +++  +  W       KQ +  E+       D+NK       +S  + + +HKDV +AV  L+  + ++KS ++    + F  Y  LW E+ +  +  F+ T P+  +I     ++ ++  +I +      +G +        + L+SE   WK      L+ +  +++D ++E     +  L +P+ DLDDVR  M  L ++R++ I++++++Q I + Y +  ++ IY    + ++V+ L   ++K+   A+ V D + E++     EL +G+  F +    F  D+D  GPM +GI  +EASDR+ ++Q +FDELWRK+  YS GE+LFGL +TDYP + + ++E N L +LY LY  VL T+  YY++ W+++NI+ I+ +L DFQ +CRKLPK ++ W A+ DL+  IDDFNETCPLLE M++ AM  RHW R+  +    F+  +  F L  L+EAP+L  KE++EDIC+ A KE DIEAKLK + +DWS  S     FK+RG+L+LKG  T EI+S +EDSLM + +L SNRYNAPFK  IQ W+ KL  T +I+E WL+VQNLWIYLEAVFVGGDI+KQLP EAKRF NIDKS+ KIM RA EIPN V CC GD++L+  L  LL+QLE CQKSLTGYLE KRL+FPRFFFVSDP LLEILGQASD  +IQ HLLS+FD   TV F EK  D I ++NS   E V+ +  +   G+VE+WLG LLK  + ++ +++   S+++ND +F   E   SF  Q G++G+Q++WT+DSE AL + +TDK IM+ TN +FL +LN  I +T ++LT ++R +FET++TIHVHQRDIFDDL  L+I +  DFEW KQ+RFY+ ED D  IV ITDV+F+YQNE+LG T+RL ITPLTDRCYITL+QA+GM +GGAPAGPAGTGKTETTKDMGR LGK VVVFNCSDQMD+RGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KE+++ FIF DGD+V ++PEFGIF+TMNPGYAGRQELPENLKI FRTVAMMVPDR IIIRVK+ASCGF +N VLS+K YTLYKLCEEQLSKQVHYDFGLRNILSVLRTLG+ KR NP+D+E  IVMRVLRDMN+SKL+DEDE LF+SL++D+FP +K++T  Y D+  AI K  ++   +N+  W LK++QL+ET  VRHG+M +GP+G+GKT C   ++R  T+ G  HKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRR+ KV + ++ W++LDGPVDA+WIENLNSVLDDNKTLTLANGDRI MA N+K++FE  N+DNASPATVSR GMV+ SSS+L W+  + +WLL        S      + +++ +A+ ++   L  KM  LE  YIRQ +D++ GL+  + ++  K   LE++ +FS+MWSLGA+LEL +R KL+EF+  H   L  P    ++TIFEY V+D G W+HW+ RV E+ YP D IPE+ SILVPNVDN RT FL++ I+KQ K VLLIGEQGTAKTV++K Y G Y+PE  IFKS NFSSATTPNM+QR +ESYV+KR GTT+GPP  R MTIFIDDINMPVINEWGDQITNEIVRQM+E  G YSLE+PGDF+TI+DIQ+++AMIHPGGGRNDIP RLKR   IFNCTLPSN S+D+IF+ +G GYF  +R    +V   +  LV  TR  WQ  K KMLPTPA FHYVFNLRDLSRIW+G+L V  +   S  +++ LW HEC RVI+DRFT + DK WF   + ++  E    E +     EP Y+VDFL+DAPE   EE+EE   E PKIYE I S++ +  +++ +M+Q+NE +RG  +DLVFF DA+ HL+ +SR+I   +G+ALLVGVGGSGKQSLTRL+SFI+GY+ FQ+TLT         SYN  NL EDLK LYRT+G  G G+TF+FT NEIK+ESFLEF+NN+LSSGEIANLFA+DE+DE+  EL+ VMKK  PRRP + +NL ++++SR    LH+ LCFSPVGEKFR RSL+FPGLISGC IDWFQ+WP+DA IAVS ++L+ ++IV + +VK  V++ M    + V E C++Y+ RFRR+T VTPKS +SF+  YK +Y  K++ I  ++ RM++GL KL EA  SV  L K+L    K + +A ++A +VLA VE   +AA+ VK +V   K +AE LV NIS  K +AE KLE A PAL+EAE AL+TIK   IATV+KLG+PP+LI  IMDCV ILF++++  +  D E+   + +WDE++K+MS ++FL  ++ +P D IN E+VD+M PYF    +   +AK   G+VAGL SWT AM+ +F +NKEVLPLKANLAVQ++K + A  +L  A+E+L  K+ EL  VQ     A+ +K A+ D+A+ C+ KM  A ALIGGLAGE+ RWTE   +F  +  +LVGDV+++TAFLSY GPFNQ+FR+ LQ  W  +++   IP + ++  I  LTD + I EWNIQGLP DELS+QNG+I T+A R+PLLIDPQ QGK WI+NKEK +++ VT LNHKYFRNHLED++S+G P++IEDV EE+DP LDN+L++N +K G+ +K+K+GDKEVD    F+ Y+TTKLPNP+YTPE+FA+TSIIDFTVT++GLEDQLLG VIL E++ELE ER +L+E V  N +K KELE NLL +L++T+GSL++D ++IEVL  +K TA +V++K+ I + TE KIN+AREEYR VATRGS+LYFL+  M+ VN MYQTSL QFL  FD SM  S K+ IT KRI  II YLT+E++RY +RG YE DKF F +L+ + I  +   I  +EFQ+FIKGGAAL+LN   P P +W  D TWLNLV+L+ L  F  I  +V+ N++ W TW+  DAPE   IPDGY++L+ F+K+LL+RSWC DRT+   +KYI  ++G RFAE V+ N EE+  E  E  PMICFLS+GSDP+ NIE LAKK  LKC  ISMGQGQE+HARKL+   +++G W+LLQNCHLGL +M E    I   E       ++ +FR W+TTE HPKFPI +LQ+ +K+T +PP GIRAGL+RTY  L+QD LD + +  + P+++ ++FLHT VQERRKFGP+GWNIPYEFN SD+ ++  FVQNHLDD++  +G+SW TV YM+GEVQYGGRVTDDYDKRLLNT+ + WF   +F   F F+KGY + S K  + Y A ID +  +D P+ +G H+NA+I Y+T+    +L  I++IQPK+S  G GE+RE  V R   +ML + P  ++ F+VK+ L  MG+   +NIFL+QE+DRMQ++I +VRS   DL LA++GTIIMSENL+DALDNIF+AR+P+ + + SW S++LGFWFT+LL+R+ QF++W +  RPV FWM+GFFNPQGFLTAMRQE+ R H+GWALD V + NDV K   E+    P EGV+V+GL++DGAGW+ R+++L E   KVL+T +PV+H+YA      +   A  N + Y CPVYKK  RTDLNYI  L L++N+ PDHW LRGVALLCD+K
Sbjct:  155 NNEKSIDNRSVSDEVAIFMISAEERNSCLNVVKTFMDHVLKPSIEAVTEFGL-----AEKEQTQKFFHILNMYNTFLKSSEATVSSRVNF--DISHELFKGLLLVRWQIEASSKILTRVRLVERYFEQWLRQIQGILVEGKQIQRDTPDVGPLQMLVNWRRMLARYTTITEFVTSRAFNNHKDCLTLSRSSKLLNRWAEIDNQVTLALNEAKDNVRYISSLQKFWDPLYRSSPNVIISSLPGLMVAIRNVSKTAHYFNTPVNVTGLMVKISNQLTITSKNYITDN----------------EHSKVM-ENYKNIYIHTVDEMK-NSNERPWTVSSVYILTCLQKFLQRLEKVKWIANTDITYSILDRIMISGMERFNAMIKGARMTISSQLYDPLNYRIETFDLDFEKFVNEVEEAEVGMQQFVKLLSTECPSAASVMLVLKRFEALSLECLCLD--RRYLEVAEMLEREMFLLKDVYNEERGNPFIPRNLPPVAGRIIWIRSIFKKIDLPMQALK-LRQCVLAHKKAQRTVRYYNYMNGIICHYEMAYHKAWFDYVEEVRCLLNAPIMTIN----KEEAIYIVNIDRAILQLISETEWMWKLNLEVPNMAATITYCKDRLLGPATTLKLMLQRYDRLRTSLTPVFINIMRFRLQEISILLKPSLSTVTWISENLEDYVEKVCMKIKEVETFFNLILDIEDLRILQEMYSISDYLYIYVPE-EPVSSYEFVEESNKLRSEIERILEKKSVCMERAVVDIINMFIDLLDFEQTDSKGRRVFQLPPEKLNDTNWRTEGFLPIDKWDFIQFH-KIYRTIYLAPEDVLRTLQFRNYENIRYELYHLRNDCM--DLFSYYNSKIILALVAGSKRSLDFVRQNILRTN--WRTNPM----KPIL-HTDLEIDFYNGCYIQPNLEIMQNDFNNAVLCCTEINYFVSTWG------KQAKTQERRDRRVTVDENKYE-----RSYFRYVMEHKDVIRAVQNLANGLLSYKSDMEEFQRDMFEKYKYLWAEDREDIINSFVLTNPLTVDIRDMFLHYDNISLKIETMSAKRIIGPIEVRMGSTIEKLVSESKKWKVLLGHLLSVQYKKQLDEMIEFITEQNNILDKPINDLDDVRQAMVVLEKVRDNYIEMDVSLQLITDTYSLFSQFYIYVPQEDYDKVEGLQVLFNKMLENAKKVSDRISEMEEPLLRELNDGIATFVQEFYDFNLDFDLNGPMVEGISAKEASDRVFLFQNRFDELWRKFEMYSSGEKLFGLPITDYPLLHQRKREFNYLNRLYSLYIQVLKTITDYYEMPWADVNIEKISAELSDFQLRCRKLPKGMQSWPAFIDLKTKIDDFNETCPLLELMTNKAMKERHWIRLNALFNTDFDPTNPKFTLGKLLEAPILKYKEDVEDICVGASKELDIEAKLKQIVSDWSLVSLQLGQFKNRGDLVLKGGETLEIISSLEDSLMIMNSLASNRYNAPFKKDIQLWLSKLVNTGDILEKWLMVQNLWIYLEAVFVGGDISKQLPMEAKRFTNIDKSYVKIMMRAREIPNAVDCCTGDESLATNLTWLLDQLETCQKSLTGYLESKRLVFPRFFFVSDPVLLEILGQASDPTSIQPHLLSIFDAIATVDFQEKSIDIIESMNSMNREKVKFENTVQCLGSVELWLGRLLKEMQDTIRTILAQMSVSLNDPEFNFAEEFPSFCGQAGVVGVQLLWTKDSEYALRKCRTDKTIMKRTNNKFLVLLNFFIDLTVKDLTSLDRIRFETMVTIHVHQRDIFDDLCTLRIKSAGDFEWQKQARFYYNEDNDDVIVGITDVNFVYQNEYLGVTERLAITPLTDRCYITLAQAVGMCMGGAPAGPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKEKRSTFIFLDGDIVSLNPEFGIFITMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKMASCGFKENVVLSRKMYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGSQKRSNPNDTEETIVMRVLRDMNVSKLIDEDEGLFVSLVDDMFPGIKLTTNVYKDLQKAIIKVCDELGYVNNPEWNLKVVQLYETSLVRHGLMLMGPTGSGKTSCTVCMLRCFTEMGRTHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRSLKVPQHQNCWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIKMADNSKLVFEPDNVDNASPATVSRVGMVFTSSSVLSWKIYMEAWLL---KQGEDSEVFRRCYDVLYDDAHVFLQSRLLAKMRILEAIYIRQMLDIMDGLLLDLPLRTEKA--LERIFLFSLMWSLGAVLELSEREKLEEFLLKHVSKLRWPKRGVNETIFEYYVDDNGNWQHWSTRVEEFRYPEDEIPEFSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPEVHIFKSFNFSSATTPNMYQRIIESYVEKRQGTTYGPPNQRAMTIFIDDINMPVINEWGDQITNEIVRQMIEQRGFYSLERPGDFSTIMDIQMLSAMIHPGGGRNDIPNRLKRHLCIFNCTLPSNNSMDQIFKSIGAGYFSPDR-LGDEVVEVIPLLVPLTRIFWQNVKAKMLPTPANFHYVFNLRDLSRIWEGILKVKHEECKSVDQILKLWCHECTRVISDRFTAEKDKIWFSSKM-ISDAELNIKEFMEFYPEEPTYWVDFLRDAPEGQEEEDEEMSFEPPKIYEEIPSFDFVRSKVLVFMSQFNEYIRGYNMDLVFFMDALKHLMIVSRIISNPRGNALLVGVGGSGKQSLTRLSSFIAGYKFFQMTLTR--------SYNTGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILSSGEIANLFAKDELDEMYSELIPVMKKHQPRRPATQDNLYDFFISRARYNLHIALCFSPVGEKFRMRSLKFPGLISGCVIDWFQKWPEDARIAVSRHYLTDYQIVCSEKVKDQVIDIMSWIHESVQETCLSYYDRFRRVTFVTPKSLISFLESYKLLYKDKQDHIVIMSERMSSGLDKLDEAGASVAILKKDLIEMNKVIALASEEAEDVLATVEQSKAAAEIVKVEVAEKKGQAEVLVKNISAVKHVAEAKLEKALPALEEAEAALKTIKAADIATVRKLGKPPYLITLIMDCVCILFRRKVKPIRPDTEKAFIQSSWDESLKVMSDTSFLRKIVEYPTDLINAEMVDMMVPYFQYPQYTFEAAKVACGNVAGLLSWTMAMSKYFEVNKEVLPLKANLAVQEAKYQKASSDLQEAEELLQQKENELAEVQQTLEDAVSKKDAVLDEAKKCQDKMDAATALIGGLAGEKIRWTEQIASFKSETDRLVGDVILLTAFLSYTGPFNQEFRSDLQSIWTKQIIEKMIPISANVNIIESLTDRSQIGEWNIQGLPTDELSIQNGIISTKAMRFPLLIDPQSQGKVWIKNKEKQNKVIVTTLNHKYFRNHLEDSVSMGIPIIIEDVAEELDPCLDNLLDRNLLKVGTQYKIKIGDKEVDWNPAFRCYITTKLPNPAYTPEIFARTSIIDFTVTMRGLEDQLLGRVILAERKELEDERVQLVETVTGNMKKMKELEANLLQKLSTTKGSLLDDVTVIEVLNTSKNTAIEVKEKIEIAKVTEAKINAAREEYRVVATRGSVLYFLVCSMARVNNMYQTSLVQFLERFDASMYNSSKTHITQKRIKRIINYLTFEIYRYKSRGLYEKDKFLFVLLMALSIDRQLELITFDEFQVFIKGGAALNLNDCPPVPFRWTTDETWLNLVQLTNLTPFVNILSKVSGNERAWFTWYKKDAPENEIIPDGYNSLDPFRKMLLVRSWCMDRTISQCRKYIANSLGDRFAEPVVLNFEELLLESRELMPMICFLSLGSDPSSNIELLAKKNELKCHPISMGQGQEIHARKLILSCLEDGGWVLLQNCHLGLEYMVELTVQILELERQGKDAAVNPNFRIWITTEPHPKFPITLLQMCLKYTNEPPAGIRAGLKRTYTNLSQDFLDYSQSPFYLPLVYSISFLHTVVQERRKFGPLGWNIPYEFNSSDWYASCLFVQNHLDDIEQGKGISWVTVRYMLGEVQYGGRVTDDYDKRLLNTFTRVWFHDTLFEDCFQFFKGYKVYSFKEQEAYLAAIDDMANVDPPQVYGFHSNAEITYQTNTMRNILDEIMSIQPKESSAGTGESREDRVARQVKEMLSKTPLAFDLFDVKQHLIAMGATSSMNIFLRQEIDRMQRIIILVRSIFKDLLLAVEGTIIMSENLRDALDNIFNARVPTVFKRGSWVSSSLGFWFTELLERHTQFYNWCFGARPVVFWMSGFFNPQGFLTAMRQEVARAHQGWALDQVTMHNDVLKVGPEECKKPPKEGVFVYGLFVDGAGWDKRTSRLVEATNKVLFTLMPVIHIYA------IFSTAAKNSKLYTCPVYKKINRTDLNYICALWLQSNKHPDHWTLRGVALLCDVK 4593          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 5620.82 bits (14580), Expect = 0.000e+0
Identity = 2762/4467 (61.83%), Postives = 3481/4467 (77.93%), Query Frame = 1
Query:  589 CFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGH-NSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPKK-PRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPM-NEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNH--KGWALDAVVLSNDVTKFMKEDVNNSPSE---GVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            C  F+R TDKA+T+ NI+ ++ F MLD S   +L  LE  ++++M   L++ E+WG++  KDG  N  +  F   +D+F   L +  +NM+ + +L +      ++ I+ P     A N+SE +E LE +L  W KQIEQVL+ESE+IRRE+DD+GPSAEL++WK RM  F +L++++K   V  +I ILH AKS+++ KW+ELD+ IT  ANEAKDNVKYL TLDKFF  L K  P  M++HIP L+N+I MIH +SQ+YN+SE MTSLFVKVTNQM+TT K ++ +GV+K+W+L R+EL KR+  C  LN+EY+ CF + K+K+Q++  E+Q E SENYIFGKF+ FCKRL+KI ++   LE +S+LQ  K EG++ I +RY++I   IK KTY++LDHRK EFDNDY +F  Q + L   + A +DTW ++ +  ++ L LL +FE     ++D   K+  VLQ +   L+ VRK YQK K +P  +  L P+AGKI WS+HLFKKIE PM + K+ + +IL+MP+  K++++YN++A VLLE+E+I+   W + +E    GL +SLL R+P  ++    F VN D ++LE++QEA  +  L   +P+    +   E  +K+    ++ +L E+  ++  +P V+   M+P I  ++   +PGL  L+WTS+ I  ++  V ++LQ    ++K V+DILD RI   L+ M  T L  LPE+EP+T E FL+ T  T+    E L   S+ VE ++ +I + L   L  SE  NL       CL PD K+  RCL+C PC +Y M+    QRNTE L+  T+ +L+ + RRL ++S+ +          +  LF+  + L IPNI+ +P+ + IQ ILNK V  +L M+++I  W + HL   Q+Q  +  A E+ D+  +  P  ++SL++ +++HKDV K++SQL  ++++ K+    +L + S +S LW ++P  +VK F+QT PIL++ + Q+  +S  E +IH  P T  VG ++F +E LK  LI ECH+WK  +   LN + +  M  I    D ++++L RP+ DLDDVR  M AL ELRE EI+IE  + P+EE++ +L++++++FNDGN+ER+D ++Y + +L+  A+  Q  L +++P  K ELI GV+ F+++V SF GDYD+ GP   G+ PREASDRL +YQ KFDELWRKY T+S GEELFGL V +YPD+ RI++ELNLL KLY LYN+V+D+V+ YYDI W+++NI+ IN +LLDFQN+ RKLP ALKEWQA++DL+KTIDDFNETCPLL  M++ AMM RHWERI  +T HKFEV++ NF LRN+MEAPLL  KE+IED+CISAVKE+DIEAKLK V  +WS   F+F++F++RGELLLKG  T E V+LMEDSLM LG+L+SNRYNAPFKP IQ+WVQKL+ ++E+IE WL VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSWQ+IMQRAHEIP VVQCC+GD+TL QLLPHLLEQLE+CQKSL+GYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQAHLL++FDN   V F EK YD+IL+  SQE E V + EPINAQGNVE WLG LL   +K+LHS+IR A++ I D  FKL EF++ FP+QVGLLGIQ IWTRD+EEAL QSK DKKIMQ TNQ+FLD+LNELI +TT +LTK+ERTK+ETLITIHVHQ+DIFDDLV + I +P DFEW KQSRFYF +DTD+CI+ ITDV+F Y NE+LGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK +K+QFIFTDGDVVDMD EFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDRAII+RVKLAS GF +N VLS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP + E  +VMRVLRDMNLSKLVDEDE LF+SLI DLFP + +    YPD+ AAI KQ E+A LI H PW LKL+QL+ETQRVRHGMMTLGPSG GKT CI+ LM+AMTDCG PHKEMRMNPKAITA QMFG LDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+LDWQPIL++WL  +    A  + +L  F  I+ +   +V   +SPKM  LEC YI+Q IDLL GL+  ++ K +  +H+ +L +F++MWS GAL+ELEDR K++ F+  H   L +P  + + TIFE++V+  GEW+ W  RVPEY+YP D +P+Y SILVPNVDN RTDFL+ TI KQ KAVLLIGEQGTAKTV++KGY  KY+PE  + KSLNFSSAT P MFQ+T+ESY+DKRMGTT+GPPGG+KMT+F+DDINMPVINEWGDQITNEIVRQ+M   G YSLE+PG+FTT+VD+Q++AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF  L  GYFC ERGF  +V      LV  TRK+WQ  K KMLP+PAKFHY+FNLRDLSRIWQG+L V S+V  +   L SL++HEC RVI DRF ++ D++ F+  L+    ++ G  ++     + YFVDFL+DAPE TGEE E+ E E PK+YEPI +++ LS+RL  +  QYNE VRG  +DLVFF+DAM HL+KISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY++FQITLT         +YNVSNL+EDLK LYR +G  GKG+TF+FTDN+IKDE+FLE++NN+L+SGE++NLFARDE+DEI Q L+  MKK+ PR PP+ +NL  Y++SRV   LHV LCFSPVGEK R+R+L+FPGLISGCT+DWFQRWP+DAL+AV+ +FLS + +  + EVK++VV TMG FQD+VAE C  YFQRFRR T+VTPKSYL+FI GY+ +Y +K E +G LA RMNTGL++L+EA  SVNEL  EL  KEK LEVA++KAGEVL +V  KA AA+KVK QVQ VKD+A+A+V+ I  DK +AE KLEAAKPAL+ +E AL+TIKP  IATV+KLG+PPHLIMRIMDCVL+LF++R+D VT DPERPC KP+W EA+KLM+ S FL+ LLNF KDTI +EVV+L+ PY  MED+NL +AK   G+VAGLCSWT+AM  FF INKEVLPLKANL +Q+++L  A  EL+ AQE LDAKQKELD  QA Y+ AM EKQ L DDAEAC++KM+NA ALI GL GE+ RWTE+S  F++QIK +VGDVL+ T FLSY GPFNQ++R +L + WK E+ +  IP+++++  I+ML DNATI EWN+QGLPND+LS+QNG+IVT+A RYPLLIDPQGQGK WI+N+E++++LQVT+LNHKYFR HLED LS G+PLL+EDVGEE+DP LDN+LEKNFIK+G T KVKVGDKEVDVM+ F LY+TTKL NP+Y+PE+ AKT ++DFTVT+KGLEDQLLG VIL EK+E+EAER KL+EEV  NKRK +ELE NLLYRLTS +GSLVEDESLIEVL+VTK TA++V QKL +  +TEI IN AREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLG+FD SM  S KS +T+KR+ NI+E+LT+EVFRYTARG YE  KF FT+LL +KI +++  I H E Q FIKGGA+LDLN+VE KPK+WI D TWLNLV+LS L  F  +  QV +ND+ WK+WFD   PEE+ +PDGY++ L+ F+KLLLIRSWCPDRT+  A+KYI E+MG+++AEGVI ++E M  E ++  P++CFLSMGSDPT+NI+RLAK K + C  ISMGQGQEVHAR+LL+ SM +G W+LLQNCHLGL+F+DE LE +TTTENIH++FR WVTT+ HPKFPIN LQ  IKFT +PP G++AGL+RTY  +TQ+QL+ITN  QW+P+ + VAFLHTTVQERRKFGP+GWNIPYEFNQ+DFTS+VQFVQNHLDD+D+KRGV+W  + YM+GEVQYGGRVTDD DKRLLNT+A+ WFS  MF  KF FYKGY IP  + L +Y A ID LPL+D+PE FGLH NADI Y+T+ AN  L+TI+NIQPKDS  G GETRES V ++A++ML++LP DY P EVK  LQKMG+ +P+ IFL+QE+DRMQ+VI  VRSTL DLKLAIDGTIIMSE+L+DALD+++DAR+P  W K+SWE+A+LGFWFT+LL+RN+QF+SW + GRP+ FW+TGFFNPQGFLTAMRQE TR +  KGWALD V+L NDVT+ MKEDV + P     GVY++GLYLDGAGW+ R+ KL E  PKVL+  LPVVHVYAVS      +  K     Y CPVYKKPRRTDL YIF L L++++ PDHW LRGVALLCD K
Sbjct:    1 CLFFLRITDKAITTTNISQEVNFGMLDCSESSILHNLEFLLTQVMNQALKSQEDWGAI--KDGQMNPDVQNFLRSVDKFTFTLSSVMRNMEEKFKLHHIPSAPDLSHIQKPEDYSYAANNSELVEDLEAVLVYWAKQIEQVLTESERIRRESDDIGPSAELAHWKRRMITFCSLMDEIKDPYVKKIIGILHAAKSKTMSKWKELDASITIVANEAKDNVKYLSTLDKFFELLEKSTPTSMLKHIPKLMNSIHMIHRVSQFYNTSEHMTSLFVKVTNQMVTTSKAYLCQGVTKVWELDRKELLKRMKECIELNQEYQQCFRQMKEKIQQNPHERQLELSENYIFGKFDTFCKRLEKITDMATTLEDFSVLQFMKFEGVEKIYMRYQNIVSTIKSKTYNVLDHRKLEFDNDYIEFRNQIQVLYQSVDALIDTWLQRPLTTEQVLELLSRFENGVGRQMDLNQKYMVVLQRYECDLEFVRKCYQKEKDNP--VSQLTPLAGKIEWSKHLFKKIELPMQILKD-KLDILQMPDRRKIIRSYNRLAAVLLEYEMIHQKAWVEGVELGLSGLNASLLTRHPTTKE----FYVNLDPLVLEVLQEANNMYKLGALVPDGIHDMAAKEPQLKEYRYKLQMMLKEFHAVVKKIPGVLKSPMKPFIRSVETALSPGLTILSWTSLNIDYFIGCVYKALQELEQVLKVVTDILDCRINHTLESMCSTTLLTLPENEPVTPEMFLTHTAATISTERETLKVASQQVERSMLEIAEELNRMLKPSERVNLKK---CSCLHPDAKQMTRCLQCLPCAFYIMMGQLCQRNTEALVTATKSSLNALHRRLLAASSSYRSSSPSGATIQVPLFRVSVELAIPNIVFRPSFEHIQGILNKGVNMVLSMAKDIPLWNYFHLQQDQLQAEQVAAREHGDETVVSKPILLRSLDRHVTEHKDVNKSLSQLVPLVSSLKADAGDILEDLSQFSALWNQDPAEQVKAFLQTNPILADFSTQLSLYSAYETQIHELPQTCTVGPILFETESLKMSLIQECHTWKREFGAALNQQASAGMTEISSFVDGVNRQLQRPISDLDDVRESMGALRELREEEIRIETIMGPVEESFALLNRHDLFFNDGNAERIDGVVYAWKELKVMAKETQKKLSDVEPHMKAELIAGVEVFQKSVESFYGDYDNSGPGVTGLPPREASDRLQVYQAKFDELWRKYVTFSSGEELFGLPVGEYPDLHRIKRELNLLSKLYSLYNSVIDSVSGYYDILWADLNIEKINNELLDFQNRIRKLPAALKEWQAFNDLKKTIDDFNETCPLLYMMANKAMMARHWERITDLTKHKFEVEAPNFSLRNVMEAPLLKCKEDIEDVCISAVKERDIEAKLKDVVTEWSGHQFTFATFRNRGELLLKGSDTSEKVALMEDSLMVLGSLMSNRYNAPFKPTIQQWVQKLSNSSEVIEKWLTVQNLWLYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQRIMQRAHEIPGVVQCCVGDETLQQLLPHLLEQLEVCQKSLSGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNLFDNVNRVVFHEKNYDQILSFQSQEGETVNMSEPINAQGNVEAWLGMLLDGVKKTLHSIIRQAAMVIGDQGFKLVEFQSMFPAQVGLLGIQFIWTRDAEEALQQSKADKKIMQTTNQKFLDLLNELIDMTTHDLTKMERTKYETLITIHVHQKDIFDDLVQMNIRSPLDFEWQKQSRFYFIDDTDRCIIQITDVEFDYCNEYLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQA--DVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKNLNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLKKHNARLDLPSTQGEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQGPWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTR--------TYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVS---STTESKKPAMNLYSCPVYKKPRRTDLTYIFSLFLRSSQNPDHWTLRGVALLCDCK 4442          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 5425.14 bits (14072), Expect = 0.000e+0
Identity = 2748/4593 (59.83%), Postives = 3479/4593 (75.75%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLE-EWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGY----ECLQPD--PKKPRCLECQPCVYYA--------MLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLA--------EENNDDNKLPG-------------PGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTIL-NTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK-EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA----LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLK--VTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH ++   ++    L+ ++VEDA+L   +    E+FF+ +    L+ YYQD    +    + T         K+F+  G+   L G+C  F R+ T K +TS NI  D+ F MLD +G  LL ++E+ +S+I  P L+ +   WG +++      K  +F   LD F++ L  AQ+++  ++ L+  +  DL   ++ PS      NS++ +EK+E  +  WIKQIEQVL+ES+Q+R+EADD+GP AEL +WK RMSRFN LL+Q+K+ +V  V+ +L  AKS+ ++ WRELD RITDAANEAKDNVKYLYTL+KF  PL   NPV M+E IP LINAIRMIHSIS+YYN+SE++TSLFVKV                             R+S+                      S + + E    YIFGKF+ F +RL KI NL + + +Y+ LQ  KIEG++++  R+++I   +KKK Y  LD R+++FD DY++F  Q   L  Q++ F+D  F+K    ++ L +LKKFE++    L   DK+ ++LQNF + ++ + ++Y K K+DPP+  +LPP AGKI W+R L+ +I+ PM LF++  P +L  P+A  +++NYN++AKVLLEFE++Y+++W    E  K GL +SLL+++P+      +  VNFD  IL  I+E   +  + LDIP  A+ L   + + K  Y  ++  L  +  +  S  P    ++ PH+ ++DE   PGL +L WTS+ I  Y+ ++  +L +  LL+ +V+D+++ RI+AVL +M+   LC LPEDEP T EEF+  T++   + ++ L  +S LVE A N++I++L         KN++  +G       + P   P  P   + +              +L++F  RN + L++ TR TL+T+++R+ +SS    I       +P +F+A + L IPNI+  P LDE+Q  LN+AV  ++ +S+ + QW+   +  +++ E    A        E  + D+                 P  +K+ +K IS++K++ K VS LS  +N+ K ++   L  FS Y  +WK++ +  +++F+Q  P LSE  +QI Y+ D+E EI++ P    VGA+  Y+  LK  L +E  SW   + Q  N K   EM+ I    D  SK+L+R +KDLDD+R  MA L E+RE +I I+  + PIEE+Y MLHKY +      +E+VD+L Y + KL +++  VQ+ L+ +QPKF+GELI+ V+ F E+   F  DYD   P  Q     +      IY      +   Y T++GGEELFGL VT +P +  IRK+L LLQKLY LYN+V+DTVN YYDI+W++I+ID IN +LLDFQ +CRKLP+ LKEWQA+ DL+KTID+F+E CPLL+ M++ AMM RHW+RI  VTGH FEV++DNF LRN+MEAPLL  KEEIEDICISAVKE+DIE KLK V  +W  ++F+F+ FK+RGELLL+GD+T EI++ MEDSLM LG+L+SNRYN PFK +IQ+WVQ L+ TT+IIENW+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+PNVVQ C+GD+T+ QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL++FDN K V F EK+YDKILAI+S+E E ++LD+P+ A+GNVE+WL  LLK S++SLH VIR A++ I DS F+L EF  SFP+QVGLLGIQMIWT+DSE+AL+ ++ D+KIM  TNQ FL++LN LI +TT++L  +ERTK+ETLITIHVHQRDIFDDL  L I +P DFEWLKQ RFYF ED+D+ +++ITDV F+YQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQI++VLTCKKER+  FIFTDGD V+M+PEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGF+ N  L++KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP+D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP +++    YPD+ +AIDKQ+ +A LINH PWRLK+IQL+ETQRVRHGMM LGPSGAGKT CI+ LM+AMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW++LDGPVDAIWIENLNSVLDDN+TLTLANGDRIPMAPN KI+FE HNI+NASPATVSRNGMV+MSSS+L+W PIL  WL   +   A    +L + F   F E YR+  Q+L  KM  LE   I Q I++L GL+   +   E+   H+E+L VF++MWS+GALLEL+DR+KL+ ++ +  +    LP      +DT+F++ V + G W HW  RV EY+YP D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KGY  KY+PE    KSLNFSSATTP MFQR++ESYVDKRMGTT+GPP G+KM+IFIDDINMPVINEWGDQ+TNEIVRQ+ME  G ++LEKPG+FT IVDIQ +AAMIHPGGGRND+PQRLKRQFSIFNCTLPSNASIDKIF ++G G++C+ RGF  +V++TV  LV  TR+LWQ TK+KMLPTPA FHY+FNLRDLSRIWQGML V ++VI++   L+ LWKHEC RVI DRFT   D  WF+ TL   V  +       V  L  + YFVDFL+DAPEATG+E EET+ + PK+YEPIES++ L +RL  +++ +NE++RG  +D+VFF+DAM HL+KISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY+TFQITLT         SYN +NLMEDLK LYRT+GQ GKGI+F+FTDNEIKDESFLE++NN+LSSGE++NLFARDE+DEI+ +L+ VMK+E+PRRPP+NENL EY+MSRV + LHVVLCFSPVGE+FRNR+L+FP LISGCT+DWF RWPKDALIAVS +FLST++I  T EVK  VV  MG FQD VAE C +YFQR+RR THVTPKSYLSFI  YK +Y +K  E+ TLA RMNTGL+KL EA+ESV  LSKEL VKEKEL++A  KA  VL +V VKA AA+KVK +VQ VKD+A+A+V++IS DKAIAEEKLEAA+PAL+EAE AL+TIKP  IATV+ LGRPPHLIMRIMDCVL+LF++R+++V  DPE+ C  P+W E++KLM+  NFL SL  FPKDTIN+EVV+ + PYF+M D+N+ +AK V G+VAGLCSWTKAMA+FFSINKEVLPLKANLAVQ+++L  A  +L  AQ  LDAKQ ELD+VQAEY KAM EKQ L +DAE CR KM  A +LI GLAGE+ERWT+ SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FRN+L   W+ E+    IPF  ++    ML D  T+SEWN+QGLPND+LS+QNG+IVT+A R+PLLIDPQ QGK WI+NKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLEKNFIK+G T+KVK+GDKEVDVMKGF+LYVTTKLPNP+YTPE+ A+TSIIDFTVT++GLEDQLLG VILTEKQELE ERT L+E+V  NKRK KELEDNLL+RLTST+GSLV+DESLI VL  TK TAE+V QKL I  +TEI+IN+AREEYRPVATRGSILYFLI EMSMVN MYQTSL+QFLGLFD S+  S KSPITSKRI NIIEY+T+EV +Y ARG YE  KF FT+LLT+KI M+S ++KHEEF   IKGGA+LDL A  PK  KWI D+TWLNLVELSKL  F  I +Q+ +++K W++WFD +APEE  IP+ YD  L+ F++LLLIRSWCPDRT+  A+KYI ++MG R+AEGVI +LE+  EE +  TP+ICFLSMGSDPTD+I  L K++ ++   +SMGQGQEVHARKLL  SM  G W LLQNCHLGL+FMDE ++ IT T+++H++FR W+TTE H  FPI +LQ+ IKFT +PP G++AGL+RTY  ++QD LD++N  QW+PML+ VAFLH+TVQERRK+GP+GWNIPYEFNQ+DF +T+QFVQNHLDD+D+K+GVSW TV YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MF+P F FYKGY IP   ++D+Y  +I  LP  D+PE FGLH NADI Y++  A  +L TI++IQPKDS  G GETRE++V RLADDML++LP D+ PFEV+E+L  MG L+P+NIFL+QE+DRMQ+VI +VR+TL DLKLAIDGTIIMSENL+DALD ++DARIP+ W K SW S TLGFWFT+LL+RN QFHSW++EGRP CFWMTGFFNPQGFLTAMRQEITR +KGWALD +VL N+VT++MK+D+   P+EGVYV+GLYL+GAGW+ R+ KL +  PKVL+  +PV+ +YA   NN V D      R Y  P+YKKP RTDLNYI  ++L+T+  P++WILRGVALLCD+K
Sbjct:   25 LDSRHDYVLSIVSSCVGLEKSEVEDAILEGTQIERMEQFFAVDGLPHLILYYQDTEATEAGYNNQTQCPHRIKKAKVFVTEGTDVALTGICVFFTRANTSKPITSENIHRDVNFNMLDTTGVGLLKSVEQLLSEIFIPTLRKMNYGWGELASPQAQAVK-QDFISSLDSFVSVLSGAQESLQEKVNLQECETFDL-KTLKGPSDYTAVANSADALEKIEACMKTWIKQIEQVLAESDQLRKEADDLGPRAELDHWKKRMSRFNYLLDQLKSPEVKAVLGVLLVAKSKLIKVWRELDIRITDAANEAKDNVKYLYTLEKFCDPLYNSNPVSMVEAIPGLINAIRMIHSISRYYNTSEKITSLFVKV-----------------------------RVSY---------------------KSNDHRLEM---YIFGKFDTFQRRLSKILNLFSTITTYNALQDSKIEGLETMATRFQAIVLTMKKKQYSFLDQRRTDFDQDYEEFCKQTSELHNQLKTFMDNTFDKIQNTERALYVLKKFERLGIPDLGISDKYQRILQNFGRDIEMISRIYNKQKTDPPIAPDLPPTAGKILWARQLYSRIQEPMDLFQQL-PGLLSTPDAKPIIRNYNRVAKVLLEFEVLYHHSWMAQTEAVKAGLQASLLVKSPET----GQLFVNFDPQILTQIRETDCMLGMGLDIPPFAAILQQKKEVFKKNYNKLQ--LKRFDRV--SWKPAFEQLLMPHVAKVDEAILPGLTSLNWTSLNIDKYLCRITAALDNLELLLHRVNDLVEFRIDAVLQEMSTATLCVLPEDEPCTCEEFVQTTKELCIKGAQMLHTKSSLVEEAANELINMLLELEANICFKNISKFNGRLFSRSTMAPSLGPSSPLLRKKKKLDLMKVMEEEAKELLSHFNHRNVDALLRLTRNTLETLRKRIHASS---LIRQKGSGPQP-IFRAGVCLAIPNIIMVPGLDEVQHALNRAVDYVVSVSKGVGQWSKERISKRKMSERRMAALKQNSQESESEDADSTYHSSTSDISASANQAIPFQIKNYHKSISENKEIVKLVSVLSTSINSTKKEIMNALERFSIYHHIWKKDREETIQKFIQGNPFLSEFESQILYYRDLELEINAEPEFISVGALALYTVDLKLALTAETKSWMVDFGQYCNRKYRMEMEQIFTFIDEASKKLNRQIKDLDDIRIAMATLKEIREHQISIDFQVGPIEESYSMLHKYGLLIAKEEAEKVDTLRYTWEKLLSRSTEVQNELVSLQPKFRGELIKNVETFVEDCQHFYHDYDRVSPEGQLHFQAQTQLFSCIY------IPLGYITFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNSVIDTVNGYYDISWADIHIDRINNELLDFQARCRKLPRGLKEWQAFMDLKKTIDEFSECCPLLDLMTNKAMMTRHWKRITEVTGHTFEVETDNFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIITNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLEQLEMCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNIFDNIKCVRFHEKMYDKILAISSREGETIELDKPVIAEGNVEVWLNALLKESQRSLHLVIRQAALAIQDSGFELIEFLDSFPAQVGLLGIQMIWTKDSEDALSNARYDRKIMSKTNQFFLELLNNLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIKSPTDFEWLKQCRFYFNEDSDKMMINITDVGFVYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRKNFIFTDGDNVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPNDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPDLESAIDKQVTEAGLINHPPWRLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIENASPATVSRNGMVFMSSSVLNWSPILEGWL---KNRSAQEGMVLKDLFSSSFPELYRFSIQSLQYKMEMLEAFIIMQCINMLQGLIQPKEQGGELSREHMERLYVFALMWSVGALLELDDRMKLERWLRNHDSIHLDLPNIPPHSEDTMFDFYVTNDGHWVHWNTRVEEYIYPPDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYMSKYDPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQNGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDVPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSHRGFSEEVRNTVGRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLGVTAEVISTPQLLLQLWKHECKRVIADRFTAPEDVAWFDSTLAKLVEEQLGEEEREVVDLGVDSYFVDFLRDAPEATGDEPEETDFDMPKVYEPIESFDSLMERLNMFLSHFNESIRGASMDMVFFRDAMIHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTR--------SYNTANLMEDLKGLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEIISDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSPVGERFRNRALKFPALISGCTMDWFSRWPKDALIAVSEHFLSTYDIDCTLEVKSEVVQCMGSFQDGVAEKCADYFQRYRRSTHVTPKSYLSFIHDYKTIYKEKHSEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANAKADMVLKEVTVKAQAAEKVKVEVQKVKDKAQAIVDSISADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNTVKTDPEKNCTMPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVEFLSPYFDMVDYNIETAKRVCGNVAGLCSWTKAMAAFFSINKEVLPLKANLAVQENRLTIANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDAERCRHKMQTASSLISGLAGEKERWTQLSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLTDWQREMKFRQIPFRTNLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIKNKESKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGFTYKVKIGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKERTDLLEDVTANKRKMKELEDNLLFRLTSTQGSLVDDESLITVLGNTKRTAEEVTQKLQIAAETEIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLTKSSKSPITSKRIANIIEYMTFEVHKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPPKAAKWILDITWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDREAPEEEPIPNAYDQALDCFRRLLLIRSWCPDRTIAQARKYITQSMGERYAEGVILDLEKTWEESEPRTPLICFLSMGSDPTDSIIALGKRQRIETRYVSMGQGQEVHARKLLQHSMANGGWALLQNCHLGLDFMDELMDTITETDSVHDTFRLWMTTEVHKHFPITLLQMSIKFTNEPPQGLKAGLKRTYGGISQDLLDVSNMVQWRPMLYGVAFLHSTVQERRKYGPLGWNIPYEFNQADFNATIQFVQNHLDDIDIKKGVSWNTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFSPDFHFYKGYSIPKCSNVDQYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSTGGGETREAIVGRLADDMLEKLPPDFVPFEVRERLMSMGPLQPMNIFLRQEIDRMQRVIVLVRNTLNDLKLAIDGTIIMSENLRDALDCMYDARIPARWKKASWASTTLGFWFTELLERNRQFHSWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPAEGVYVYGLYLEGAGWDRRNCKLIDSKPKVLFEMMPVIRMYA--ENNGVKDA-----RLYSSPIYKKPVRTDLNYIAAVDLRTSHPPEYWILRGVALLCDVK 4525          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 3758.38 bits (9745), Expect = 0.000e+0
Identity = 1825/2680 (68.10%), Postives = 2203/2680 (82.20%), Query Frame = 1
Query: 5941 CYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFIT-HKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNH--KGWALDAVVLSNDVTKFMKEDVNNSPSE---GVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            CYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK +K+QFIFTDGDVVDMD EFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDRAII+RVKLAS GF +N VLS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP + E  +VMRVLRDMNLSKLVDEDE LF+SLI DLFP + +    YPD+ AAI KQ E+A LI H PW LKL+QL+ETQRVRHGMMTLGPSG GKT CI+ LM+AMTDCG PHKEMRMNPKAITA QMFG LDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+LDWQPIL++WL  +    A  + +L  F  I+ +   +V   +SPKM  LEC YI+Q IDLL GL+  ++ K +  +H+ +L +F++MWS GAL+ELEDR K++ F+  H   L +P  + + TIFE++V+  GEW+ W  RVPEY+YP D +P+Y SILVPNVDN RTDFL+ TI KQ KAVLLIGEQGTAKTV++KGY  KY+PE  + KSLNFSSAT P MFQ+T+ESY+DKRMGTT+GPPGG+KMT+F+DDINMPVINEWGDQITNEIVRQ+M   G YSLE+PG+FTT+VD+Q++AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF  L  GYFC ERGF  +V      LV  TRK+WQ  K KMLP+PAKFHY+FNLRDLSRIWQG+L V S+V  +   L SL++HEC RVI DRF ++ D++ F+  L+    ++ G  ++     + YFVDFL+DAPE TGEE E+ E E PK+YEPI +++ LS+RL  +  QYNE VRG  +DLVFF+DAM HL+KISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY++FQITLT         +YNVSNL+EDLK LYR +G  GKG+TF+FTDN+IKDE+FLE++NN+L+SGE++NLFARDE+DEI Q L+  MKK+ PR PP+ +NL  Y++SRV   LHV LCFSPVGEK R+R+L+FPGLISGCT+DWFQRWP+DAL+AV+ +FLS + +  + EVK++VV TMG FQD+VAE C  YFQRFRR T+VTPKSYL+FI GY+ +Y +K E +G LA RMNTGL++L+EA  SVNEL  EL  KEK LEVA++KAGEVL +V  KA AA+KVK QVQ VKD+A+A+V+ I  DK +AE KLEAAKPAL+ +E AL+TIKP  IATV+KLG+PPHLIMRIMDCVL+LF++R+D VT DPERPC KP+W EA+KLM+ S FL+ LLNF KDTI +EVV+L+ PY  MED+NL +AK   G+VAGLCSWT+AM  FF INKEVLPLKANL +Q+++L  A  EL+ AQE LDAKQKELD  QA Y+ AM EKQ L DDAEAC++KM+NA ALI GL GE+ RWTE+S  F++QIK +VGDVL+ T FLSY GPFNQ++R +L + WK E+ +  IP+++++  I+ML DNATI EWN+QGLPND+LS+QNG+IVT+A RYPLLIDPQGQGK WI+N+E++++LQVT+LNHKYFR HLED LS G+PLL+EDVGEE+DP LDN+LEKNFIK+G T KVKVGDKEVDVM+ F LY+TTKL NP+Y+PE+ AKT ++DFTVT+KGLEDQLLG VIL EK+E+EAER KL+EEV  NKRK +ELE NLLYRLTS +GSLVEDESLIEVL+VTK TA++V QKL +  +TEI IN AREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLG+FD SM  S KS +T+KR+ NI+E+LT+EVFRYTARG YE  KF FT+LL +KI +++  I H E Q FIKGGA+LDLN+VE KPK+WI D TWLNLV+LS L  F  +  QV +ND+ WK+WFD   PEE+ +PDGY++ L+ F+KLLLIRSWCPDRT+  A+KYI E+MG+++AEGVI ++E M  E ++  P++CFLSMGSDPT+NI+RLAK K + C  ISMGQGQEVHAR+LL+ SM +G W+LLQNCHLGL+F+DE LE +TTTENIH++FR WVTT+ HPKFPIN LQ  IKFT +PP G++AGL+RTY  +TQ+QL+ITN  QW+P+ + VAFLHTTVQERRKFGP+GWNIPYEFNQ+DFTS+VQFVQNHLDD+D+KRGV+W  + YM+GEVQYGGRVTDD DKRLLNT+A+ WFS  MF  KF FYKGY IP  + L +Y A ID LPL+D+PE FGLH NADI Y+T+ AN  L+TI+NIQPKDS  G GETRES V ++A++ML++LP DY P EVK  LQKMG+ +P+ IFL+QE+DRMQ+VI  VRSTL DLKLAIDGTIIMSE+L+DALD+++DAR+P  W K+SWE+A+LGFWFT+LL+RN+QF+SW + GRP+ FW+TGFFNPQGFLTAMRQE TR +  KGWALD V+L NDVT+ MKEDV + P     GVY++GLYLDGAGW+ R+ KL E  PKVL+  LPVVHVYAVS      +  K     Y CPVYKKPRRTDL YIF L L++++ PDHW LRGVALLCD K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQA--DVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKNLNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLKKHNARLDLPSTQGEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQGPWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTR--------TYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVS---STTESKKPAMNLYSCPVYKKPRRTDLTYIFSLFLRSSQNPDHWTLRGVALLCDCK 2685          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2006.49 bits (5197), Expect = 0.000e+0
Identity = 1216/3589 (33.88%), Postives = 1940/3589 (54.05%), Query Frame = 1
Query: 3367 KSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKE--WQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDE---KVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSK--TDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC---GEPH----KEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPK-------MVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLI----VFSMMWSLGALLELEDRLKLQEFITH-KKALPVPICKDDDTIFEYVVNDKGE-WEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTER--GFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTL--KVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAE-------ALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKP-KKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNL--KCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEII--TTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQ-LDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKF---SFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSG---GGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGR-PVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTD----LNYIFPLNLKTNEAP-DHWILRGVALLCDI 13956
            K ++ +I   +++ K    ++  M T  S +QT L  +  +  +W+ E  + ++ + +  P ++  +A I  ++++   +        V  V+    PLK  L+  C+ W++ + Q L+   + ++  +       + RLS+P + L D+   +  L  L+    KIE  I PI E Y +L KYE+  +    E +++L   +   +         L + +   K  LI   + F++   +F+  + S GP    + P  A  +++  + + + L  +      G  +F +E     DI  + K+++ LQ+++++     D    +     + +  + ++           KL +A K+  W+  D  +  I+ F +  PL+  + ++A+  RHW +I       F+  S +F L  ++   L  + E I DI  +A KE  IE  L+ +   W   S   +  K +G   L+G  T E+   +ED+ + L  + ++R+   F+ ++  W + L+   E+IE  L VQ  W+YLE +F+  DI KQL +E   F  +  SW+ IM+R  +  N ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K++  ++       +   + S + E V    P+  +G VE WL D+ +  R +L   +R+ S+ +     K  ++   +P Q+ +   Q+ WT D   AL  SK   DK  +++  ++ + +LN+       NLTKI R K   L+T+ VH RD+   L          F+WL Q R Y+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +D++ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+      N F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF    VL+KK +TLY L  +QLSKQ HYDFGLR + S+LR  G  +R  PD  +  I++  ++DMN++KL   D  LF  +I+DLFP ++  T  Y  +  A++ ++ Q+ L        K+IQL+ET+  RH  M +G +G+GKT     L   ++     GEP     +E  +NPKA++  +++G  +++TN+WTDG+ S+L R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W+P ++SW   +E    V         L++    RY+ +TL+ K       +   E N +     L   L    + +K   + +  +++    +FS++WS+ A ++ E R K+  F+   + + P     + DTI+EY V+ K + W  +  ++P+      + P Y  I+VP VD  R  +L+  +      VLL G  GT KT + +      +       ++N SS T+ N  Q  +ES V+KR+   + P GG+KM +F+DD+NMP ++ +G Q   E++R  ++    Y  +K      I D+ ++ +M  PGGGR  I  RL+ +F++ N T P+ + I +I+     G   +++   F+ +V+     L  AT +L+     + LPTPAK HY+FNLRD+S+++QG+L  + D  ++   +  LW HEC RV +DR  + AD + F   L  K+    +     +   +  P F DFL+++                +IYE +  ++ L   +   +  YN T     + LV F+DA+ H+ ++ RVI   +G+ LLVG+GGSG+QSLTRLA++I  +  FQ+ +T          Y      ED+K LYR +G   K   FLF D +I DESFLE +NN+LSSGE+ NL+  DE+DEI   L    +K+     P  + +  Y + RV   LH+VLC SPVG+ FRNR  ++P L++  TIDWF  WP+DAL+ V+   L    + S   ++  V +        VA+         +R  +VTP +YL  +SGYK++  +KR+E+G   +++  GL K+ +    V  +S EL   +K++   +K+  E L  +  +   A + ++ V    ++ E       A+  N  RD       L+ A PAL+EA +ALE++  + +  +K  GRPP L+  +M  V+IL             R C +PTW EA + +   NF+  L+NF KD I+D V+  +  Y    DF       VS     LC W +AM  +  I + V P +A L    ++L      L  AQ  L    ++LD ++ +Y++ + +K+ L   +E    K+  A  L+ GLAGER RW E     +K +  LVGD L+  AFLSY GPF  + R+ ++   W  ++    +P +   +    L+    + EWNIQGLP+D  S +NG+IVTR  R+PL++DPQGQ   WI+N E    L+V  L    F   LE+A+  G P+L+++V EE+DP+L  +L K+  + G  F +K+GDKE++    F+ Y+TTKL NP YTPE+ +KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK +ELED +L  L    GSL++D  L+  L+ +K TA +V ++L I   TE +I++ARE YRP A R SIL+F++ ++  ++ MYQ SL  ++ LF  S+  S +S    +RINN+  + TY V+RYT RG +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F ++     +  + W  W+ +  PE+A +P  ++N     +K+L++RS   DR       ++   +G +F E  I +++ +  +    TP+I  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +L+   +  G W+ L NCHL L++M E  +++     +  H  FR W+++  HP+FPI ILQ GIK T +PP G++  ++R Y  +++ Q L  +    ++ +LF + F H+ + ERRKF  +GWNI Y FN SDF  +   +  +LD+ +    + W  + ++I  + YGG VTDD+D+RLL TY   +F P + +  F   S    Y +P   S   Y  +I +LP ++ PE FG + NADI  + + A  +  T++++QP+ +      AG +RE  V  L+ D+LQ++P + + +E   KL K   L PLN+ L QE+ R   ++  +R +L++L+  I G ++MS +L++  + I DAR+P  W K       L  W  DL  R EQF  W    R PV FW++GF  P GFLTA+ Q   R +   ++D +     VT     ++   P +GV + GL+L+GAGW+ +++ L E  P  L  P+P +H        PV  + +  +  Y CP Y  P R+      +++  ++LK+   P DHWI RG ALL  +
Sbjct: 1000 KPIHSIIEQDEEICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPAVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRG--TDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTH-HPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSF-EGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSW---MEKRQKVET------DLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREIEGSFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFY-KIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQ-TLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIY-----GTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES----------------QIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQ--------YRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETP--DAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRD-------LDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL-------------RGC-EPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYE---EIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEID-YEGTRKLLK-DDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNV-SVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHF------KPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSL 4504          

HSP 2 Score: 140.969 bits (354), Expect = 3.949e-32
Identity = 151/702 (21.51%), Postives = 303/702 (43.16%), Query Frame = 1
Query:  598 FIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLV-AVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFC-----FHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTY----------------DILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQI---DCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETR--PEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTI-ENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIP 2619
            FIR+ D  +T  +  + + F    +  G  ++ L R ++ +  P +     W   S K+ ++++       L RFL  L       DS+ +L       L   +E   +R   AV +   +++LE ++  W +QI+ VLS ++ +    D +GP  E+S+WKSR +  +++  Q++   V  +  IL    S  +  + +L  +I +++ +A+ NV +L  L +    L++  P ++   +  ++N IR+I   S Y+N+ +R+T+L  K++N++I  C         +   L R      +S  + LN+  + C      +    +L    + + +   +  IF   ++F +R   +  +    + ++  +  +   +     R  S  ++ +K  Y                DILD R   +  DY  F  + + LE  +Q  + + FE    +++ + LL  F+ +   + +K     K   V   F   L  +  +  +  S  P+   +P  AG+I W++ L  ++E  M + +     P +    E   +   Y K+ + L E     + +W +++ +     L   L+IR   K K G    +NF+  +L+L  E  Y   L  +IP   + +      + +    +  ++ +Y+ II  +      +    I  +D+   PGL  L W++   P
Sbjct:  138 FIRAPDSMITEESFRSSVQF---GSVRGGAIEGLLRMMNGVHTPQVTLSTTWPETS-KNNYSAE-------LHRFLTKLT------DSRFKLLGSTV--LYIPLEALQHRPEEAVKNKNLVQRLEMVVIHWTRQIKAVLS-AQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKISNEIIRLC--------CREISLNRIFQGYAVSSKQILNDCIQCCLAWKELYLHTSQLHHKHSSQGWSLDQISIFALVDSFMQRCKDLIEICECQQQFARWEDGERVPLPCFAGRLGS--EVTQKLLYIEATFDKSLQVLQSVQDILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSELVEINLVMCRTSSLIPV--QMPRYAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVI---YVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRC--KGKTGL-LDINFNKNLLKLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWSTKGTP 801          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2005.33 bits (5194), Expect = 0.000e+0
Identity = 1217/3589 (33.91%), Postives = 1940/3589 (54.05%), Query Frame = 1
Query: 3367 KSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKE--WQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDE---KVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSK--TDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC---GEPH----KEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPK-------MVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLI----VFSMMWSLGALLELEDRLKLQEFITH-KKALPVPICKDDDTIFEYVVNDKGE-WEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTER--GFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTL--KVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAE-------ALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKP-KKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNL--KCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEII--TTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQ-LDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKF---SFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSG---GGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGR-PVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTD----LNYIFPLNLKTNEAP-DHWILRGVALLCDI 13956
            K ++ +I   +++ K    ++  M T  S +QT L  +  +  +W+ E  + ++ + +  P ++  +A I  ++++   +        V  V+    PLK  L+  C+ W++ + Q L+   + ++  +       + RLS+P + L D+   +  L  L+    KIE  I PI E Y +L KYE+   D   E +++L   +   +         L + +   K  LI   + F++   +F+  + S GP    + P  A  +++  + + + L  +      G  +F +E     DI  + K+++ LQ+++++     D    +     + +  + ++           KL +A K+  W+  D  +  I+ F +  PL+  + ++A+  RHW +I       F+  S +F L  ++   L  + E I DI  +A KE  IE  L+ +   W   S   +  K +G   L+G  T E+   +ED+ + L  + ++R+   F+ ++  W + L+   E+IE  L VQ  W+YLE +F+  DI KQL +E   F  +  SW+ IM+R  +  N ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K++  ++       +   + S + E V    P+  +G VE WL D+ +  R +L   +R+ S+ +     K  ++   +P Q+ +   Q+ WT D   AL  SK   DK  +++  ++ + +LN+       NLTKI R K   L+T+ VH RD+   L          F+WL Q R Y+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +D++ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+      N F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF    VL+KK +TLY L  +QLSKQ HYDFGLR + S+LR  G  +R  PD  +  I++  ++DMN++KL   D  LF  +I+DLFP ++  T  Y  +  A++ ++ Q+ L        K+IQL+ET+  RH  M +G +G+GKT     L   ++     GEP     +E  +NPKA++  +++G  +++TN+WTDG+ S+L R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W+P ++SW   +E    V         L++    RY+ +TL+ K       +   E N +     L   L    + +K   + +  +++    +FS++WS+ A ++ E R K+  F+   + + P     + DTI+EY V+ K + W  +  ++P+      + P Y  I+VP VD  R  +L+  +      VLL G  GT KT + +      +       ++N SS T+ N  Q  +ES V+KR+   + P GG+KM +F+DD+NMP ++ +G Q   E++R  ++    Y  +K      I D+ ++ +M  PGGGR  I  RL+ +F++ N T P+ + I +I+     G   +++   F+ +V+     L  AT +L+     + LPTPAK HY+FNLRD+S+++QG+L  + D  ++   +  LW HEC RV +DR  + AD + F   L  K+    +     +   +  P F DFL+++                +IYE +  ++ L   +   +  YN T     + LV F+DA+ H+ ++ RVI   +G+ LLVG+GGSG+QSLTRLA++I  +  FQ+ +T          Y      ED+K LYR +G   K   FLF D +I DESFLE +NN+LSSGE+ NL+  DE+DEI   L    +K+     P  + +  Y + RV   LH+VLC SPVG+ FRNR  ++P L++  TIDWF  WP+DAL+ V+   L    + S   ++  V +        VA+         +R  +VTP +YL  +SGYK++  +KR+E+G   +++  GL K+ +    V  +S EL   +K++   +K+  E L  +  +   A + ++ V    ++ E       A+  N  RD       L+ A PAL+EA +ALE++  + +  +K  GRPP L+  +M  V+IL             R C +PTW EA + +   NF+  L+NF KD I+D V+  +  Y    DF       VS     LC W +AM  +  I + V P +A L    ++L      L  AQ  L    ++LD ++ +Y++ + +K+ L   +E    K+  A  L+ GLAGER RW E     +K +  LVGD L+  AFLSY GPF  + R+ ++   W  ++    +P +   +    L+    + EWNIQGLP+D  S +NG+IVTR  R+PL++DPQGQ   WI+N E    L+V  L    F   LE+A+  G P+L+++V EE+DP+L  +L K+  + G  F +K+GDKE++    F+ Y+TTKL NP YTPE+ +KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK +ELED +L  L    GSL++D  L+  L+ +K TA +V ++L I   TE +I++ARE YRP A R SIL+F++ ++  ++ MYQ SL  ++ LF  S+  S +S    +RINN+  + TY V+RYT RG +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F ++     +  + W  W+ +  PE+A +P  ++N     +K+L++RS   DR       ++   +G +F E  I +++ +  +    TP+I  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +L+   +  G W+ L NCHL L++M E  +++     +  H  FR W+++  HP+FPI ILQ GIK T +PP G++  ++R Y  +++ Q L  +    ++ +LF + F H+ + ERRKF  +GWNI Y FN SDF  +   +  +LD+ +    + W  + ++I  + YGG VTDD+D+RLL TY   +F P + +  F   S    Y +P   S   Y  +I +LP ++ PE FG + NADI  + + A  +  T++++QP+ +      AG +RE  V  L+ D+LQ++P + + +E   KL K   L PLN+ L QE+ R   ++  +R +L++L+  I G ++MS +L++  + I DAR+P  W K       L  W  DL  R EQF  W    R PV FW++GF  P GFLTA+ Q   R +   ++D +     VT     ++   P +GV + GL+L+GAGW+ +++ L E  P  L  P+P +H        PV  + +  +  Y CP Y  P R+      +++  ++LK+   P DHWI RG ALL  +
Sbjct:  881 KPIHSIIEQDEEICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAV-DPVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRG--TDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTH-HPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSF-EGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSW---MEKRQKVET------DLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREIEGSFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFY-KIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQ-TLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIY-----GTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES----------------QIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQ--------YRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETP--DAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRD-------LDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL-------------RGC-EPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYE---EIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEID-YEGTRKLLK-DDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNV-SVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHF------KPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSL 4384          

HSP 2 Score: 107.071 bits (266), Expect = 7.075e-22
Identity = 147/704 (20.88%), Postives = 282/704 (40.06%), Query Frame = 1
Query:  598 FIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLV-AVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQI---DCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETR--PEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTI-ENFKLGLASSLLIRNPDK----EKDGAKFLVNFDTMILE-------------------LIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIP 2619
            FIR+ D  +T  +  + + F    +  G  ++ L R ++ +  P +     W   S K+ ++++       L RFL  L       DS+ +L       L   +E   +R   AV +   +++LE ++  W +QI+ VLS ++ +    D +GP  E+S+WKSR +  +++  Q++   V  +  IL    S  +  + +L  +I +++ +A+ NV +L  L +    L++  P ++   +  ++N IR+I   S Y+N+ +R+T+L  K     I  C+              R E  +R+            CF     +L  + T+K       YI   F+   K L  + ++Q+IL                                    D R   +  DY  F  + + LE  +Q  + + FE    +++ + LL  F+ +   + +K     K   V   F   L  +  +  +  S  P+   +P  AG+I W++ L  ++E  M + +     P +    E   +   Y K+ + L E     + +W +++ +     L   L+IR   K    + +  K+    +T IL+                   L  E  Y   L  +IP   + +      + +    +  ++ +Y+ II  +      +    I  +D+   PGL  L W++   P
Sbjct:   77 FIRAPDSMITEESFRSSVQF---GSVRGGAIEGLLRMMNGVHTPQVTLSTTWPETS-KNNYSAE-------LHRFLTKLT------DSRFKLLGSTV--LYIPLEALQHRPEEAVKNKNLVQRLEMVVIHWTRQIKAVLS-AQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRK-----ICECQQ----------QFARWEDGERVPLP---------CF---AGRLGSEVTQKLL-----YIEATFD---KSLQVLQSVQDIL------------------------------------DVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSELVEINLVMCRTSSLIPV--QMPRYAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVI---YVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGLLDINFNKYSCIHNTCILQNRLGFFNVTNQHTESECTTLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWSTKGTP 684          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: ENSXETT00000021690.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 5562.65 bits (14429), Expect = 0.000e+0
Identity = 2808/4621 (60.77%), Postives = 3544/4621 (76.69%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSA-------HKKLFIATGSSEPLKGLCFLFIRSTD-KALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL------------KMNLTESELKNLNAEDGYECLQPDPKKP-----------------------RCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS-----NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNK------LPGPGSVKSLN-----------KLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICK----DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKT-LKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH ++   +A   +L+ ++VEDA+L   +    + FF+    + +MFYYQDV   +     S   G V++         K+F+  G    L G+C  FIRS+  K +T  N+  ++ F MLD SG  LL ++E  +S I  P L+ ++  WG +       +   +F   L+ F+  L  AQ+++  ++ L+  +  DL   ++ P   L   NSSE +E++E  +  WIKQIEQVL+ES Q+R+EADD+GP AEL +WK R+S+F+ LL+Q+KT +V  V+ +L  AKS+ L+ WR LD+RITD+ANEAKDNVKYLYTL+KF  PL   +PV MI+ IP L+NAI MIH+IS+YYN+SE++TSLFVKVTNQMIT CK ++     +KIWD  ++ + +++    +LNE Y+  FHKTK+  ++  TE+QF+FSE YIFGKF+ F +RL+KI ++   + +YS LQ  KIEG++ +  +++S    IKKK YD LD R++EFD+DY++F+ Q   L  Q++ F+D+ FE++   ++ + +L+KFE++    L  ++K+ K+LQN+   ++ V K+Y K K++PPL R+LPP+AGKI W+R L  +I+ PM LF++     L+  EA ++++NYNK+AKVLLE+E++++ +W K +E  K GL +SLL+++P+      +  VNFD +IL LI+E + +  L L+IP  A+ L   +N+ K  +  ++ +L+E   I   V   +  ++ PHI +IDE   PGL++L WTS+ I  Y++ + E      LL+ +V+D++  RI+AVL DM++T LC LPE+EP++ E+FL MT+    + +  L  +S +VE A N++I++L            K  +    +++ N   G   L  +                             LE + C    +L++F  RN + L+K TR TL+TI++R+Q SS     +  +I     + +P +FKA++ L IPNI+  P LDE+Q  LNKAV+ I+ +S+ + QW+   +  K I E +  A   N ++       +     V S++           K +S++K++ K  S LS  +N+ K +V T L  F  Y  +W+++    +++F+   P+LSE  +QI +F D+E  I++ P    VG +  ++  LK  L SE  +W     +  N K   EM++I    + ++K+L+R +KDLDD+R  MAAL E+RE +I ++  + PIEE+Y ML+KYE+      +E+VD+L Y + KL  +   VQ+ L+ IQP F+GELI  V+ F ++   F  DY+  GPM  G+ P+EASDRL ++Q +FD L RKY TY+GGEELFGL+VT YP +  I+K+LNLLQKLY LYNNV++ VN YYDI WS++NI+ IN +LL+FQN+CRKLP+ALKEWQA+ DL+KTIDDF+E CPLLE MS+ AMM RHW+RI  VTGH F+V+++ F LRN+MEAPLL  KEEIEDICISAVKEKDIE KLK V  +W  ++F+F++FK+RGELLL+GD+T EI++ MEDSLM LG+L+SNRYN PFK +IQ+WV  L+ TT+IIE+W+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+PNVVQCC+GD+T+ QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN K+V F EKVYD+IL+I+S+E E ++L++ + A+GNVE+WL  LLK S+ SLH VIR A+I I DS F+L EF +SFP+QVGLLGIQMIWTRD+E+ALT +K DKKIMQ TNQ FLD+LN LI +TT++L+ IER K+ETLITIHVHQRDIFDDL  + I TP DFEWLKQ RFYF ED+D+  ++ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQI++VLTCKKERK  FIFTDGD V+M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGF+ N VL++KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP +++    YP++ AAI KQ+E A LI H PW+LK+IQLFETQRVRHGMMTLGPSGAGKT CI+ LM+AMTDCGEPH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + K+GEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+L W PIL  WL      DA  N +   +   F+E YR+  Q+L  KM  +E   I Q+I++L GL+   D   EI   HLE+L VFS+MWS+GA+LEL+DR+K+++++    ++ + + K     DDT+F+Y V  +G+W HW   V EY+YP+D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KG+  KYNPE+ + K LNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KM++FIDDINMPVINEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT I+D+Q +AAMIHPGGGRNDIPQRLKRQFS+FNCTLPSN SIDKIF ++G G+FC++RGF  D++  V  L+  TRKLWQ TK KMLPTPAKFHY+FNLRDLSRIWQGML   S+VI   + L+ LWKHEC RVI DRFT   D DWF+KT LK+  ++    +       + YFVDFL+DAPEATGEE E+ + + PKIYEPIES+ QL DRL  ++  +NE++RG  +D+VFFKDAM HLVKISR+IRT +G+ALLVGVGGSGKQSLT+LAS+I+GY+TFQITL+         SYN SNLMEDLK+LYRT+GQ GKGI+F+FTDNEIKDESFLE++NN+LSSGE++NLFARDE+DEI  +L+  MKKEYPRRPP+NENL EY+MSRV + LHVVLCFSPVGEKFRNR+L+FP LISGCT+DWF RWPKDAL+AVS +FLS+++I  TPE+KK VV  MG FQD VAE C+ YFQR+RR THVTPKSYLSFI GYK +Y +K  E+ TLA RMNTGL+KL EA+ESV  LSKEL VKEKEL++A +KA  VL +V VKA AA+KVK +VQ VKD+A+A+V+NIS DKA+AEEKLEAAKPAL+EAE AL+TIKP  IATV+ LGRPPHLIMRIMDCVL+LF+++++ V  D E+ C  P+W E++KLM G NFL +L  FPKDTIN+EVV+L++PYF M+D+N+ +AK V G+VAGLCSWTKAMASF+SINKEVLPLKANLA+Q+S+L  A  +L  AQ  LDAKQ ELD+VQAEY KAM EKQ L +DA+ CR KM  A +LI GLAGE+ERWTE SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FRN +   W+ E+    IPF  ++    ML D  TISEWN+QGLPND+LS+QNG+IVT+A RYPLLIDPQ QGK WI+NKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLEKNFIK+GST+KVKVGDKEVDVM GF+LY+TTKLPNP+YTPE+ A+TSIIDFTVT+KGLEDQLLG VILTEKQELE ERT L+E+V  NKRK KELEDNLL+RLTST+GSLVEDESLI VL  TK+TAE+V QKL I  +TEI+INSAREEYRPVATRGSILYFLI EMSMVN MYQTSL+QFLGLFD S+A S KSPITSKRI NIIE++TYEV++Y ARG YE  KF FT+LLT+KI M+S ++KHEEF   IKGGA+LDL A   KP KWI D+TWLNLVELSKL  F  I EQ+A+N+K WK WFD + PEE  +P GYD  L+ F++LLLIRSWCPDRT+  A+KYI ++MG ++ EGV+ +LE+  EE +  TP+ICFLSMGSDPTD+I  L KK+ ++   +SMGQGQE+HARKLL  +M  G W LLQNCHLGL+F+DE ++ I  T+NIHESFR W+TTE H +FPI +LQ+ IKFT +PP G++AGL+RTY  ++QD LD+ N  QWKPML+ V FLH+TVQERRKFGP+GWNIPYEFNQ+DF +TVQF+QNHLDDMD+K+GVSW TV YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MF  +F FYKGY IP   ++D Y  +I  LP  D+PE FGLH NADI Y++  A  +L TI++IQPKDS GG GETRE+VV RLADDML +LP DY PFEVKE+LQKMG  +P+NIFL+QE+DRMQ++IS+VR+TL DLKLAIDGTIIMSENL+DALD ++DARIP  W K SWES+TLGFWFT+LL+RN+QF SW++E RP CFWMTGFFNPQGFLTAMRQEITR +KGWALD+V++ N+VTK+MK+D+    SEGVYV+GLYLDGAGW+ R+ KL E  PKVL+  +PV+ +YA        + +  + RFY CP+YKKP RTDLNYI  ++LKT ++PDHWILRGVALLCD+K
Sbjct:   27 LDGRHDYVLGIVAACLNLEKSEVEDAILEGNQIERIDRFFAVGGLRHIMFYYQDVEAAEAGHLGS--FGAVTSTLVARNKKPKVFLTEGKDVALTGVCIFFIRSSSTKPVTMENVHREVHFNMLDTSGNSLLGSVESLLSDIYIPALKTMDNGWGELVDPQQAGNVKQDFLGSLEGFVGVLSGAQQSLMDKVNLKKCETYDLRT-LKGPCDYLTVANSSEGLERIEEGMKVWIKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHTQLKTFMDSTFERNYNTERSIIMLEKFERLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQQ-HSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQMEVAKSGLHASLLVKSPET----LELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDNLQFMLMEDKRIKSKVHAPLEQLIAPHIAKIDEAIQPGLLSLNWTSLNIEKYLKNIAEKHADLELLLDRVNDLVVFRIDAVLQDMSITPLCKLPEEEPVSCEQFLQMTKDLCAKGAVTLQAKSCMVEEAANELINMLLDLDIHSGDEDAKSFVGHRIMEDSNDISGKLKLSGNSGATATLFVATIGPPSPPTKKKKKDMMEILEEEAC---ELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMISFLDGNAISKQKINGQP-IFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKKNILERKITAMRGNSNDSDSEDVIVENISEVASISTVAFVHNKNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDA--NILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQGGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGEEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSR--------SYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGGVSQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-------DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4617          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 5039.55 bits (13071), Expect = 0.000e+0
Identity = 2496/3647 (68.44%), Postives = 3001/3647 (82.29%), Query Frame = 1
Query: 3049 TRLTLDTIKRRLQSSSNKFSIDPMNEDKRPA-LFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYF--SDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFIT-HKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNH--KGWALDAVVLSNDVTKFMKEDVNNSPSE---GVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            T+++LD IKRRL + S+ +    + +D  P  LFKA++ L IPN++ KP+L++IQV     +  I            ++LHH Q    + L +E      L     +K L+K IS+HKDV K + QLS I+ + K++   +L+ F+ +S +W +     V+ F+ +    S        F    +E +I   P    VG+V F ++ LK  L+ EC  WK  +   LN K A +MD I    D+LSKRLSRPV DLDDVR  M AL E+R++EI+I+M I PIEE+  +L KYE+ F DGN+ERVD L Y +  L TQA   Q+ L+++QP+ K +L++GV+ F  +   F  +Y+  GP  +GI PREASDRL ++Q KFDELWRKY T+SGGEELFGL VT+YP++QRIR+EL LLQKLY LYN V++ +N YY+I W++++I+ IN +L+DFQN+ RKLPKALKEWQA++DL+K IDDF+E+CPLLE M++ AMM RHWERI  +TGHKF+V+S++F L+N+MEA LL  KE+IEDICISAVKEKDIEAKLK+V ++WSA  F+F+ FKSRGELLLKG  T E ++LMEDSLM LG+++SNRYNAPFKP IQ+WVQKL+ TTEIIENWL VQNLWIYLEAVFVGGDIAKQLPQEAKRF NIDKSWQKIMQRAHE PN+VQCC+GD+TL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLLS+FDN   V F EK YD+IL   SQE E V L EP+NAQGNVE+WLG LL   +K+LH++IR ASI I+DS FKL++F+T +P+Q+GLLGIQMIWTRD+EEAL  +KTD+K+MQ TNQ+FLD+LN+LI +TT++LT++ERTK+ETLITIHVHQ+DIFDDLV + I +  DFEW KQSRFYF ED D+CI+ ITDV+F Y NE+LGCTDRLVITPLTDRCYITLSQALGMS+GGAPAGPAGTGKTETTKDMG+CLGK+VVVFNCSDQMDYRGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK +K+QFIFTDGDVVDMD EFGIFLTMNPGYAGRQELPENLK+ FRTVAMMVPDRAII+RVKLAS GF  N +LS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NPD+ E  +VMRVLRDMNLSKLVDEDE LF+SLI DLFP + +    YPD+ AAI KQ E+A LI+H PW LKLIQL+ETQRVRHGMMTLGPSGAGKTKCIN+LM+AMTDCG PHKEMRMNPKAITA QMFG LDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+LDW+P+L++W   L+T  A  + IL                 LSPKM  LEC YI+QAIDLL         K+    H+ +L +F++MWS+GALLEL+DR+K++ F+  H   L +P    D TIFE+V+++ G+W+HW+ +VPEY+YP D +PEY SILVPNVDN RTDFL++TI KQ KAVLLIGEQGTAKTV++KGY  KY+PE    KSLNFSSAT PNMFQR++ESY+DKRMGTT+GPP G+KMT+FIDDINMPVINEWGDQITNEIVRQ+ME  G Y+LEKPG+FT++VDIQ +AAMIHPGGGRNDIPQRLKRQF++FNCTLPSN+SIDKIFR +  GYFC +RGF   V    + LV  TRK+WQ TKIKMLPTPAKFHY+FNLRDLSRIWQG+LI+ S+V  S   L++L+KHEC RVI+DRF +Q DKDWFE T+ V   E+ G E++     E YFVDFL+DAPEATG+E E+ +LEAPK+YEPI S+EQL+DRL  YM QYNE VRG ++DLVFFKDAM HLVKISR+IRT +G+ALLVGVGGSGKQSLTRLAS+I+GY++FQITLT         +Y  +NLM+DLK+LYRT+GQ G GITF+FTDNEIKDESFLE++NN+L+SGE++NLFARDE+DEI Q+L+ VMKKE+PRR P+ ENL +Y++SRV + LHVVLCFSPVGEKFR R+L+FPGLISGCT+DWFQRWP+DAL+AV+ +FLS+++I  T EVK++VVNTMG FQD+VAE C+ YF+R+RR T+VTPKSYLSFI GYK +Y +K E +G L+ RM TGL KL+EA  SVN+LSKELAVKEK+L VA KKA EVL +V  KA AA+KVK QVQ VKD+A+A+V+ I+ DKA AEEKLE A+PALQEAE ALETIKP  IATV+KLGRPPHLIMRIMDC L+LF++++D VTADPERPC KP+W EA+KLM+ S FL SLL FPKD+I +E+V+L++PY +MED+NL SAK V G+VAGLCSWT+AMA FF INKEVLPLKANLA+Q +KL  A +ELNNAQ  LDAKQ+ELD VQA Y+ AM EKQAL DDAEACRRKM NA ALI GL GE+ RWTE+SK F  QI +LVGDVL+ T FLSY GPFNQ++RN+L + WK E+ +  IP ++D+  ISML DNATI EWN+QGLPND+LS+QNG+IVT+A R+PLLIDPQGQGK WI+N+EKN+ELQVT+LNHKYFR HLED LSLGRPLLIEDVGEE+DPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGF LY+TTKL NP+YTPE+ AKT++IDFTVT+KGLEDQLLG VILTEKQELEAER KLMEEV  NKRK +ELEDNLL+RLTST+GSLV+DESLIEVLR+TK TAE+V +KL +  +TE+KIN+AREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLG+FD SM  S KS ITSKRI NIIEYLT+EVF+YTARG YE  KF FT+L+ +KI +++ +I H EFQ  IKGGA LDLN+VEPKPKKWI D+TWLNLV+LS L  F  +  QVA+N+K WK WFD +APEEA +PDGYDN L+TF++LLLIRSWCPDRT+  A+ YI E++G+++AEG I ++E M  E D  TP++CFLSMGSDPT+NIERL+K KN  C +ISMGQGQEVHAR+LL+ SMQ+G W+LLQNCHLGL+FMDE L+ +T TE +H+ FR W+TTE HPKFPIN+LQ  +KFT +PP G++AGL+RTY+ ++Q+ LD+TN  QWKP+L+ VAFLHTTVQERRKFGP+GWNIPYEFNQ+DF +++QFVQNHLD+MD KRGV+W  + YM+GEVQYGGRVTDD DK LLNT+A+ WF   MF+ KF FYKGY IP GK++DEY  +ID+LPL+D+PE FGLH NADI Y+T+ AN+ L+TIVNIQPKDSGGGAGETRESVV RLA++ML++LPEDY P EVK +LQKMG ++P+NIFL+QE+DRMQ+VI+ VRSTL+DLKLAIDGTIIMSE+L+DALDN++DARIP  W K+SWES+TLGFWFT+LL+RN+QF SWL++GRP  FWMTGFFNPQGFLTAMRQE TR +  KGWALD+V+L NDVT+ MKEDVN  P     GVY++GL+LDGAGW+ R+ KL E  PKVL+T LPVVHVYAVS  NP AD  K     + CPVYKKPRRTDL YIF L L++ E PDHW LRG+ALLCD K
Sbjct:  423 TKVSLDAIKRRLHTISSVYQTAKLTKDHTPTPLFKAEIHLAIPNVVMKPSLEDIQVRTTFTLFLI----------AILYLHHFQ----KDLGDE------LTKMVVLKPLDKQISEHKDVTKVIIQLSTIVLSLKAEAANVLNSFTKFSGIWNQ-----VRTFLCSSRTFSLFICCYILFHLQQLETQISELPAHCIVGSVDFTTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFIDNLSKRLSRPVLDLDDVRGAMDALKEIRDAEIRIDMMIGPIEESNSLLLKYELVFQDGNAERVDGLAYAWKNLNTQAVYTQNLLIKVQPEMKTDLLDGVEKFHIDAAEFYKNYELLGPGVEGIPPREASDRLQVFQAKFDELWRKYVTFSGGEELFGLPVTEYPELQRIRRELALLQKLYGLYNAVIENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAW---LQTLPAFQHEIL---------------WNLSPKMQILECMYIKQAIDLLQKSKQN---KQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQDHSAPLELPTVSGDQTIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIAV---EDHGQEIMNNALKESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTR--------TYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNP-ADLKKQQGYLHACPVYKKPRRTDLTYIFSLFLRSIEVPDHWTLRGIALLCDSK 4011          

HSP 2 Score: 321.627 bits (823), Expect = 1.246e-86
Identity = 169/344 (49.13%), Postives = 225/344 (65.41%), Query Frame = 1
Query:  772 DG-HNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSE 1800
            DG  N +I E+ + LD+F+  L +A+ N++ +++L+  D  + +  +  PS  + A  +SE +EKLE +L  WIKQIEQVL+ESEQ+R+EADD+GPS                                              D  +T+AANEAKDNVKYLYTLDKFFGPL K +PV    HI  L+N+IRMI+S SQYYN+SE MTSLF+KVTNQ ++TCK ++  GV KIWDL R+EL +RI  C  LNE+Y+  FHK K+KL+E   E+QFEFSENYIFGK + FCKRL+KI+++ N LES + LQT KIEG++ I +RY++I    K K+YD+LDHRK E
Sbjct:    2 DGMQNLQIQEYLDSLDKFIGTLSSARHNLEGKIELKRVDSGNFLENMHNPSDFINAGGNSEIIEKLEAMLSIWIKQIEQVLAESEQMRKEADDIGPS----------------------------------------------DCNVTNAANEAKDNVKYLYTLDKFFGPLGKASPVS--SHI--LMNSIRMIYSTSQYYNTSEHMTSLFLKVTNQTVSTCKSYLSHGVIKIWDLDRQELIRRIKECVFLNEQYQNSFHKVKEKLKETPNERQFEFSENYIFGKLDTFCKRLEKISDISNNLESLADLQTIKIEGVEKISIRYETIVTNTKSKSYDVLDHRKQE 295          

HSP 3 Score: 76.6406 bits (187), Expect = 1.432e-12
Identity = 33/84 (39.29%), Postives = 58/84 (69.05%), Query Frame = 1
Query: 2170 EAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEI 2421
            E  K++++YNKMA VL+EFEL+Y+  W K  +  K GL +SLL+R+P+ +    +  VN D M++E++ E KY++ +  ++P++
Sbjct:  311 EMKKIIRHYNKMASVLMEFELLYHRGWCKCADIAKNGLHASLLVRHPNTK----ELYVNLDPMVMEVLHETKYLQKMGFEVPDV 390          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 5034.93 bits (13059), Expect = 0.000e+0
Identity = 2500/3648 (68.53%), Postives = 3003/3648 (82.32%), Query Frame = 1
Query: 3049 TRLTLDTIKRRLQSSSNKFSIDPMNEDKRPA-LFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYF--SDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTIL-NTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFIT-HKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNH--KGWALDAVVLSNDVTKFMKEDVNNSPSE---GVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            T+++LD IKRRL + S+ +    + +D  P  LFKA++ L IPN++ KP+L++IQV     +  IL      EQ     L      EL K+               +K L+K IS+HKDV K + QLS I+ + K++   +L+ F+ +S +W +     V+ F+ +    S        F    +E +I   P    VG+V F ++ LK  L+ EC  WK  +   LN K A +MD I    D+LSKRLSRPV DLDDVR  M AL E+R++EI+I+M I PIEE+  +L KYE+ F DGN+ERVD L Y +  L TQA   Q+ L+++QP+ K +L++GV+ F  +   F  +Y+  GP  +GI PREASDRL ++Q KFDELWRKY T+SGGEELFGL VT+YP++QRIR+EL LLQKLY LYN V++ +N YY+I W++++I+ IN +L+DFQN+ RKLPKALKEWQA++DL+K IDDF+E+CPLLE M++ AMM RHWERI  +TGHKF+V+S++F L+N+MEA LL  KE+IEDICISAVKEKDIEAKLK+V ++WSA  F+F+ FKSRGELLLKG  T E ++LMEDSLM LG+++SNRYNAPFKP IQ+WVQKL+ TTEIIENWL VQNLWIYLEAVFVGGDIAKQLPQEAKRF NIDKSWQKIMQRAHE PN+VQCC+GD+TL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLLS+FDN   V F EK YD+IL   SQE E V L EP+NAQGNVE+WLG LL   +K+LH++IR ASI I+DS FKL++F+T +P+Q+GLLGIQMIWTRD+EEAL  +KTD+K+MQ TNQ+FLD+LN+LI +TT++LT++ERTK+ETLITIHVHQ+DIFDDLV + I +  DFEW KQSRFYF ED D+CI+ ITDV+F Y NE+LGCTDRLVITPLTDRCYITLSQALGMS+GGAPAGPAGTGKTETTKDMG+CLGK+VVVFNCSDQMDYRGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK +K+QFIFTDGDVVDMD EFGIFLTMNPGYAGRQELPENLK+ FRTVAMMVPDRAII+RVKLAS GF  N +LS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NPD+ E  +VMRVLRDMNLSKLVDEDE LF+SLI DLFP + +    YPD+ AAI KQ E+A LI+H PW LKLIQL+ETQRVRHGMMTLGPSGAGKTKCIN+LM+AMTDCG PHKEMRMNPKAITA QMFG LDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+LDW+P+L++W   L+T  A  + IL N F +     YR V    SPKM  LEC YI+QAIDLL         K+    H+ +L +F++MWS+GALLEL+DR+K++ F+  H   L +P    D TIFE+V+++ G+W+HW+ +VPEY+YP D +PEY SILVPNVDN RTDFL++TI KQ KAVLLIGEQGTAKTV++KGY  KY+PE    KSLNFSSAT PNMFQR++ESY+DKRMGTT+GPP G+KMT+FIDDINMPVINEWGDQITNEIVRQ+ME  G Y+LEKPG+FT++VDIQ +AAMIHPGGGRNDIPQRLKRQF++FNCTLPSN+SIDKIFR +  GYFC +RGF   V    + LV  TRK+WQ TKIKMLPTPAKFHY+FNLRDLSRIWQG+LI+ S+V  S   L++L+KHEC RVI+DRF +Q DKDWFE T+ V   E+ G E++     E YFVDFL+DAPEATG+E E+ +LEAPK+YEPI S+EQL+DRL  YM QYNE VRG ++DLVFFKDAM HLVKISR+IRT +G+ALLVGVGGSGKQSLTRLAS+I+GY++FQITLT         +Y  +NLM+DLK+LYRT+GQ G GITF+FTDNEIKDESFLE++NN+L+SGE++NLFARDE+DEI Q+L+ VMKKE+PRR P+ ENL +Y++SRV + LHVVLCFSPVGEKFR R+L+FPGLISGCT+DWFQRWP+DAL+AV+ +FLS+++I  T EVK++VVNTMG FQD+VAE C+ YF+R+RR T+VTPKSYLSFI GYK +Y +K E +G L+ RM TGL KL+EA  SVN+LSKELAVKEK+L VA KKA EVL +V  KA AA+KVK QVQ VKD+A+A+V+ I+ DKA AEEKLE A+PALQEAE ALETIKP  IATV+KLGRPPHLIMRIMDC L+LF++++D VTADPERPC KP+W EA+KLM+ S FL SLL FPKD+I +E+V+L++PY +MED+NL SAK V G+VAGLCSWT+AMA FF INKEVLPLKANLA+Q +KL  A +ELNNAQ  LDAKQ+ELD VQA Y+ AM EKQAL DDAEACRRKM NA ALI GL GE+ RWTE+SK F  QI +LVGDVL+ T FLSY GPFNQ++RN+L + WK E+ +  IP ++D+  ISML DNATI EWN+QGLPND+LS+QNG+IVT+A R+PLLIDPQGQGK WI+N+EKN+ELQVT+LNHKYFR HLED LSLGRPLLIEDVGEE+DPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGF LY+TTKL NP+YTPE+ AKT++IDFTVT+KGLEDQLLG VILTEKQELEAER KLMEEV  NKRK +ELEDNLL+RLTST+GSLV+DESLIEVLR+TK TAE+V +KL +  +TE+KIN+AREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLG+FD SM  S KS ITSKRI NIIEYLT+EVF+YTARG YE  KF FT+L+ +KI +++ +I H EFQ  IKGGA LDLN+VEPKPKKWI D+TWLNLV+LS L  F  +  QVA+N+K WK WFD +APEEA +PDGYDN L+TF++LLLIRSWCPDRT+  A+ YI E++G+++AEG I ++E M  E D  TP++CFLSMGSDPT+NIERL+K KN  C +ISMGQGQEVHAR+LL+ SMQ+G W+LLQNCHLGL+FMDE L+ +T TE +H+ FR W+TTE HPKFPIN+LQ  +KFT +PP G++AGL+RTY+ ++Q+ LD+TN  QWKP+L+ VAFLHTTVQERRKFGP+GWNIPYEFNQ+DF +++QFVQNHLD+MD KRGV+W  + YM+GEVQYGGRVTDD DK LLNT+A+ WF   MF+ KF FYKGY IP GK++DEY  +ID+LPL+D+PE FGLH NADI Y+T+ AN+ L+TIVNIQPKDSGGGAGETRESVV RLA++ML++LPEDY P EVK +LQKMG ++P+NIFL+QE+DRMQ+VI+ VRSTL+DLKLAIDGTIIMSE+L+DALDN++DARIP  W K+SWES+TLGFWFT+LL+RN+QF SWL++GRP  FWMTGFFNPQGFLTAMRQE TR +  KGWALD+V+L NDVT+ MKEDVN  P     GVY++GL+LDGAGW+ R+ KL E  PKVL+T LPVVHVYAVS  NP AD  K     + CPVYKKPRRTDL YIF L L++ E PDHW LRG+ALLCD K
Sbjct:  481 TKVSLDAIKRRLHTISSVYQTAKLTKDHTPTPLFKAEIHLAIPNVVMKPSLEDIQVRTTFTLFLIL------EQNAARDLG----DELTKMV-------------VLKPLDKQISEHKDVTKVIIQLSTIVLSLKAEAANVLNSFTKFSGIWNQ-----VRTFLCSSRTFSLFICCYILFHLQQLETQISELPAHCIVGSVDFTTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFIDNLSKRLSRPVLDLDDVRGAMDALKEIRDAEIRIDMMIGPIEESNSLLLKYELVFQDGNAERVDGLAYAWKNLNTQAVYTQNLLIKVQPEMKTDLLDGVEKFHIDAAEFYKNYELLGPGVEGIPPREASDRLQVFQAKFDELWRKYVTFSGGEELFGLPVTEYPELQRIRRELALLQKLYGLYNAVIENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAW---LQTLPAFQHEILWNCFNM---ANYRAV----SPKMQILECMYIKQAIDLLQKSKQN---KQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQDHSAPLELPTVSGDQTIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIAV---EDHGQEIMNNALKESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTR--------TYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNP-ADLKKQQGYLHACPVYKKPRRTDLTYIFSLFLRSIEVPDHWTLRGIALLCDSK 4075          

HSP 2 Score: 398.667 bits (1023), Expect = 5.826e-110
Identity = 230/551 (41.74%), Postives = 321/551 (58.26%), Query Frame = 1
Query:  772 DG-HNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEI 2421
            DG  N +I E+ + LD+F+  L +A+ N++ +++L+  D  + +  +  PS  + A  +SE +EKLE +L  WIKQIEQVL+ESEQ+R+EADD+GPS                                              D  +T+AANEAKDNVKYLYTLDKFFGPL K +PV    HI  L+N+IRMI+S SQYYN+SE MTSLF+KVTNQ ++TCK ++  GV KIWDL R+EL +RI  C  LNE+Y+  FHK K+KL+E   E+QFEFSENYIFGK + FCKRL+KI+++ N LES + LQT KIEG++ I +RY++I    K K+YD+LDHRK E        +V   T                   ++ +NLLKKFE+I    LD  +K+  VLQ +S+ LD VRKLYQK K +                                 T        E  K++++YNKMA VL+EFEL+Y+  W K  +  K GL +SLL+R+P+ +    +  VN D M++E++ E KY++ +  ++P++
Sbjct:    2 DGMQNLQIQEYLDSLDKFIGTLSSARHNLEGKIELKRVDSGNFLENMHNPSDFINAGGNSEIIEKLEAMLSIWIKQIEQVLAESEQMRKEADDIGPS----------------------------------------------DCNVTNAANEAKDNVKYLYTLDKFFGPLGKASPVS--SHI--LMNSIRMIYSTSQYYNTSEHMTSLFLKVTNQTVSTCKSYLSHGVIKIWDLDRQELIRRIKECVFLNEQYQNSFHKVKEKLKETPNERQFEFSENYIFGKLDTFCKRLEKISDISNNLESLADLQTIKIEGVEKISIRYETIVTNTKSKSYDVLDHRKQEVSITMGLKIVLVST-------------------EQMINLLKKFERIGKDHLDFGEKYMIVLQRYSRDLDMVRKLYQKQKEN-------------------------------PPTPRNTPPGLEMKKIIRHYNKMASVLMEFELLYHRGWCKCADIAKNGLHASLLVRHPNTK----ELYVNLDPMVMEVLHETKYLQKMGFEVPDV 448          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 4972.53 bits (12897), Expect = 0.000e+0
Identity = 2478/3647 (67.95%), Postives = 2976/3647 (81.60%), Query Frame = 1
Query: 3049 TRLTLDTIKRRLQSSSNKFSIDPMNEDKRPA-LFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYF--SDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFIT-HKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNH--KGWALDAVVLSNDVTKFMKEDVNNSPSE---GVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            T+++LD IKRRL + S+ +    + +D  P  LFKA++ L IPN++ KP+L++IQV     +  I            ++LHH Q    + L +E      L     +K L+K IS+HKDV K + QLS I+ + K++   +L+ F+ +S +W +     V+ F+ +    S        F    +E +I   P    VG+V F ++ LK  L+ EC  WK  +   LN K A +MD I    D+LSKRLSRPV DLDDVR  M AL E+R++EI+I+M I PIEE+  +L KYE                             DH+  ++P F  ++I          I  +  Y+ +GP  +GI PREASDRL ++Q KFDELWRKY T+SGGEELFGL VT+YP++QRIR+EL LLQKLY LYN V++ +N YY+I W++++I+ IN +L+DFQN+ RKLPKALKEWQA++DL+K IDDF+E+CPLLE M++ AMM RHWERI  +TGHKF+V+S++F L+N+MEA LL  KE+IEDICISAVKEKDIEAKLK+V ++WSA  F+F+ FKSRGELLLKG  T E ++LMEDSLM LG+++SNRYNAPFKP IQ+WVQKL+ TTEIIENWL VQNLWIYLEAVFVGGDIAKQLPQEAKRF NIDKSWQKIMQRAHE PN+VQCC+GD+TL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLLS+FDN   V F EK YD+IL   SQE E V L EP+NAQGNVE+WLG LL   +K+LH++IR ASI I+DS FKL++F+T +P+Q+GLLGIQMIWTRD+EEAL  +KTD+K+MQ TNQ+FLD+LN+LI +TT++LT++ERTK+ETLITIHVHQ+DIFDDLV + I +  DFEW KQSRFYF ED D+CI+ ITDV+F Y NE+LGCTDRLVITPLTDRCYITLSQALGMS+GGAPAGPAGTGKTETTKDMG+CLGK+VVVFNCSDQMDYRGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK +K+QFIFTDGDVVDMD EFGIFLTMNPGYAGRQELPENLK+ FRTVAMMVPDRAII+RVKLAS GF  N +LS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NPD+ E  +VMRVLRDMNLSKLVDEDE LF+SLI DLFP + +    YPD+ AAI KQ E+A LI+H PW LKLIQL+ETQRVRHGMMTLGPSGAGKTKCIN+LM+AMTDCG PHKEMRMNPKAITA QMFG LDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+LDW+P+L++WL   +T  A  + IL                 LSPKM  LEC YI+QAIDLL         K+    H+ +L +F++MWS+GALLEL+DR+K++ F+  H   L +P    D TIFE+V+++ G+W+HW+ +VPEY+YP D +PEY SILVPNVDN RTDFL++TI KQ KAVLLIGEQGTAKTV++KGY  KY+PE    KSLNFSSAT PNMFQR++ESY+DKRMGTT+GPP G+KMT+FIDDINMPVINEWGDQITNEIVRQ+ME  G Y+LEKPG+FT++VDIQ +AAMIHPGGGRNDIPQRLKRQF++FNCTLPSN+SIDKIFR +  GYFC +RGF   V    + LV  TRK+WQ TKIKMLPTPAKFHY+FNLRDLSRIWQG+LI+ S+V  S   L++L+KHEC RVI+DRF +Q DKDWFE T+ V   E+ G E++     E YFVDFL+DAPEATG+E E+ +LEAPK+YEPI S+EQL+DRL  YM QYNE VRG ++DLVFFKDAM HLVKISR+IRT +G+ALLVGVGGSGKQSLTRLAS+I+GY++FQITLT         +Y  +NLM+DLK+LYRT+GQ G GITF+FTDNEIKDESFLE++NN+L+SGE++NLFARDE+DEI Q+L+ VMKKE+PRR P+ ENL +Y++SRV + LHVVLCFSPVGEKFR R+L+FPGLISGCT+DWFQRWP+DAL+AV+ +FLS+++I  T EVK++VVNTMG FQD+VAE C+ YF+R+RR T+VTPKSYLSFI GYK +Y +K E +G L+ RM TGL KL+EA  SVN+LSKELAVKEK+L VA KKA EVL +V  KA AA+KVK QVQ VKD+A+A+V+ I+ DKA AEEKLE A+PALQEAE ALETIKP  IATV+KLGRPPHLIMRIMDC L+LF++++D VTADPERPC KP+W EA+KLM+ S FL SLL FPKD+I +E+V+L++PY +MED+NL SAK V G+VAGLCSWT+AMA FF INKEVLPLKANLA+Q +KL  A +ELNNAQ  LDAKQ+ELD VQA Y+ AM EKQAL DDAEACRRKM NA ALI GL GE+ RWTE+SK F  QI +LVGDVL+ T FLSY GPFNQ++RN+L + WK E+ +  IP ++D+  ISML DNATI EWN+QGLPND+LS+QNG+IVT+A R+PLLIDPQGQGK WI+N+EKN+ELQVT+LNHKYFR HLED LSLGRPLLIEDVGEE+DPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGF LY+TTKL NP+YTPE+ AKT++IDFTVT+KGLEDQLLG VILTEKQELEAER KLMEEV  NKRK +ELEDNLL+RLTST+GSLV+DESLIEVLR+TK TAE+V +KL +  +TE+KIN+AREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLG+FD SM  S KS ITSKRI NIIEYLT+EVF+YTARG YE  KF FT+L+ +KI +++ +I H EFQ  IKGGA LDLN+VEPKPKKWI D+TWLNLV+LS L  F  +  QVA+N+K WK WFD +APEEA +PDGYDN L+TF++LLLIRSWCPDRT+  A+ YI E++G+++AEG I ++E M  E D  TP++CFLSMGSDPT+NIERL+K KN  C +ISMGQGQEVHAR+LL+ SMQ+G W+LLQNCHLGL+FMDE L+ +T TE +H+ FR W+TTE HPKFPIN+LQ  +KFT +PP G++AGL+RTY+ ++Q+ LD+TN  QWKP+L+ VAFLHTTVQERRKFGP+GWNIPYEFNQ+DF +++QFVQNHLD+MD KRGV+W  + YM+GEVQYGGRVTDD DK LLNT+A+ WF   MF+ KF FYKGY IP GK++DEY  +ID+LPL+D+PE FGLH NADI Y+T+ AN+ L+TIVNIQPKDSGGGAGETRESVV RLA++ML++LPEDY P EVK +LQKMG ++P+NIFL+QE+DRMQ+VI+ VRSTL+DLKLAIDGTIIMSE+L+DALDN++DARIP  W K+SWES+TLGFWFT+LL+RN+QF SWL++GRP  FWMTGFFNPQGFLTAMRQE TR +  KGWALD+V+L NDVT+ MKEDVN  P     GVY++GL+LDGAGW+ R+ KL E  PKVL+T LPVVHVYAVS  NP AD  K     + CPVYKKPRRTDL YIF L L++ E PDHW LRG+ALLCD K
Sbjct:  443 TKVSLDAIKRRLHTISSVYQTAKLTKDHTPTPLFKAEIHLAIPNVVMKPSLEDIQVRTTFTLFLI----------AILYLHHFQ----KDLGDE------LTKMVVLKPLDKQISEHKDVTKVIIQLSTIVLSLKAEAANVLNSFTKFSGIWNQ-----VRTFLCSSRTFSLFICCYILFHLQQLETQISELPAHCIVGSVDFTTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFIDNLSKRLSRPVLDLDDVRGAMDALKEIRDAEIRIDMMIGPIEESNSLLLKYE-----------------------------DHICCVKPVFFLDVIS---------IVILCIYN-KGPGVEGIPPREASDRLQVFQAKFDELWRKYVTFSGGEELFGLPVTEYPELQRIRRELALLQKLYGLYNAVIENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAWL---QTLPAFQHEIL---------------WNLSPKMQILECMYIKQAIDLLQKSKQN---KQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQDHSAPLELPTVSGDQTIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIAV---EDHGQEIMNNALKESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTR--------TYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNP-ADLKKQQGYLHACPVYKKPRRTDLTYIFSLFLRSIEVPDHWTLRGIALLCDSK 3992          

HSP 2 Score: 371.703 bits (953), Expect = 8.201e-102
Identity = 213/495 (43.03%), Postives = 288/495 (58.18%), Query Frame = 1
Query:  937 VNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEI 2421
            + + E +EKLE +L  WIKQIEQVL+ESEQ+R+EADD+GPS                                              D  +T+AANEAKDNVKYLYTLDKFFGPL K +PV    HI  L+N+IRMI+S SQYYN+SE MTSLF+KVTNQ ++TCK ++  GV KIWDL R+EL +RI  C  LNE+Y+  FHK K+KL+E   E+QFEFSENYIFGK + FCKRL+KI+++ N LES + LQT KIEG++ I +RY++I    K K+YD+LDHRK E        +V   T                   ++ +NLLKKFE+I    LD  +K+  VLQ +S+ LD VRKLYQK K +                                 T        E  K++++YNKMA VL+EFEL+Y+  W K  +  K GL +SLL+R+P+ +    +  VN D M++E++ E KY++ +  ++P++
Sbjct:   20 IGTFEIIEKLEAMLSIWIKQIEQVLAESEQMRKEADDIGPS----------------------------------------------DCNVTNAANEAKDNVKYLYTLDKFFGPLGKASPVS--SHI--LMNSIRMIYSTSQYYNTSEHMTSLFLKVTNQTVSTCKSYLSHGVIKIWDLDRQELIRRIKECVFLNEQYQNSFHKVKEKLKETPNERQFEFSENYIFGKLDTFCKRLEKISDISNNLESLADLQTIKIEGVEKISIRYETIVTNTKSKSYDVLDHRKQEVSITMGLKIVLVST-------------------EQMINLLKKFERIGKDHLDFGEKYMIVLQRYSRDLDMVRKLYQKQKEN-------------------------------PPTPRNTPPGLEMKKIIRHYNKMASVLMEFELLYHRGWCKCADIAKNGLHASLLVRHPNTK----ELYVNLDPMVMEVLHETKYLQKMGFEVPDV 410          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 4969.06 bits (12888), Expect = 0.000e+0
Identity = 2474/3648 (67.82%), Postives = 2970/3648 (81.41%), Query Frame = 1
Query: 3049 TRLTLDTIKRRLQSSSNKFSIDPMNEDKRPA-LFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYF--SDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTIL-NTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFIT-HKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNH--KGWALDAVVLSNDVTKFMKEDVNNSPSE---GVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            T+++LD IKRRL + S+ +    + +D  P  LFKA++ L IPN++ KP+L++IQV     +  I            ++LHH Q    + L +E      L     +K L+K IS+HKDV K + QLS I+ + K++   +L+ F+ +S +W +     V+ F+ +    S        F    +E +I   P    VG+V F ++ LK  L+ EC  WK  +   LN K A +MD I    D+LSKRLSRPV DLDDVR  M AL E+R++EI+I+M I PIEE+  +L KYE+ F DGN+ERVD L Y +  L TQ+                              +F   ++  GP  +GI PREASDRL ++Q KFDELWRKY T+SGGEELFGL VT+YP++QRIR+EL LLQKLY LYN V++ +N YY+I W++++I+ IN +L+DFQN+ RKLPKALKEWQA++DL+K IDDF+E+CPLLE M++ AMM RHWERI  +TGHKF+V+S++F L+N+MEA LL  KE+IEDICISAVKEKDIEAKLK+V ++WSA  F+F+ FKSRGELLLKG  T E ++LMEDSLM LG+++SNRYNAPFKP IQ+WVQKL+ TTEIIENWL VQNLWIYLEAVFVGGDIAKQLPQEAKRF NIDKSWQKIMQRAHE PN+VQCC+GD+TL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLLS+FDN   V F EK YD+IL   SQE E V L EP+NAQGNVE+WLG LL   +K+LH++IR ASI I+DS FKL++F+T +P+Q+GLLGIQMIWTRD+EEAL  +KTD+K+MQ TNQ+FLD+LN+LI +TT++LT++ERTK+ETLITIHVHQ+DIFDDLV + I +  DFEW KQSRFYF ED D+CI+ ITDV+F Y NE+LGCTDRLVITPLTDRCYITLSQALGMS+GGAPAGPAGTGKTETTKDMG+CLGK+VVVFNCSDQMDYRGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK +K+QFIFTDGDVVDMD EFGIFLTMNPGYAGRQELPENLK+ FRTVAMMVPDRAII+RVKLAS GF  N +LS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NPD+ E  +VMRVLRDMNLSKLVDEDE LF+SLI DLFP + +    YPD+ AAI KQ E+A LI+H PW LKLIQL+ETQRVRHGMMTLGPSGAGKTKCIN+LM+AMTDCG PHKEMRMNPKAITA QMFG LDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+LDW+P+L++WL   +T  A  + IL N F  IF     Y                                 K+    H+ +L +F++MWS+GALLEL+DR+K++ F+  H   L +P    D TIFE+V+++ G+W+HW+ +VPEY+YP D +PEY SILVPNVDN RTDFL++TI KQ KAVLLIGEQGTAKTV++KGY  KY+PE    KSLNFSSAT PNMFQR++ESY+DKRMGTT+GPP G+KMT+FIDDINMPVINEWGDQITNEIVRQ+ME  G Y+LEKPG+FT++VDIQ +AAMIHPGGGRNDIPQRLKRQF++FNCTLPSN+SIDKIFR +  GYFC +RGF   V    + LV  TRK+WQ TKIKMLPTPAKFHY+FNLRDLSRIWQG+LI+ S+V  S   L++L+KHEC RVI+DRF +Q DKDWFE T+ V   E+ G E++     E YFVDFL+DAPEATG+E E+ +LEAPK+YEPI S+EQL+DRL  YM QYNE VRG ++DLVFFKDAM HLVKISR+IRT +G+ALLVGVGGSGKQSLTRLAS+I+GY++FQITLT         +Y  +NLM+DLK+LYRT+GQ G GITF+FTDNEIKDESFLE++NN+L+SGE++NLFARDE+DEI Q+L+ VMKKE+PRR P+ ENL +Y++SRV + LHVVLCFSPVGEKFR R+L+FPGLISGCT+DWFQRWP+DAL+AV+ +FLS+++I  T EVK++VVNTMG FQD+VAE C+ YF+R+RR T+VTPKSYLSFI GYK +Y +K E +G L+ RM TGL KL+EA  SVN+LSKELAVKEK+L VA KKA EVL +V  KA AA+KVK QVQ VKD+A+A+V+ I+ DKA AEEKLE A+PALQEAE ALETIKP  IATV+KLGRPPHLIMRIMDC L+LF++++D VTADPERPC KP+W EA+KLM+ S FL SLL FPKD+I +E+V+L++PY +MED+NL SAK V G+VAGLCSWT+AMA FF INKEVLPLKANLA+Q +KL  A +ELNNAQ  LDAKQ+ELD VQA Y+ AM EKQAL DDAEACRRKM NA ALI GL GE+ RWTE+SK F  QI +LVGDVL+ T FLSY GPFNQ++RN+L + WK E+ +  IP ++D+  ISML DNATI EWN+QGLPND+LS+QNG+IVT+A R+PLLIDPQGQGK WI+N+EKN+ELQVT+LNHKYFR HLED LSLGRPLLIEDVGEE+DPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGF LY+TTKL NP+YTPE+ AKT++IDFTVT+KGLEDQLLG VILTEKQELEAER KLMEEV  NKRK +ELEDNLL+RLTST+GSLV+DESLIEVLR+TK TAE+V +KL +  +TE+KIN+AREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLG+FD SM  S KS ITSKRI NIIEYLT+EVF+YTARG YE  KF FT+L+ +KI +++ +I H EFQ  IKGGA LDLN+VEPKPKKWI D+TWLNLV+LS L  F  +  QVA+N+K WK WFD +APEEA +PDGYDN L+TF++LLLIRSWCPDRT+  A+ YI E++G+++AEG I ++E M  E D  TP++CFLSMGSDPT+NIERL+K KN  C +ISMGQGQEVHAR+LL+ SMQ+G W+LLQNCHLGL+FMDE L+ +T TE +H+ FR W+TTE HPKFPIN+LQ  +KFT +PP G++AGL+RTY+ ++Q+ LD+TN  QWKP+L+ VAFLHTTVQERRKFGP+GWNIPYEFNQ+DF +++QFVQNHLD+MD KRGV+W  + YM+GEVQYGGRVTDD DK LLNT+A+ WF   MF+ KF FYKGY IP GK++DEY  +ID+LPL+D+PE FGLH NADI Y+T+ AN+ L+TIVNIQPKDSGGGAGETRESVV RLA++ML++LPEDY P EVK +LQKMG ++P+NIFL+QE+DRMQ+VI+ VRSTL+DLKLAIDGTIIMSE+L+DALDN++DARIP  W K+SWES+TLGFWFT+LL+RN+QF SWL++GRP  FWMTGFFNPQGFLTAMRQE TR +  KGWALD+V+L NDVT+ MKEDVN  P     GVY++GL+LDGAGW+ R+ KL E  PKVL+T LPVVHVYAVS  NP AD  K     + CPVYKKPRRTDL YIF L L++ E PDHW LRG+ALLCD K
Sbjct:  591 TKVSLDAIKRRLHTISSVYQTAKLTKDHTPTPLFKAEIHLAIPNVVMKPSLEDIQVRTTFTLFLI----------AILYLHHFQ----KDLGDE------LTKMVVLKPLDKQISEHKDVTKVIIQLSTIVLSLKAEAANVLNSFTKFSGIWNQ-----VRTFLCSSRTFSLFICCYILFHLQQLETQISELPAHCIVGSVDFTTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFIDNLSKRLSRPVLDLDDVRGAMDALKEIRDAEIRIDMMIGPIEESNSLLLKYELVFQDGNAERVDGLAYAWKNLNTQS------------------------------TFNIAFNFMGPGVEGIPPREASDRLQVFQAKFDELWRKYVTFSGGEELFGLPVTEYPELQRIRRELALLQKLYGLYNAVIENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAWL---QTLPAFQHEILWNCFNSIFQVLKHYE--------------------------------KQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQDHSAPLELPTVSGDQTIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIAV---EDHGQEIMNNALKESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTR--------TYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNP-ADLKKQQGYLHACPVYKKPRRTDLTYIFSLFLRSIEVPDHWTLRGIALLCDSK 4136          

HSP 2 Score: 558.525 bits (1438), Expect = 2.051e-158
Identity = 286/515 (55.53%), Postives = 383/515 (74.37%), Query Frame = 1
Query:  772 DG-HNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPD 2313
            DG  N +I E+ + LD+F+  L +A+ N++ +++L+  D  + +  +  PS  + A  +SE +EKLE +L  WIKQIEQVL+ESEQ+R+EADD+GPSAEL +WKSRMS FN+LL+++K+ KV  V++IL  AKSR L+KW+ELD  +T+AANEAKDNVKYLYTLDKFFGPL K +P  M+EHIPSL+N+IRMI+S SQYYN+SE MTSLF+KVTNQ ++TCK ++  GV KIWDL R  L   +  C  LNE+Y+  FHK K+KL+E   E+QFEFSENYIFGK + FCKRL+KI+++ N LES + LQT KIEG++ I +RY++I    K K+YD+LDHRK EFD DY +F  Q E L   +QAF+D+WFEK +  ++ +NLLKKFE+I    LD  +K+  VLQ +S+ LD VRKLYQK K +PP  RN PPI GKI W+R LF+KI+ PM   K T+PE+LK  E  K++++YNKMA VL+EFEL+Y+  W K  +  K GL +SLL+R+P+
Sbjct:    2 DGMQNLQIQEYLDSLDKFIGTLSSARHNLEGKIELKRVDSGNFLENMHNPSDFINAGGNSEIIEKLEAMLSIWIKQIEQVLAESEQMRKEADDIGPSAELEHWKSRMSSFNSLLDEIKSPKVKKVLSILQAAKSRILKKWKELDCNVTNAANEAKDNVKYLYTLDKFFGPLGKASPATMVEHIPSLMNSIRMIYSTSQYYNTSEHMTSLFLKVTNQTVSTCKSYLSHGVIKIWDLDRYILY-FMKECVFLNEQYQNSFHKVKEKLKETPNERQFEFSENYIFGKLDTFCKRLEKISDISNNLESLADLQTIKIEGVEKISIRYETIVTNTKSKSYDVLDHRKQEFDKDYMEFKNQIEGLYQSLQAFVDSWFEKPLTTEQMINLLKKFERIGKDHLDFGEKYMIVLQRYSRDLDMVRKLYQKQKENPPTPRNTPPITGKIMWARQLFRKIDQPMKFLK-TKPELLKGLEMKKIIRHYNKMASVLMEFELLYHRGWCKCADIAKNGLHASLLVRHPN 514          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 5479.45 bits (14213), Expect = 0.000e+0
Identity = 2786/4616 (60.36%), Postives = 3500/4616 (75.82%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTS-IGPVSAH---KKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQ-NLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCK-HFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL----------------------------KMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSS-------SNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDN--------------------KLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA--LPVPICKD-DDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE--VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH ++F  +A   DL+  +VEDALL   +    ++ F+    + LMFYYQDV   +     S+  + P S      K+F+  G    L G C  FIRS   KA+T  NI  +++F  LD + G LL+++ R +S I  P L+ +   WG +      +S   EF   L+ F+  L  AQ ++  ++ L+  D  +L +  E   Y  +A N  ET+EK+E  +  WIKQ+EQ+L+E+ Q+R+EADDVGP AEL +WK R+SRFN LL+Q+K+  V   + +L  AKS+ L+ WR+ D RITDAANEAKDNVKYLYTL+K   PL   +PV MI+ IP+LINAI+M++SIS YYN+SE++TSLFVKVTNQMI+ CK H    G + IW   +E + ++I+   +L + Y+ CF +TK+KL+++ +EKQF+FSE YIFGKFE F +RL KI ++    ++YS+LQ  KIEG++ +  +Y+ I   IKKK Y+ LD R+ +FD DY++F  +   L   +Q F+D  FEK     + L+ LKKFE+++   L  ++K+  + QNF+  +D + KLY K K DPPL RN PPIAGKI W+R LF ++E PM LF++  P +L+  EA  ++++YN++AKVLLEFE++Y+  W + IE    GL +SLL++ P       +  VNFD  IL L +E + +  L L +   A+ L    ++ K  +  MK +L EY  +   +PP +  +M PH+ R+DE   PGL  LTWTS+ I  Y+E     ++   LL+ +V+D+++ RI A+L++M+  ALC LP+D+P+T EEFL MT+      ++ L  +S LVE AVN++I++L                            +   +E+   + NA      L    +K +  E        +L++F  +NT+ L+K TR TL+ I+RR+  S       SN  S    N      +F+A + L IPNI   P L++IQ  LNKAV+ I+ + + + QW+   L  +++ E +  A +NN+D+                     LP P   ++  K ISD+K++ K VS LS ++++ K +V T +  F  Y+ +W++E +  +  F+   P+L E  ++I YF  +E EI++ P   +VG++  Y+  LK  L +E  +W     +  N K   EM++IL + +   K+LSRP+KDLDD+R  MAAL E+RE +I  +  + PIEE+Y +L+KY +       ++VD+L Y + KL  +A  VQ+ L  +QP F+ ELI  V+ F ++   F  DYD  GPMA G+ P+EAS RL I+Q +FD ++RKY TY+GGEELFGL VT YP +  I+++LNLLQK+Y LYNNV++TVNSY D  WS++NI+ IN +LL+FQN+CRKLP+ALK+WQA+ DL+KTIDDF+E CPLLE M+ NAM+ RHW+RI  +TGH  +V ++ F LRN+MEAPLL  KEEIEDICISAVKE+DIE KL+ V N+W  ++ +FS FK+RGELLL+GD+T E+++ MEDSLM LG+LLSNRYN PFK +IQ+WVQ L+ +T+IIENW+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHEIPNVVQCC+GD+T+ QLLPHLL+QLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F +K+YD+IL+I+S+E E ++LD+P+ A+GNVE+WL  LL+ S+ SLH VIR A+  I +  F+L EF +SFP+QVGLLGIQM+WTRDSEEAL  +K DKKIMQ TNQ FL++LN LI +TT++L+ +ER K+ETLITIHVHQRDIFDDL  + + +P DFEWLKQ RFYFKED+D+ ++ ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQIS++LTCKKE K  FIFTDGD V M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGF+ N VL++KF+TLY+LCEEQLSKQVHYDFGLRNILSVLRTLGA KR +P D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP + +    YP++  AI KQ+E+A LINH PW+LK+IQLFETQRVRHGMMTLGPSG+GKT CI+ LM+AMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+LDW PIL  +L      +A    +   +   F + YR+  Q L  KM  LE   I Q+  +L GL+   +   E+   HL +L VF+MMWS+GA+LELE R +++ ++  ++   L +P   D  DT+F+Y V   G W HW+   PEY+YP D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KG+  K++PE  + K+LNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KM +FIDD+NMPVINEWGDQ+TNEIVRQ+ME +G Y+LEKPG+FT+IVDIQ +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPS+AS+DKIF ++G GY+C +RGF  +VQ  +  LV  TR+LWQ TK+KMLPTPAKFHYVFNLRDLSRIWQGML + S+VI    +L+ LWKHEC RVI DRF+  +D  WF+K +    EEE G E   V     + YFVDFL+DAPEATGE  EE + E PK+YEPI S   L +RL  ++  YNE++RG  +D+VFF DAM HLVKISRVIRT +G+ALLVGVGGSGKQSLTRLASFI+GY +FQITLT         SYN SNLMEDLK+LYRT+GQ GKGITF+FTDNEIK+ESFLE++NN+LSSGE++NLFARDE+DEI  +L  +MKKE+PRRPP+N+NL EY+MSRV   LH+VLCFSPVGEKFRNR+L+FP LISGCTIDWF RWPKDAL+AVS +FLS++ I  T E+KK +V  MG FQD VAE C +YFQRFRR THVTPKSYLSFI GYK +Y +K  E+ +LA RMNTGL+KL EA+ESV  LSKELA KEKEL+VA +KA  VL +V +KA AA+KVK +VQ VKD+A+A+V++IS+DKAIAEEKLEAAKPAL+EAE AL+TIKP  IATV+ LGRPPHLIMRIMDCVL+LF++R+++V  D ++ C  P+W E++KLM+  NFL +L  FPKDTIN+EV++ + PYF M D+N+ +AK V G+VAGLCSWTKAMASFFSINKEVLPLKANL VQ+++   AM++L  AQ  LDAKQ ELD+VQAEY +AM EKQ L +DA+ CR KM  A  LI GLAGE+ERWTE SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FR++L   WK E+    IPF + +    ML D  TISEWN+QGLPND+LS+QNG+IVT+A RYPLLIDPQ QGK WI+NKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLEKNFIK+GSTFKVKVGDKEVDVM GF+LY+TTKLPNP+YTPE+ A+TSIIDFTVT+KGLEDQLLG VILTEKQELE ERT L+E+V  NKR+ KELEDNLLYRLTST+GSLVEDESLI VL  TK+TAE+V QKL I  +TEI+INSAREEYRPVATRGSILYFLI EM +VNEMYQTSL+QFLGLFD S+A S KSPITSKRI NIIE++TYEVF+Y ARG YE  KF FT+LLT+KI ++   +KHEEF   IKGGA+LDL A  PKP KWI D+TWLNLVELSKL  F  I +Q+++N+K W+ WFD + PEE  +P+ YD +L+ F++LLLIRSWCPDRT+  A+KYI ++MG  +AEGVI +LE+  EE D  TP+IC LSMGSDPTD+I  L K+  ++   +SMGQGQEVHARKLL  +M  G W+LLQNCHLGL+F+DE ++++T TE +H++FR W+TTE H +FPI +LQ+ IKF  +PP G+RAGLRRTY  ++QD LD++   QWKPML+ VAFLH+TVQERRKFGP+GWNIPYEFNQ+DF +TVQF+QNHLDDMD+K+GVSW TV YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MF P F+FY+GY IP   ++D Y  +I  LP  DSPE FGLH NADI Y++  A  +L TI+ IQPKDS GG  ETRE+VV RLADDML++LPEDY+PFEVKE+LQKMG  +P+NIFL+QE+DRMQ+V+S+VRSTL +LKLA+DGTIIMSENL+DALD +FDARIP+ W K SW S+TLGFWFT+LL+RN QF SW+  GRP CFWMTGFFNPQGFLTAMRQEITR +KGWALD +VL N+VTKFMK+D++  P+EGVYV+GLYL+GAGW+ R+ KL E  PKVL+  +PV+ ++A   NN   D      R Y CP+YKKP RTDLNYI  ++LKT +AP+HW+LRGVALLCD+K
Sbjct:   33 LDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERMDQLFAVGGLRHLMFYYQDVEGAEAGHCGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITPENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIRQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIIELKSLKEPTDYLALASNP-ETVEKVECCMRVWIKQMEQILAENSQLRKEADDVGPRAELEHWKQRLSRFNYLLDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMIDAIPTLINAIKMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQGYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIEGLEDMATKYQDIVAAIKKKEYNFLDQREMDFDQDYEEFCKRINELHNDLQRFMDITFEKIPSTRQALSTLKKFERLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQQ-HPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGT----GELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRVNDLIEFRIHAILEEMSSMALCQLPQDDPLTCEEFLQMTKDLCVSGAQLLHFKSSLVEEAVNELINMLLDVDVPPEEAAENVCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEAR-ELLSHFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSNDASKAKQN---HLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHERKMAAVKNNEDSDSDAEVEENELQETLEIASINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTFIAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEA--EILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQAGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTR--------SYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA--ENNTARDP-----RLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDVK 4621          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDY--SRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPM-ILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDII----DILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLN---------------YFTQRNTETLIKCTRLTLDTIKRRL--QSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGS-----------------VKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTS-HLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            + P H +IF+ + +   LDL  VE+ +L       F  FF     K L F YQ+  V  +   RT  T +       ++++   + + LKGLC  F+R   D A+ S  I  D+ F  LDAS G LL+ ++  +  I  P +     WG+++      S+   F E + R+L +L  A  +++  + L+  D+ D  +K+        A +SSE + +LE +L  W KQIEQVL ESEQ+R+EADD GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD+ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIHS+S+YYN+SERMTSLF+KVTNQM+T CK ++ +G  + +WD     + K+I  C  L +EY+  FHKT+K++ E S EK FE SE YIFGKFEAFCKRL+KI  +  I+++YS L    IEGID + +++K+I   IKK  YDILD R++EFD D+ +FM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   L+  +KLY   K DPPL RN+PPIAGKI W R LF++I  P+   FK +  +IL   E   +++ YN++A VL+EFE+ Y+  WFK +   +  L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A  L+  E+ +K     ++ +L  Y ++   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KKV+D+ ++ I+ VL ++A T L  L +     +E+ L++ E   +E ++ L  +S+ VE AV ++I     I ++  T    K++  +        + ++   L+ +        N               +F+ +  ++L K TRL+LDT+KRR+   S   + S D +      +  K ++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W       +Q+++++     +   ++ P  G                  +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++ +E EI    P   VG++  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ  L+++QPKFK  L+E VK F E+VI+F   Y++ GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +L +FQN+CRKLP+ALK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD F LRN+MEAPLL NK++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYN PFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD++ A+ S+E E + LD P+ A+G VEIWL DLLK+   SLH++IRSA   I+DS F L  F   FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +LTK +R KFETLITIHVHQRDIFDDLV + I +  DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE   VMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++ +A+D Q+    LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+++T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP  K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL      +A  +  L+ +  +F +AY Y+  +L+PKM  LECNYI Q+++LL GL+   +   + +  HL KL VF +MWSLGALLEL+ R KL+ F+  H   L +P I K    T++E+ V D G+WEHW  R+  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKRMG+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSN SIDKIF I+GCGYF   R F+P++   V NLV+ +R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML V ++  +S   L+SL+KHEC RVI DRF    D+ WF   L    EE    EV A +  EPYFVDFL+D PE TG+E E+T  E PKIYE + S+E LS++L  Y  Q+NE +RG  LDLVFFKDAMTHLVKISR+IRT+ G+ALLVGVGGSGKQSL++LASFI+GY+ FQITLT         SYNVSNL+EDLK LY+ +G  GKGITF+FTDNEIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY+++R  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWPK+ALIAV++YFL  + IV + E K+ VV TMG+F D+V+E+C NYFQR+RR  HVTPKSYLSFI+GYK +Y  K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ KVK +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+PC KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AM  F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGDVL+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  I+ML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+ FKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELE+ER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR+TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH+EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK WFD DAPEE  IPDGY D+L+T +KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D +TP+ICFLSMGSDPT  I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+G W+LLQNCHLGL FM+E LE++  TE   +SFR W+TTE H +FPI +LQ  IKFT +PP G+RAGL+RT+A + QD LDI+N   WKPML+ VAFLH+TVQERRKFGP+GWNIPYEFN +DF+++VQF+QNHLD+ D+K+GVSW TV YMIGEVQYGGRVTDD+DKRLLN +A+ WFS +MF P F FY GY IP  K+LD+Y  FI  LP +D+PE FGLH NADI Y+++ A+ +L TI NIQPK+SGGG GETRE++VYRL++DML +LP +Y P EVK +L KMG L  +NIFL+QE+DRMQKVISI+RS+L DLKLAI+GTIIMSENL+DALDN++DARIP  W ++SW+S+TLGFWFT+LL+RN QF +W++EGRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD V + N+V +  KE++   P+EGVY++GLY+DGA W+ R+ KL E  PKVL+T LPV+H++A++   P       + + Y CP+YKKPRRTDL +I  + L+T  +PDHWILRGVALLCDIK
Sbjct:  170 IGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEVPGFECGRT-ITGVPKGGKMMRIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKG-LLEGIKHMLKSIFLPAILATSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDF-SKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYFFKNS--DILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIFEQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTTMEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQ-----QQVRQIKSFQNNSRGSDQPPASGKPLKKEERSFEETIPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEA--SVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVSSGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGSKLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTR--------SYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAP------KDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDY--SRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPM-ILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDII----DILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLN---------------YFTQRNTETLIKCTRLTLDTIKRRL--QSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGS-----------------VKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTS-HLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            + P H +IF+ + +   LDL  VE+ +L       F  FF     K L F YQ+  V  +   RT  T +       ++++   + + LKGLC  F+R   D A+ S  I  D+ F  LDAS G LL+ ++  +  I  P +     WG+++      S+   F E + R+L +L  A  +++  + L+  D+ D  +K+        A +SSE + +LE +L  W KQIEQVL ESEQ+R+EADD GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD+ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIHS+S+YYN+SERMTSLF+KVTNQM+T CK ++ +G  + +WD     + K+I  C  L +EY+  FHKT+K++ E S EK FE SE YIFGKFEAFCKRL+KI  +  I+++YS L    IEGID + +++K+I   IKK  YDILD R++EFD D+ +FM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   L+  +KLY   K DPPL RN+PPIAGKI W R LF++I  P+   FK +  +IL   E   +++ YN++A VL+EFE+ Y+  WFK +   +  L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A  L+  E+ +K     ++ +L  Y ++   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KKV+D+ ++ I+ VL ++A T L  L +     +E+ L++ E   +E ++ L  +S+ VE AV ++I     I ++  T    K++  +        + ++   L+ +        N               +F+ +  ++L K TRL+LDT+KRR+   S   + S D +      +  K ++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W       +Q+++++     +   ++ P  G                  +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++ +E EI    P   VG++  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ  L+++QPKFK  L+E VK F E+VI+F   Y++ GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +L +FQN+CRKLP+ALK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD F LRN+MEAPLL NK++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYN PFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD++ A+ S+E E + LD P+ A+G VEIWL DLLK+   SLH++IRSA   I+DS F L  F   FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +LTK +R KFETLITIHVHQRDIFDDLV + I +  DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE   VMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++ +A+D Q+    LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+++T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP  K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL      +A  +  L+ +  +F +AY Y+  +L+PKM  LECNYI Q+++LL GL+   +   + +  HL KL VF +MWSLGALLEL+ R KL+ F+  H   L +P I K    T++E+ V D G+WEHW  R+  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKRMG+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSN SIDKIF I+GCGYF   R F+P++   V NLV+ +R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML V ++  +S   L+SL+KHEC RVI DRF    D+ WF   L    EE    EV A +  EPYFVDFL+D PE TG+E E+T  E PKIYE + S+E LS++L  Y  Q+NE +RG  LDLVFFKDAMTHLVKISR+IRT+ G+ALLVGVGGSGKQSL++LASFI+GY+ FQITLT         SYNVSNL+EDLK LY+ +G  GKGITF+FTDNEIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY+++R  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWPK+ALIAV++YFL  + IV + E K+ VV TMG+F D+V+E+C NYFQR+RR  HVTPKSYLSFI+GYK +Y  K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ KVK +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+PC KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AM  F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGDVL+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  I+ML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+ FKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELE+ER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR+TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH+EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK WFD DAPEE  IPDGY D+L+T +KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D +TP+ICFLSMGSDPT  I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+G W+LLQNCHLGL FM+E LE++  TE   +SFR W+TTE H +FPI +LQ  IKFT +PP G+RAGL+RT+A + QD LDI+N   WKPML+ VAFLH+TVQERRKFGP+GWNIPYEFN +DF+++VQF+QNHLD+ D+K+GVSW TV YMIGEVQYGGRVTDD+DKRLLN +A+ WFS +MF P F FY GY IP  K+LD+Y  FI  LP +D+PE FGLH NADI Y+++ A+ +L TI NIQPK+SGGG GETRE++VYRL++DML +LP +Y P EVK +L KMG L  +NIFL+QE+DRMQKVISI+RS+L DLKLAI+GTIIMSENL+DALDN++DARIP  W ++SW+S+TLGFWFT+LL+RN QF +W++EGRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD V + N+V +  KE++   P+EGVY++GLY+DGA W+ R+ KL E  PKVL+T LPV+H++A++   P       + + Y CP+YKKPRRTDL +I  + L+T  +PDHWILRGVALLCDIK
Sbjct:  170 IGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEVPGFECGRT-ITGVPKGGKMMRIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKG-LLEGIKHMLKSIFLPAILATSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDF-SKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYFFKNS--DILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIFEQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTTMEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQ-----QQVRQIKSFQNNSRGSDQPPASGKPLKKEERSFEETIPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEA--SVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVSSGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGSKLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTR--------SYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAP------KDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDY--SRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPM-ILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDII----DILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLN---------------YFTQRNTETLIKCTRLTLDTIKRRL--QSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGS-----------------VKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTS-HLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            + P H +IF+ + +   LDL  VE+ +L       F  FF     K L F YQ+  V  +   RT  T +       ++++   + + LKGLC  F+R   D A+ S  I  D+ F  LDAS G LL+ ++  +  I  P +     WG+++      S+   F E + R+L +L  A  +++  + L+  D+ D  +K+        A +SSE + +LE +L  W KQIEQVL ESEQ+R+EADD GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD+ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIHS+S+YYN+SERMTSLF+KVTNQM+T CK ++ +G  + +WD     + K+I  C  L +EY+  FHKT+K++ E S EK FE SE YIFGKFEAFCKRL+KI  +  I+++YS L    IEGID + +++K+I   IKK  YDILD R++EFD D+ +FM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   L+  +KLY   K DPPL RN+PPIAGKI W R LF++I  P+   FK +  +IL   E   +++ YN++A VL+EFE+ Y+  WFK +   +  L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A  L+  E+ +K     ++ +L  Y ++   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KKV+D+ ++ I+ VL ++A T L  L +     +E+ L++ E   +E ++ L  +S+ VE AV ++I     I ++  T    K++  +        + ++   L+ +        N               +F+ +  ++L K TRL+LDT+KRR+   S   + S D +      +  K ++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W       +Q+++++     +   ++ P  G                  +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++ +E EI    P   VG++  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ  L+++QPKFK  L+E VK F E+VI+F   Y++ GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +L +FQN+CRKLP+ALK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD F LRN+MEAPLL NK++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYN PFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD++ A+ S+E E + LD P+ A+G VEIWL DLLK+   SLH++IRSA   I+DS F L  F   FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +LTK +R KFETLITIHVHQRDIFDDLV + I +  DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE   VMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++ +A+D Q+    LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+++T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP  K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL      +A  +  L+ +  +F +AY Y+  +L+PKM  LECNYI Q+++LL GL+   +   + +  HL KL VF +MWSLGALLEL+ R KL+ F+  H   L +P I K    T++E+ V D G+WEHW  R+  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKRMG+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSN SIDKIF I+GCGYF   R F+P++   V NLV+ +R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML V ++  +S   L+SL+KHEC RVI DRF    D+ WF   L    EE    EV A +  EPYFVDFL+D PE TG+E E+T  E PKIYE + S+E LS++L  Y  Q+NE +RG  LDLVFFKDAMTHLVKISR+IRT+ G+ALLVGVGGSGKQSL++LASFI+GY+ FQITLT         SYNVSNL+EDLK LY+ +G  GKGITF+FTDNEIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY+++R  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWPK+ALIAV++YFL  + IV + E K+ VV TMG+F D+V+E+C NYFQR+RR  HVTPKSYLSFI+GYK +Y  K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ KVK +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+PC KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AM  F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGDVL+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  I+ML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+ FKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELE+ER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR+TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH+EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK WFD DAPEE  IPDGY D+L+T +KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D +TP+ICFLSMGSDPT  I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+G W+LLQNCHLGL FM+E LE++  TE   +SFR W+TTE H +FPI +LQ  IKFT +PP G+RAGL+RT+A + QD LDI+N   WKPML+ VAFLH+TVQERRKFGP+GWNIPYEFN +DF+++VQF+QNHLD+ D+K+GVSW TV YMIGEVQYGGRVTDD+DKRLLN +A+ WFS +MF P F FY GY IP  K+LD+Y  FI  LP +D+PE FGLH NADI Y+++ A+ +L TI NIQPK+SGGG GETRE++VYRL++DML +LP +Y P EVK +L KMG L  +NIFL+QE+DRMQKVISI+RS+L DLKLAI+GTIIMSENL+DALDN++DARIP  W ++SW+S+TLGFWFT+LL+RN QF +W++EGRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD V + N+V +  KE++   P+EGVY++GLY+DGA W+ R+ KL E  PKVL+T LPV+H++A++   P       + + Y CP+YKKPRRTDL +I  + L+T  +PDHWILRGVALLCDIK
Sbjct:  170 IGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEVPGFECGRT-ITGVPKGGKMMRIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKG-LLEGIKHMLKSIFLPAILATSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDF-SKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYFFKNS--DILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIFEQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTTMEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQ-----QQVRQIKSFQNNSRGSDQPPASGKPLKKEERSFEETIPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEA--SVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVSSGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGSKLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTR--------SYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAP------KDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 2004.95 bits (5193), Expect = 0.000e+0
Identity = 1227/3594 (34.14%), Postives = 1950/3594 (54.26%), Query Frame = 1
Query: 3382 LISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKE--WQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYD-----KILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSK--TDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRL-KLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTD---CGEPH----KEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECN------------YIRQAIDLLAGLVHGMDIKEIK--TSHLEKLIVFSMMWSLGALLELEDRLKLQEFITH-KKALPVPICKDDDTIFEYVVNDKGE-WEHWTARVPE-YLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLK--------VTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDR-------AEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALN-HKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKP-KKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNL--KCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFM---DEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQL-DITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKF---SFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGG-AGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGR-PVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRR---TD-LNYIFPLNLKTNE-APDHWILRGVALLCDI 13956
            L+   +D+ K  +Q+S  M    S +Q  L  +  Y  +W+    + ++ + +  P +S  +A I  ++++   +        +  V+     LK  L+  C+ W+  +   L    A  +  +       ++++S P + L+++   +  +  L+     +E  I PI E + +L KYE+   D   E ++SL   +   +      +  L + + KFK  LI     FK+   + + D++ +GP    +    A D++   +     +  +         +F +E     D+Q + KEL+ LQ+++++  +  ++ N +    +  +  + +         +  +L K  K+  W+  +  R  I+ F  T PL+  + + A+  RHW++++     +F+ +S++F L  +++  +  + E+I +I  SA KE  IE  L+ +   W +       +K +G   L+G  T E+   +ED+ +AL  + ++R+   F+  +  W + L+   E+IE  L VQ  W+YLE +F+G DI KQLP E+  F  ++ +W+ IM R ++  N ++       L + L  +   LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K +   +KV       + + + S + E +    P+  +G VE WLGD+ +  R +L  ++R+  + +     K  ++   +  QV +   Q+ WT D  + L  +K  +DKKI++ +      ILN+       NLTKI R K   L+TI +H RD+ + L    +     F+WL Q RFY+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +DY+ +GR+Y GLAQSG+WGCFDEFNRI + VLSV AQQI  +L+       +F F +G  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF    +L+KK YTLY L  +QLS+Q HYDFGLR + S+LR  G  +R  PD S+  +++  +RDMN++KL   D  LF ++++DLFP +++    Y  +   I+++I +  L    P+ L K++QL+ET+  RH  M +G +G+ KT    +L  ++T     GEP+    +E  +NPKA++  +++G  D+ TN+WTDGI S++ R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV N+  ASPATVSR GMVY     L W+P ++SWL      +    T +   + +F    +++ + LS K     CN             + +   +LA   +G++  + +  +  +E   VFSM+WS+ A ++ + R K+  ++   + + P     + DT++EY VN K   W  +  ++P+ + YP +    +  I+VP VD  R ++L++T+      VLL+G  GT KT I +         Q     +N S+ TT N  Q  +ES V+KR    + P GG+ M  F+DD+NMP  + +G Q   E++R  ++    Y   K      I D+ ++AAM  PGGGR  I  RL+ +F+I N T P+ +   +I RI G       + F+ +V+   N +  AT  ++     + LPTPAK HY+FNLRD+S+++QGML  N D  ++ + +  LW HEC RV +DR  + AD + F   L         +T    C +      +  P F DFL++                PK+YE +     L   +   + +YN +     + LV F++A+ H+ +I RVI   +G+ LLVG+GGSG+QSL RLAS I  Y TFQI +T     KH   Y      +D+K LYR +G   +  +FLF D +I DESFLE +NN+LSSGE+ NL+  DE +EI   ++   + E  + P S+++L  Y + RV   LH+VLC SPVG+ FRN   ++P L++  TI+WF  WP++AL+ V+  ++   ++ +   + + V          VA+         RR  +VTP +YL  +SGYK++  +KR+E+   A ++ TGL K+ E  E V  +S EL   +K++   +K+  E L  +  +   A + ++ V    ++        +AL +N  +D   A   LE A  AL+       ++  + I  +K  GRPP  +  +M  V+IL                 +PTW EA + +   NF+ SL+NF KD I+D+V+  +  Y    DF       VS     LC W +AM  +  + + V P +  +    ++L+     L  AQE L    ++L++++ +Y++ + +K+ L   +E    K+  A  L+ GLAGE+ RW E  +  ++ +  LVGD LI  AFLSY GPF  ++R+ I+ + W  ++    +P +      + LT+   + +WNIQGLP+D  S +NG+IVTR  R+ L+IDPQGQ   WI+N E N  L++  L  H Y R  LE A+  G P+L+++V E +DP L+ VL K+  + G    +++GDKEV+    F+ Y+TTKL NP Y PE  AKT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK KELED +L  L    GSL++D  L+  L+ +K TA +V ++L     TEI I+ ARE YRP A R S+L+F++ +M  ++ MYQ SL  ++GLF  S+  S +S     RI  + +Y TY V+RYT R  +E  K  F+  +  KI   SG++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F  +     +  + W  W+ + +PE+A +P  ++N     +++L++RS   DR       +I   +G RF E  + N++ + E+    +P++  LS G DPT  + +LA+   +  +  ++S+GQGQ   A +LL   + +G W+ L NCHL L++M   D+ +E +   E+ H SFR W+++  HP FPI+ILQ  IK T +PP G++A + R Y L+T+ Q    +   ++K +LF + F H+ + ER+KF  +GWNI Y FN SDF  +   +  +LD+ +      W  + Y+I  V YGG VTDD+D+RLL TY  ++F        F   S    Y IP   SL  Y+ +I  LP +D PE FG H NAD+  + + A  +  T++++QP+ +     G++RE  V  LA D+ Q++PE  + +E   KL  +    PLN+ L QE+ R  K++  +  +L DL+  I G I+MS +L++  + IFDA +P  W K+      L  W  DL  R EQF +W    R PV FW++GF  P GFLTA+ Q   R +   ++D++     V+     ++   P +GV+V GLYL+GAGW+ +++ L E  P  L   +P +H        P   + K+ +  Y CP Y  P R   TD  +++  ++L++     DHWI RG ALL  +
Sbjct:  962 LVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRG--TEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPG-LLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKI-QKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVS------ILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYF-EGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGL-QITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWL------EKRPKTEVEPLQRMFE---KFINKILSFKKDN--CNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREIEGSFP-----NKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPN--APFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQS-IKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTES---QIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPN------KRPPIFGDFLKE----------------PKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVT-----KH---YRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAE--QIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALE-------SLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGN--------------EPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRV-LEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQL-QVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYE---ETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMID-YEGTRKLLALDP-SPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQN-NISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHF------RPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSL 4454          

HSP 2 Score: 103.99 bits (258), Expect = 6.000e-21
Identity = 78/275 (28.36%), Postives = 135/275 (49.09%), Query Frame = 1
Query:  598 FIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRL-----VAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKV 1407
            FIR     +T  N    + +  +    G  + AL R +S +  P +   + W          S  + F   L RFL +L       D++ +LE          + IP+  +     V V   E +++LE  +  W +QI++VLS  E +    +++GP  E+ +W +R    +++ +Q+  K V  + +IL  AKS  L  +R+L  +I D + +A+ N+ +L  L + +  L+   P D+ E +P LI+ IR+I   S +YN+ ER+T+LF KV
Sbjct:  176 FIRQAPVPITPENFEETVQYGTVR---GAYIPALLRLLSGVYVPQIFMNKSWPE--------SIRNHFVSHLHRFLASLT------DTRYKLEGH------TVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVLSAQESVE-TGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKV 426          
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q8TE73|DYH5_HUMAN (Dynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3)

HSP 1 Score: 5509.88 bits (14292), Expect = 0.000e+0
Identity = 2802/4622 (60.62%), Postives = 3524/4622 (76.24%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVS------AHKKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSM-STKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYE-GVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL------------------KMNL-TESELK-----------NLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS-----NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDN--------------------KLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA----LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE----VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH ++F  +A   DL+ T+VEDA+L   +    ++ F+    + LMFYYQDV  E+       S+G V+         K+F+  G+   L G+C  FIR+   KA+T +NI  +++F MLDA+ G LL+++ R +S I  P L+     WG +   +D  N +  EF   L+ F+N L  AQ+++  ++ L   D  +L    E P+  L   N+ ET+ K+E+ +  WIKQ EQVL+E+ Q+ +EADDVGP AEL +WK R+S+FN LLEQ+K+  V  V+ +L  AKS+ L+ WRE+D RITDA NEAKDNVKYLYTL+K   PL   +P+ M++ IP+LINAI+MI+SIS YYN+SE++TSLFVKVTNQ+I+ CK ++   G + IW+  ++ + ++I    +L +EY+ CFHKTK+KL+++   KQF+FSE YIFGKFE F +RL KI ++   L++YS+LQ   IEG++ +  +Y+ I   IKKK Y+ LD RK +FD DY++F  Q   L  +++ F+D  F K    ++ L +LKKFE+++   L   DK+  +L+N+   +D + KLY K K DPPL RN PPIAGKI W+R LF +I+ PM LF++  P +L   EA  ++++YN+MAKVLLEFE++++  W + IE   +GL +SLL++ P       +  VNFD  IL L +E + +  + L++  +A+ L    +  K  +  MK +L EY  +   +P  +  ++ PH+ ++DE   PGL ALTWTS+ I  Y+E     ++   LL+ +V+D+++ RI+A+L++M+ T LC LP++EP+T EEFL MT+      ++ L  +S LVE AVN+++++L                   +N   ES  K           ++NA      L    +K +  E        +L++F  +N + L+K TR TL+ I++R+ SS      +  S   M ++  P +F+A + L IPNI+  P L+++Q  LNKAV+ I+ + + + QW+   L  K+IQE +  A ++N+D+                     LP P   K+  K +S++K++ K VS LS I+N+ K +V T +  F  Y+ +W++  +  +K F+   P+LSE  +QI YF ++E EI++ P    VG++  Y+  LK  L +E  +W     +  N K   EM++I  L +  +K+L+RP+KDLDD+R  MAAL E+RE +I I+  + PIEE+Y +L++Y +       ++VD+L Y + KL  +A  VQ+ L+ +QP FK ELI  V+ F ++   F  DYD  GPMA G+ P+EASDRL ++Q +FD ++RKY TY+GGEELFGL  T YP +  I+K+LNLLQK+Y LYN+V++TVNSYYDI WSE+NI+ IN +LL+FQN+CRKLP+ALK+WQA+ DL+K IDDF+E CPLLE M+  AMM RHWERI T+TGH  +V +++F LRN+MEAPLL  KEEIEDICISAVKE+DIE KLK V N+W  ++F+F SFK+RGELLL+GD+T EI++ MEDSLM LG+LLSNRYN PFK +IQ+WVQ L+ +T+IIE+W+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+P+VVQCC+GD+TL QLLPHLL+QLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN K+V F EK+YD+IL+I+SQE E ++LD+P+ A+GNVE+WL  LL+ S+ SLH VIR A+  I ++ F+L EF +SFP+QVGLLGIQMIWTRDSEEAL  +K DKKIMQ TNQ FL++LN LI VTT++L+  ER K+ETLITIHVHQRDIFDDL  + I +P DFEWLKQ RFYF ED+D+ ++ ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQIS++LTCKKE K  FIFTDGD V M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGF+ N VL++KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP + +    YP++ AAI +Q+E+A LINH PW+LK+IQLFETQRVRHGMMTLGPSGAGKT CI+ LMRAMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW+ILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KIIFE HNIDNASPATVSRNGMV+MSSSILDW PIL  +L      +A    +   +   F + YR+  Q L  KM  LE   I Q+I++L GL+   +   E+  +HL +L VF+++WS GA LEL+ R +L+ ++  +      LP P     DT F+Y V   G W HW  R  EYLYP+D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KG+  KY+PE  + KSLNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KMT+FIDD+NMP+INEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT+IVDIQ +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPS AS+DKIF ++G G++CT+RGF  +V+ +V  LV  TR+LWQ TKIKMLPTPAKFHYVFNLRDLSR+WQGML   S+VI   + L+ LWKHEC RVI DRFT  +D  WF+K L    EEE G E    V  G+ T  YFVDFL+DAPEA GE +EE + E PKIYEPIES+  L +RL  ++  YNE++RG  +D+VFF DAM HLVKISRVIRT +G+ALLVGVGGSGKQSLTRLASFI+GY +FQITLT         SYN SNLMEDLK+LYRT+GQ GKGITF+FTDNEIKDESFLE++NN+LSSGE++NLFARDE+DEI  +L SVMKKE+PR  P+NENL +Y+MSRV + LH+VLCFSPVGEKFRNR+L+FP LISGCTIDWF RWPKDAL+AVS +FL++++I  + E+KK VV  MG FQD VAE C++YFQRFRR THVTPKSYLSFI GYK +Y +K  E+ TLA RMNTGL+KL EA+ESV  LSKEL  KEKEL+VA  KA  VL +V +KA AA+KVK +VQ VKDRA+A+V++IS+DKAIAEEKLEAAKPAL+EAE AL+TI+P  IATV+ LGRPPHLIMRIMDCVL+LF++++ +V  D E+ C  P+W E++KLM+  NFL +L  FPKDTIN+EV++ + PYF M D+N+ +AK V G+VAGLCSWTKAMASFFSINKEVLPLKANL VQ+++   AM++L  AQ  LD KQ ELD+VQAEY +AM EKQ L +DAE CR KM  A  LI GLAGE+ERWTE S+ F  Q K+LVGDVL+ TAFLSY GPFNQ+FR++L   W+ E+    IPF  ++    ML D  TISEWN+QGLPND+LS+QNG+IVT+A RYPLLIDPQ QGK WI+NKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLE+NFIK+GSTFKVKVGDKEVDV+ GF+LY+TTKLPNP+YTPE+ A+TSIIDFTVT+KGLEDQLLG VILTEKQELE ERT LME+V  NKR+ KELEDNLLYRLTST+GSLVEDESLI VL  TK TAE+V QKL I  +TE++INSAREEYRPVATRGSILYFLI EM +VNEMYQTSL+QFLGLFD S+A S KSPITSKRI NIIE++TYEV++Y ARG YE  KF FT+LLT+KI ++  ++KHEEF   IKGGA+LDL A  PKP KWI D+TWLNLVELSKL  F  + +Q+++N+K WK WFD + PEE  +P+ YD +L+ F++LLLIRSWCPDRT+  A+KYI ++MG ++AEGVI +LE+  EE D  TP+IC LSMGSDPTD+I  L K+  ++   +SMGQGQEVHARKLL  +M  G W LLQNCHLGL+FMDE ++II  TE +H++FR W+TTE H +FPI +LQ+ IKF  DPP G+RAGL+RTY+ ++QD LD+++  QWKPML+ VAFLH+TVQERRKFG +GWNIPYEFNQ+DF +TVQF+QNHLDDMD+K+GVSW T+ YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MF P FSFY+GY IP   ++D Y  +I  LP  DSPE FGLH NADI Y++  A  +L TI+ IQPKD+ GG  ETRE+VV RLADDML++LP DY PFEVKE+LQKMG  +P+NIFL+QE+DRMQ+V+S+VRSTL +LKLAIDGTIIMSENL+DALD +FDARIP++W K SW S+TLGFWFT+L++RN QF SW++ GRP CFWMTGFFNPQGFLTAMRQEITR +KGWALD +VL N+VTK+MK+D++  P+EGVYV+GLYL+GAGW+ R+ KL E  PKVL+  +PV+ +YA   NN + D      RFY CP+YKKP RTDLNYI  ++L+T + P+HW+LRGVALLCD+K
Sbjct:   33 LDARHNYLFAIVASCLDLNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDV--EEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATSHGWGELEGLQDAANIR-QEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKE-PTDYLTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLLEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASIWNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEFCKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADIDMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQQ-HPAVLSTAEAKPIIRSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGT----GELFVNFDPQILILFRETECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEYQRVKSKIPAAIEQLIVPHLAKVDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPLCQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLP-IFRASVTLAIPNIVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVEMGENELQDTLEIASVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDCFKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTADLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAALKEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKLVSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPATQYPQLLEIKKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEA--EILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQGGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPPP-AGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDCGIDT--YFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTR--------SYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA--ENNTLRDP-----RFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALLCDVK 4624          
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q8VHE6|DYH5_MOUSE (Dynein heavy chain 5, axonemal OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2)

HSP 1 Score: 5479.45 bits (14213), Expect = 0.000e+0
Identity = 2786/4616 (60.36%), Postives = 3500/4616 (75.82%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTS-IGPVSAH---KKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQ-NLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCK-HFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL----------------------------KMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSS-------SNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDN--------------------KLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA--LPVPICKD-DDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE--VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH ++F  +A   DL+  +VEDALL   +    ++ F+    + LMFYYQDV   +     S+  + P S      K+F+  G    L G C  FIRS   KA+T  NI  +++F  LD + G LL+++ R +S I  P L+ +   WG +      +S   EF   L+ F+  L  AQ ++  ++ L+  D  +L +  E   Y  +A N  ET+EK+E  +  WIKQ+EQ+L+E+ Q+R+EADDVGP AEL +WK R+SRFN LL+Q+K+  V   + +L  AKS+ L+ WR+ D RITDAANEAKDNVKYLYTL+K   PL   +PV MI+ IP+LINAI+M++SIS YYN+SE++TSLFVKVTNQMI+ CK H    G + IW   +E + ++I+   +L + Y+ CF +TK+KL+++ +EKQF+FSE YIFGKFE F +RL KI ++    ++YS+LQ  KIEG++ +  +Y+ I   IKKK Y+ LD R+ +FD DY++F  +   L   +Q F+D  FEK     + L+ LKKFE+++   L  ++K+  + QNF+  +D + KLY K K DPPL RN PPIAGKI W+R LF ++E PM LF++  P +L+  EA  ++++YN++AKVLLEFE++Y+  W + IE    GL +SLL++ P       +  VNFD  IL L +E + +  L L +   A+ L    ++ K  +  MK +L EY  +   +PP +  +M PH+ R+DE   PGL  LTWTS+ I  Y+E     ++   LL+ +V+D+++ RI A+L++M+  ALC LP+D+P+T EEFL MT+      ++ L  +S LVE AVN++I++L                            +   +E+   + NA      L    +K +  E        +L++F  +NT+ L+K TR TL+ I+RR+  S       SN  S    N      +F+A + L IPNI   P L++IQ  LNKAV+ I+ + + + QW+   L  +++ E +  A +NN+D+                     LP P   ++  K ISD+K++ K VS LS ++++ K +V T +  F  Y+ +W++E +  +  F+   P+L E  ++I YF  +E EI++ P   +VG++  Y+  LK  L +E  +W     +  N K   EM++IL + +   K+LSRP+KDLDD+R  MAAL E+RE +I  +  + PIEE+Y +L+KY +       ++VD+L Y + KL  +A  VQ+ L  +QP F+ ELI  V+ F ++   F  DYD  GPMA G+ P+EAS RL I+Q +FD ++RKY TY+GGEELFGL VT YP +  I+++LNLLQK+Y LYNNV++TVNSY D  WS++NI+ IN +LL+FQN+CRKLP+ALK+WQA+ DL+KTIDDF+E CPLLE M+ NAM+ RHW+RI  +TGH  +V ++ F LRN+MEAPLL  KEEIEDICISAVKE+DIE KL+ V N+W  ++ +FS FK+RGELLL+GD+T E+++ MEDSLM LG+LLSNRYN PFK +IQ+WVQ L+ +T+IIENW+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHEIPNVVQCC+GD+T+ QLLPHLL+QLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F +K+YD+IL+I+S+E E ++LD+P+ A+GNVE+WL  LL+ S+ SLH VIR A+  I +  F+L EF +SFP+QVGLLGIQM+WTRDSEEAL  +K DKKIMQ TNQ FL++LN LI +TT++L+ +ER K+ETLITIHVHQRDIFDDL  + + +P DFEWLKQ RFYFKED+D+ ++ ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQIS++LTCKKE K  FIFTDGD V M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGF+ N VL++KF+TLY+LCEEQLSKQVHYDFGLRNILSVLRTLGA KR +P D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP + +    YP++  AI KQ+E+A LINH PW+LK+IQLFETQRVRHGMMTLGPSG+GKT CI+ LM+AMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+LDW PIL  +L      +A    +   +   F + YR+  Q L  KM  LE   I Q+  +L GL+   +   E+   HL +L VF+MMWS+GA+LELE R +++ ++  ++   L +P   D  DT+F+Y V   G W HW+   PEY+YP D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KG+  K++PE  + K+LNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KM +FIDD+NMPVINEWGDQ+TNEIVRQ+ME +G Y+LEKPG+FT+IVDIQ +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPS+AS+DKIF ++G GY+C +RGF  +VQ  +  LV  TR+LWQ TK+KMLPTPAKFHYVFNLRDLSRIWQGML + S+VI    +L+ LWKHEC RVI DRF+  +D  WF+K +    EEE G E   V     + YFVDFL+DAPEATGE  EE + E PK+YEPI S   L +RL  ++  YNE++RG  +D+VFF DAM HLVKISRVIRT +G+ALLVGVGGSGKQSLTRLASFI+GY +FQITLT         SYN SNLMEDLK+LYRT+GQ GKGITF+FTDNEIK+ESFLE++NN+LSSGE++NLFARDE+DEI  +L  +MKKE+PRRPP+N+NL EY+MSRV   LH+VLCFSPVGEKFRNR+L+FP LISGCTIDWF RWPKDAL+AVS +FLS++ I  T E+KK +V  MG FQD VAE C +YFQRFRR THVTPKSYLSFI GYK +Y +K  E+ +LA RMNTGL+KL EA+ESV  LSKELA KEKEL+VA +KA  VL +V +KA AA+KVK +VQ VKD+A+A+V++IS+DKAIAEEKLEAAKPAL+EAE AL+TIKP  IATV+ LGRPPHLIMRIMDCVL+LF++R+++V  D ++ C  P+W E++KLM+  NFL +L  FPKDTIN+EV++ + PYF M D+N+ +AK V G+VAGLCSWTKAMASFFSINKEVLPLKANL VQ+++   AM++L  AQ  LDAKQ ELD+VQAEY +AM EKQ L +DA+ CR KM  A  LI GLAGE+ERWTE SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FR++L   WK E+    IPF + +    ML D  TISEWN+QGLPND+LS+QNG+IVT+A RYPLLIDPQ QGK WI+NKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLEKNFIK+GSTFKVKVGDKEVDVM GF+LY+TTKLPNP+YTPE+ A+TSIIDFTVT+KGLEDQLLG VILTEKQELE ERT L+E+V  NKR+ KELEDNLLYRLTST+GSLVEDESLI VL  TK+TAE+V QKL I  +TEI+INSAREEYRPVATRGSILYFLI EM +VNEMYQTSL+QFLGLFD S+A S KSPITSKRI NIIE++TYEVF+Y ARG YE  KF FT+LLT+KI ++   +KHEEF   IKGGA+LDL A  PKP KWI D+TWLNLVELSKL  F  I +Q+++N+K W+ WFD + PEE  +P+ YD +L+ F++LLLIRSWCPDRT+  A+KYI ++MG  +AEGVI +LE+  EE D  TP+IC LSMGSDPTD+I  L K+  ++   +SMGQGQEVHARKLL  +M  G W+LLQNCHLGL+F+DE ++++T TE +H++FR W+TTE H +FPI +LQ+ IKF  +PP G+RAGLRRTY  ++QD LD++   QWKPML+ VAFLH+TVQERRKFGP+GWNIPYEFNQ+DF +TVQF+QNHLDDMD+K+GVSW TV YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MF P F+FY+GY IP   ++D Y  +I  LP  DSPE FGLH NADI Y++  A  +L TI+ IQPKDS GG  ETRE+VV RLADDML++LPEDY+PFEVKE+LQKMG  +P+NIFL+QE+DRMQ+V+S+VRSTL +LKLA+DGTIIMSENL+DALD +FDARIP+ W K SW S+TLGFWFT+LL+RN QF SW+  GRP CFWMTGFFNPQGFLTAMRQEITR +KGWALD +VL N+VTKFMK+D++  P+EGVYV+GLYL+GAGW+ R+ KL E  PKVL+  +PV+ ++A   NN   D      R Y CP+YKKP RTDLNYI  ++LKT +AP+HW+LRGVALLCD+K
Sbjct:   33 LDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERMDQLFAVGGLRHLMFYYQDVEGAEAGHCGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITPENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIRQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIIELKSLKEPTDYLALASNP-ETVEKVECCMRVWIKQMEQILAENSQLRKEADDVGPRAELEHWKQRLSRFNYLLDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMIDAIPTLINAIKMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQGYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIEGLEDMATKYQDIVAAIKKKEYNFLDQREMDFDQDYEEFCKRINELHNDLQRFMDITFEKIPSTRQALSTLKKFERLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQQ-HPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGT----GELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRVNDLIEFRIHAILEEMSSMALCQLPQDDPLTCEEFLQMTKDLCVSGAQLLHFKSSLVEEAVNELINMLLDVDVPPEEAAENVCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEAR-ELLSHFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSNDASKAKQN---HLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHERKMAAVKNNEDSDSDAEVEENELQETLEIASINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTFIAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEA--EILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQAGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTR--------SYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA--ENNTARDP-----RLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDVK 4621          
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q91XQ0|DYH8_MOUSE (Dynein heavy chain 8, axonemal OS=Mus musculus OX=10090 GN=Dnah8 PE=1 SV=2)

HSP 1 Score: 5335.77 bits (13840), Expect = 0.000e+0
Identity = 2706/4598 (58.85%), Postives = 3447/4598 (74.97%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDY--SRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPM-ILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDII----DILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLN---------------YFTQRNTETLIKCTRLTLDTIKRRL--QSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGS-----------------VKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTS-HLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            + P H +IF+ + +   LDL  VE+ +L       F  FF     K L F YQ+  V  +   RT  T +       ++++   + + LKGLC  F+R   D A+ S  I  D+ F  LDAS G LL+ ++  +  I  P +     WG+++      S+   F E + R+L +L  A  +++  + L+  D+ D  +K+        A +SSE + +LE +L  W KQIEQVL ESEQ+R+EADD GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD+ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIHS+S+YYN+SERMTSLF+KVTNQM+T CK ++ +G  + +WD     + K+I  C  L +EY+  FHKT+K++ E S EK FE SE YIFGKFEAFCKRL+KI  +  I+++YS L    IEGID + +++K+I   IKK  YDILD R++EFD D+ +FM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   L+  +KLY   K DPPL RN+PPIAGKI W R LF++I  P+   FK +  +IL   E   +++ YN++A VL+EFE+ Y+  WFK +   +  L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A  L+  E+ +K     ++ +L  Y ++   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KKV+D+ ++ I+ VL ++A T L  L +     +E+ L++ E   +E ++ L  +S+ VE AV ++I     I ++  T    K++  +        + ++   L+ +        N               +F+ +  ++L K TRL+LDT+KRR+   S   + S D +      +  K ++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W       +Q+++++     +   ++ P  G                  +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++ +E EI    P   VG++  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ  L+++QPKFK  L+E VK F E+VI+F   Y++ GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +L +FQN+CRKLP+ALK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD F LRN+MEAPLL NK++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYN PFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD++ A+ S+E E + LD P+ A+G VEIWL DLLK+   SLH++IRSA   I+DS F L  F   FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +LTK +R KFETLITIHVHQRDIFDDLV + I +  DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE   VMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++ +A+D Q+    LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+++T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP  K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL      +A  +  L+ +  +F +AY Y+  +L+PKM  LECNYI Q+++LL GL+   +   + +  HL KL VF +MWSLGALLEL+ R KL+ F+  H   L +P I K    T++E+ V D G+WEHW  R+  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKRMG+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSN SIDKIF I+GCGYF   R F+P++   V NLV+ +R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML V ++  +S   L+SL+KHEC RVI DRF    D+ WF   L    EE    EV A +  EPYFVDFL+D PE TG+E E+T  E PKIYE + S+E LS++L  Y  Q+NE +RG  LDLVFFKDAMTHLVKISR+IRT+ G+ALLVGVGGSGKQSL++LASFI+GY+ FQITLT         SYNVSNL+EDLK LY+ +G  GKGITF+FTDNEIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY+++R  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWPK+ALIAV++YFL  + IV + E K+ VV TMG+F D+V+E+C NYFQR+RR  HVTPKSYLSFI+GYK +Y  K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ KVK +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+PC KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AM  F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGDVL+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  I+ML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+ FKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELE+ER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR+TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH+EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK WFD DAPEE  IPDGY D+L+T +KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D +TP+ICFLSMGSDPT  I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+G W+LLQNCHLGL FM+E LE++  TE   +SFR W+TTE H +FPI +LQ  IKFT +PP G+RAGL+RT+A + QD LDI+N   WKPML+ VAFLH+TVQERRKFGP+GWNIPYEFN +DF+++VQF+QNHLD+ D+K+GVSW TV YMIGEVQYGGRVTDD+DKRLLN +A+ WFS +MF P F FY GY IP  K+LD+Y  FI  LP +D+PE FGLH NADI Y+++ A+ +L TI NIQPK+SGGG GETRE++VYRL++DML +LP +Y P EVK +L KMG L  +NIFL+QE+DRMQKVISI+RS+L DLKLAI+GTIIMSENL+DALDN++DARIP  W ++SW+S+TLGFWFT+LL+RN QF +W++EGRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD V + N+V +  KE++   P+EGVY++GLY+DGA W+ R+ KL E  PKVL+T LPV+H++A++   P       + + Y CP+YKKPRRTDL +I  + L+T  +PDHWILRGVALLCDIK
Sbjct:  170 IGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEVPGFECGRT-ITGVPKGGKMMRIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKG-LLEGIKHMLKSIFLPAILATSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDF-SKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYFFKNS--DILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIFEQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTTMEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQ-----QQVRQIKSFQNNSRGSDQPPASGKPLKKEERSFEETIPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEA--SVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVSSGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGSKLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTR--------SYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAP------KDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|Q96JB1|DYH8_HUMAN (Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2)

HSP 1 Score: 5316.9 bits (13791), Expect = 0.000e+0
Identity = 2688/4528 (59.36%), Postives = 3428/4528 (75.71%), Query Frame = 1
Query:  544 KLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEG-VSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQID--CLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPM-ILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL----------KMNLTESELKNL--NAEDG------YECL---------QPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS---NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLH---------------HKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIK-TSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVP-ICK-DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            KL+I   + + LKGLC  F+R   D A+    I  +  F +LDAS G LL+ +   ++ I  P +     WG+++      S+   F E ++R+L+ L  A+ +++  ++L+  D+ +  +K+        A ++SET+ +LE +L  W KQIEQVL ESEQ+R+EA D GP  EL +WK   ++FN ++EQ+K      VI +L+ A S+ L+ WR+LD+RITD ANE+KDNV+YLYTL+K   PL   + V M   I +LINAIRMIH +S+YYN+SERMTSLF+KVTNQM+T CK ++ +G ++ +WD     + K+I  C  L +EY+  FHKT+K + E S EK FE SE YIFGKFEAFCKRL+KI  +  ++++YS L    IEGID + +++++I   +KKK YDILD R++EFD D+ DFM +   LE QIQAF+++ F K +   + L LL++F++++  CL L+      ++LQ +   LD  +KLY   K DPPL RN+PPIAGKI W R L+++I  P+   FK +  +IL  P+   +++ YNK++ VL+EFE++Y+  W + I      L ++L +R+P+      K LVNFD  ILE+++E K +  + LD+PE A RL+  E+ +K     ++ +L  Y E+   VP V   +M P + +++     GL  LTW+S+ +  + ++V   L  F  L+KK+SD+ ++ I+ VL ++A T L  LPE     +E+ L++ E   +E ++ L  +SK VE AV ++I I           K+     + K++   +E G      YE           + D  K  C E        +  +F+ +  ++L K TRL+LDT+KRR+  +S    K S D +      +  K+++ L IPN++  P+LD+IQ  +N+ +Q  L++S  +  W    +                H+   +L K  EE + +  +P    +K+    +++HKD++K V  LS  +N+ +      L +F  Y TLW E+   KVKEF+   P L+EI ++I +++  E EI    P   VGA+  ++EP+K  L  E  +WK    + LN +  ++M  ++   +   K+LSRP++DLDDVR  M ALS +R++EI+++MT+ PIEEAY +L+++E+      SE VD+L Y ++KL+++A +VQ+ L+++QPKFK  L+E V+ F+E+VI+F   Y+  GPM   I P+EAS+RL I+Q  FD+LWRK+ TYS GE+LFGL VTDY  + + RKELNLLQKLY LY+ V+ +++ YY+I W +++I+ IN +LL+FQN+CRKLPK LK+WQA+ DL+K IDDF+E+CPLLE M++ AM  RHW+RI  +TG  F+V+SD+F LRN+MEAPLL +K++IEDICISA+KEKDIEAKL  V  +W+ Q+ SF++FK +GELLLKG  +GEI++LMEDSLM LG+LLSNRYNAPFK  IQ WV KL+ +++IIE WL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF NIDKSW KIMQRAHE PNV+ CC+GD+T+ QLLPHL EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQ HL +V DN   VTF  K YD+I+A+ S+E E + LD  + A+G VEIWL DLLKM   SLH++IRSA   I+DS F+L  F + FP+QVGLLGIQM+WT DSEEAL  +K D+KIMQ TNQ+FLDILN LI+ TT +L+K +R KFETLITIHVHQRDIFDDLV + I +P DFEWLKQSRFYFKED DQ +VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITL+QALGM++GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT +KERK QFIF+DGD VD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGFL+N +L++KFY LYKLCEEQL+KQVHYDFGLRNILSVLRTLG+ KR  P+DSE  IVMR LRDMNLSKLVDEDE LFLSLI DLFP +++ + TY ++  A+  Q++   LINH PW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LM+A T+CG PH+EMRMNPKAITAPQMFGRLD ATNDWTDGIFSTLWR+T K KKGE+I+LILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAP+ K++FEVHNI+NASPATVSR GMVY+SSS L W+PIL++WL   + T   +   L  ++ +F + Y Y+   L+PKM  LECNYI Q+++LL GL+   +   +    HL KL VF +MWSLGALLELE R KL+ F+  H+  L +P I K  + T++E+ V D G+WEHW  ++  Y YP D IPEY SILVPNVDN RT+FLI+TI+KQ+KAVLL GEQGTAKTV+VK Y  KY+PE Q+ KSLNFSSAT P MFQRT+ESYVDKR+G+T+GPPGGRKMT+FIDDINMPVINEWGDQITNEIVRQMMEM G+YSL+KPGDFTTIVD+Q+IAAMIHPGGGRNDIPQRLKRQF++FNCTLPSNASIDKIF I+GCGYF   R FKP +   + NLV+  R LWQ TK+KMLPTP+KFHY+FNLRDLSRIWQGML + ++   S   L+SL+KHEC RVI DRF    D+ WF   L    EE  GS+  + +  EPYFVDFL++ PE TG+E E++  E PKIYE + S++ L+++L  Y  Q+NE +RG  LDLVFFKDAMTHL+KISR+IRT+ G+ALLVGVGGSGKQSL+RLASFI+GY+ FQITLT         SYNV+NL +DLK LY+ +G  GKGITF+FTD+EIKDE+FLE+LNN+LSSGEI+NLFARDEMDEI Q L+SVMK+E PR PP+ +NL EY++SR  K LHVVLCFSPVGEKFR RSL+FPGLISGCT+DWF RWP++ALIAV++YFLS + IV + E+K+ VV TMG+F D+V+E+C +YFQR+RR  HVTPKSYLSFI+GYK +Y +K + I   A RMN GL KL+EA+ESV +LS++LAVKEKEL VA  KA EVLA+V V A A+ K+K +VQ VKD+A+ +V+ I  +K  AE KLEAAKPAL+EAE AL TIKP  IATV+KL +PPHLIMRIMDCVL+LF+K++D VT DPE+ C KP+W E++KLMS + FL SL  FPKDTIN+E V+L++PYFNM+D+   SAK V G+VAGL SWT AMA F+ IN+EVLPLKANLA Q+ +L  A  EL  AQ +LD KQ ELD VQA+++ AM+EK  L +DA+ CR+KM  A  LI GL+GE+ RWT+ SK F  QI +LVGD+L+ T FLSY GPFNQ FRN +L+  W+ EL    IPFT+++  ISML D  TI EW +QGLP D+LS+QNG+IVT+A RYPLLIDPQ QGK+WI++KEK ++LQVT+LNHKYFR HLED+LSLGRPLLIED+ EE+DPALDNVLEKNFIKSG+TFKVKVGDKE D+M  F+LY+TTKLPNP++TPE+ AKTS+IDFTVT+KGLE+QLL  VILTEKQELEAER KL+E+V  NKRK KELEDNLLY+L++T+GSLV+DESLI VLR TK+TA +V +KL +  +TEIKIN+A+EE+RP ATRGSILYFLI EMSMVN MYQTSL QFL LFD+SMA S+KSP+  KRI NIIEYLTYEVF Y+ RG YE+ KF F +L+T+KI ++ G +KH EFQ  IKGGAALDL A  PKP +WI D+TWLNLVELSKLP F +I  Q+++N+KGWK+WFD DAPEE  IPDGY D+L+T  KLLLIRSWCPDRTV  A+KYI +++  ++ E VI NLE+  EE D  TP+ICFLSMGSDPT+ I+ LAKK  L+C +ISMGQGQEVHARKL+ +SMQ+G W+LLQNCHLGL FM+E LE + TTE   +SFR W+TTE H +FPI +LQ  +KFT +PP G+RAGL+RT+A + QD LDI+N   WKPML+ VAFLH+TVQERRKFGP+GWNIPYEFN +DF+++VQF+QNHLD+ D+K+GVSW TV YMIGEVQYGGRVTDD+DKRLLN +A+ WFS +MF P F FY GY IP  K+LD+Y  +I  LP +D+PE FGLH NADI Y+++ A+ +L TI NIQPK+SGGG GETRE++VYRL++DML +LP DY P EVK +L KMG L  +NIFL+QE+DRMQ+VISI+RS+L DLKLAI+GTIIMSENL+DALDN++DARIP  W ++SW+S+TLGFWFT+LL+RN QF +W++EGRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD V + N+V +  KE++ + P EGVY++GLY+DGA W+ R+ KL E  PKVL+T LPV+H++A++   P       + + Y CP+YKKPRRTDL +I  + L+T  +PDHWILRGVALLCDIK
Sbjct:    3 KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKG-LLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNF-SKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNS--DILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPET----GKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETGEGENNDYEANIVNEFDTHDKEDEFKKECKE--------VFAFFSHQLLDSLQKATRLSLDTMKRRIFVASLYGRKQSEDII------SFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQIRPIKSVIPSPTTTDVTHQNTGKLLK-KEERSFEEAIPA-RKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWL--KKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTR--------SYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAP------KDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4490          
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Match: sp|M0R8U1|DYH5_RAT (Dynein heavy chain 5, axonemal (Fragment) OS=Rattus norvegicus OX=10116 GN=Dnah5 PE=1 SV=1)

HSP 1 Score: 3834.65 bits (9943), Expect = 0.000e+0
Identity = 1994/3455 (57.71%), Postives = 2554/3455 (73.92%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTS-IGPVSAH---KKLFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQ-NLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCK-HFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL--KMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYA-------------------------MLNYFTQRNTETLIKCTRLTLDTIKRRLQSSS-----NKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDN--------------------KLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA--LPVPICKD-DDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE--VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQ 10488
            +D RH ++F  +A   DL+  +VEDALL   +    ++ F+    + LMFYYQDV   +  +  S+  + P S      K+F+  G    L G C  F R+   KA+T+ NI  +++F  LD + G LL+++ R +S I  P L+ +   WG +      +S   EF   L+ F+  L  AQ ++  ++ L+  D  +L +  E   Y  +A N  ET+EK+E  +  WIKQ+EQ+L+E+ Q+R+EADDVGP AEL +WK R+S+FN LL+Q+K+  V  V+ +L  AKS+ L+ WR+ D R+TDAANEAKDNVKYLYTL+K   PL   +PV M++ IP+LINAI+MI+SIS YYN+SER+TSLFVKVTNQMI+ CK H    G + IW   ++ + ++I+   +L + Y+ CF +TK+KL+++ +EKQF+FSE YIFGKFE F +RL KI ++    ++YS+LQ  KIEG++ +V +Y+ +   IKKK Y+ LD RK +FD DY +F  Q   L  ++Q F+DT FEK     + L+ LKKFE+++   L  + K+  V QNF   +D + KLY K K DPPL R+ PPIAGKI W+R LF ++E PM LF++  P +L+  EA  ++++YN++AKVLLEFE++Y+  W + IE   +GL +SLL++ P       +  VNFD  IL L +E + +  + L +   A+ L    ++ K  +  MK +L EY  +   +PP +  +M PH+ R+DE   PGL  LTWTS+ I  Y+E   E ++   LL+ +++D+++ RI A+L++M+  ALC LP+D+P+T EEFL MT+      ++ L  +S LVE AVN++I++L     L E   + +  E+             C E     + A                         +L+YF  +NT+ L+K TR TL+ I+RR+  S      +      + ++  P +F+A + L IPNI   P L++IQ  LNKAV+ I+ + + + QW+   L  ++++E +  A ++N+D+                     LP P   ++  K ISD+K++ K VS LS ++++ K +V T +  F  Y+ +W++E +  +  F+   P+LSE  ++I YF  +E EI++ P    VG++  Y+  LK  L +E  +W     +  N K   EM++I  + +   K+L+RP+KDLDD+R  MAAL E+RE +I  +  + PIEE+Y +L+KY +       ++VD+L Y + KL  +A  VQ+ L  +QP F+ ELI  V+ F ++   F  DYD  GPM  G+ P+EASDRL I+Q +FD ++RKY TY+GGEELFGL VT YP +  I+K+LNLLQK+Y LYNNV++TVNSY D  WSE+NI+ IN +LL+FQN+CRKLP+ALK+WQA+ D++KTIDDF+E CPLLE M+ NAM+ RHW+RI T+TGH  +V ++ F LRN+ME PLL  KEEIEDICISAVKE+DIE KLK V N+W  ++ +FSSFK+RGELLL+GD+T E+++ MEDSLM LG+LLSNRYN PFK +IQ WVQ L+ +T+IIENW+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHEIPNVVQCC+GD+T+ QLLPHLL+QLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F +K+YD+IL+I+S+E E ++LD+P+ A+GNVE+WL  LL+ S+ SLH VIR A+  I +S F+L EF +SFP+QVGLLGIQM+WTRDSEEAL  +K DKKIMQ TNQ FL++LN LI +TT++L+ +ER K+ETLITIHVHQRDIFDDL  + + +P DFEWLKQ RFYFKED+D+ ++ ITDV F YQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQIS++LTCKKE K  FIFTDGD V M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGF+ N VL++KF+TLY+LCEEQLSKQVHYDFGLRNILSVLRTLGA KR +  D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP + +    YP++  AI KQ+E+A LINH PW+LK+IQLFETQRVRHGMMTLGPSG+GKT CI+ LM+AMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+LDW PIL  +L      +A    +   +   F + YR+  Q L  KM  LE   I Q+  +L GL+   +   ++   HL +L VF+MMWS+GA+LELE R +++ ++  ++   L +P   D  DT+F+Y V   G W HW+  +PEY+YP D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KG+  K++PE    K+LNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KM +FIDD+NMPVINEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT+IVDIQ +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPS+AS+DKIF ++G GY+C +RGF  +VQ  V  LV  TR+LWQ TK+KMLPTPAKFHYVFNLRDLSRIWQGML + S+VI    +L+ LWKHEC RVI DRF+  +D  WF+K +    EEE G E   V     + YFVDFL+DAPEATGE  EET+ E PK+YEPI S   L +RL  ++  YNE++RG  +D+VFF+DAM HLVKISRVIRT +G+ALLVGVGGSGKQSLTRLASFI+GY +FQITLT         SYN SNLMEDLK+LYRT+GQ GKGITF+FTDNEIK+ESFLE++NN+LSSGE++NLFARDE+DEI  +L S+MKKE+P+RPP+N+NL EY+MSRV   LH+VLCFSPVGEKFRNR+L+FP LISGCTIDWF RWPKDAL+AVS +FLS++ I  T E+KK +V  MG FQD VAE C +YFQRFRR THVTPKSYLSFI GYK +Y +K  E+ +LA RMNTGL+KL EA+ESV  LS+ELAVKEKEL+VA +KA  VL +V +KA AA+KVK +VQ VKD+A+A+V++IS+DKAIAEEKLEAAKPAL+EAE AL+TIKP  IATV+ LGRPPHLIMRIMDCVL+LF +R+++V  D ++ C  P+W E++KLM+  NFL +L  FPKDTIN+EV++ + PYF M D+N+ +AK V G+VAGLCSWTKAMASFFSINKEVLPLKANL VQ+++   AM++L  AQ  LD KQ ELD+VQAEY +AM EKQ
Sbjct:   33 LDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERIDQLFAVGGLRHLMFYYQDVEGAEAGQFGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFTRADPSKAITAENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIQQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIVELKSLKEPMDYLALASNP-ETVEKVECCMRVWIKQMEQILAENNQLRKEADDVGPRAELEHWKKRLSKFNYLLDQLKSPDVKAVLAMLAAAKSKLLKVWRDADIRVTDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMVDAIPTLINAIKMIYSISHYYNTSERITSLFVKVTNQMISACKAHITNNGTATIWSQPQDIVMQKIAAAIKLKQGYQCCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHQRLAKIMDIFTTFKTYSVLQDSKIEGLEDMVTKYQDVVAGIKKKEYNFLDQRKMDFDQDYDEFCKQTNELHSELQRFMDTTFEKIQSTRQALSTLKKFERLNIPNLGIEAKYQIVFQNFGTDIDMISKLYTKQKYDPPLARDQPPIAGKILWARQLFHRLEQPMQLFQQ-HPFVLRTVEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHVGLEASLLVKAPGT----GQLFVNFDPQILILFRETQCMSQMGLPVSPFAAALFEKRDMYKKNFSDMKMMLSEYQRVKLKMPPAIEQLMLPHLARVDEALQPGLAVLTWTSLNIGTYLENAFEKIKDLELLLDRINDLIEFRIHAILEEMSSVALCQLPQDDPLTCEEFLQMTKDLCVNGAQKLHFKSSLVEEAVNELINMLLDVDVLPEEASEKVRHENASPNGDTSGGGEGCAEALASSFNAGTSSLPLTTIARKKKEMEVLEEARELLSYFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSKGASKVKQNHLP-IFRASVTLAIPNISMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMRERKMAAVQSNEDSDSDTEVEESELQETLELASVNLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKCYNHIWQKEKEDTIMTFIAQNPLLSEFESRILYFQSLEQEINAEPEYICVGSIALYTADLKFSLTAETKAWMMVLGRHCNRKYRSEMENIFTVVEEFQKKLNRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMVSGLKPQEASDRLIIFQNQFDNIYRKYITYTGGEELFGLPVTQYPQLLEIKKQLNLLQKIYSLYNNVIETVNSYQDTLWSEVNIEKINSELLEFQNRCRKLPRALKDWQAFLDMKKTIDDFSECCPLLEYMASNAMVERHWQRITTLTGHSLDVGNETFKLRNIMEVPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTLTFSSFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQNWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQESGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALQNAKFDKKIMQKTNQSFLELLNMLIEMTTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFTYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASHTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTSCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEA--EILRQLYAETFPDLYRFSIQNLEFKMEILEAFVITQSTHMLQGLIPTKEQAGDVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTDPGDTMFDYYVAPDGTWRHWSMCIPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHTVKNLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGEGYYCAQRGFSKEVQDAVIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEEKTPVVDCGVDAYFVDFLRDAPEATGETPEETDAEMPKLYEPIASLNHLQERLSVFLQLYNESIRGTGMDMVFFRDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTR--------SYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTSIMKKEHPKRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYNIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHVEVQSLANRMNTGLEKLKEASESVAALSQELAVKEKELQVANEKADMVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFHRRVNAVKIDLDKSCTVPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHALAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQ 3470          
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A267GIL0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012039g4 PE=4 SV=1)

HSP 1 Score: 6548.76 bits (16989), Expect = 0.000e+0
Identity = 3232/4635 (69.73%), Postives = 3853/4635 (83.13%), Query Frame = 1
Query:  109 TDLTDIAPPLVSKEPNESNMAHVDNKTKPIQTNVRAQVVTKSVPKKIITG-ESXXXXXXXXXXXXXXXXXXVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDP--KKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQ-------------ELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGM-DIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSG-GGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
             D  ++APPLVSKE  +      D +T+P      A+    +V K  +T  E  ++Q   LK+ K+ RR  +D RH F+F+ +A+   ++ +QVE+ +L D+K+G F+ FF  + SK + FYYQ+       ++    I   +  KKL I  G   PL GL F+F R+T KA+T NN A +I +  +DAS GRLL+A+E +I  I++P L++LE+WGS++ +  + +KI EF + + RFL+ L +A+ NM  QMQL    DE L  K++ P     AV+SSE MEKLE LL +W K+IEQVL+ESEQIRREADDVGPSAEL YWKSRM+RFNNLLEQM  K+V  V+ +LH AKSR+L+ WR+LD RITDAANEA+DNVKYLYTLDKFFGPLSKCNPV M EHIP+LINAIRMI++ISQYYN+SERMT+LFVKVTNQMITTCK ++ EG +KIWD  RE L +R+ HC  LN  Y+  F K ++ L+++  EKQFEFSENYIFGKF+ FC+RL KI ++  +++S S LQ  K EGI+ ++VRY++I++ I+KKTYDILDHRK++FDNDY++F      LE  + A++D  F++ M   +QL +L +FE+I+ ++ D  +K+ ++LQ+++K L+NVR+LYQ+YK DPP+ RNLPPI+GKI+WSRHL  KIE PM++FK  + EIL++PEA K+V+NYNKMA+VLL FEL+Y+  W  T++ F +GL SSLL+RN        + LVN D +++ELI EA +++ L L++P+   R++  E  IKD YR ++E++ E+  I D++P  +  +M+P    I+E   PGL  L+W S ++ DY+E  R  +  F++L+K++SD+++ R+EAVL++M++TAL DLPE+EP+T EEF+SMTE    +A+E+L K+S+LVE +VN+ ++ +   L E+  K +  +D ++C       K+ RC ECQ C+ +A L+Y+T RNT+ LI+CTRL+LDTI+RR   S+    +    E+K+PALFK+D+VL +PNI T+P L+EIQ   NKAV+ +LKMS +I QW H  L  KQ+Q             +++++ +E  ++ KLPG   +K LNK+I+DHKDVAK +SQ+S ++++ K   +    EF  +  LW EE   KVKEFM  KPILSEI+A  K   DME E+ + P +Y+VGA+++ +E LK  LI EC +W+ AY +ELN +CA++MD ILE FD + K+L+RPV+DLDDVR+HMAAL+++RE+EI+I+M I PIEE Y +L KY+I FNDGN+ERVDSL Y  S L+ QA+ VQDHLL IQP+FK +L++GV  F++++  FV +YD +GP    I PREASDR+ ++Q +FD+LWRK+ TYSGGE+LFGL VTDYPD+QRI+K+LNL+QKLY LYN VL+TVN YYDIAW++I+I+ INQQL +FQN+CRKLPKALKEWQA++DLRKTIDDF+E+CPLLE MS+ AMM RHWER+E +T HKF+V+SDNFLLRNLMEAPLL NK++IEDICISA KEKDIEAKLK V +DWSAQS  FS+FKSRGELLLKGD+  E V+LMEDSLM LG+LLSNRYNAPFKPKIQEWV KL+G+TEIIENWL VQNLWIYLEAVFVGGDIAKQLP EAKRF NIDKSWQ+IMQRAHEIPNVVQCCMGD+TLSQLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQ+HLLS+FDNTK+VTFDEKVYDKIL+I+SQE E VQL+ P+ AQGNVE WLGDLL++SR S+H VIR + +T+ D  F L EFE S+P+QVGLLG+QM+WTRD+EEAL Q+K DKKIM  TN+ FL+ILNELI VTT+ LTK+ERTKFETLITIHVHQ+DIFDDLV   + +P DFEWLKQSRFYFKEDTDQC+VSITDVDF Y NEFLGCTDRLVITPLTDRCYIT++QALGM+LGGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI++VL CKKERK+QFIFTDGD+VDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDR II+RVKLASCGFLQN +L+KKF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKR NP DSEP IVMRVLRDMNLSKLVDEDE LF+SLI+DLFP M++  K YP+I AAI  Q+ +  LI+H PW LK IQLFETQRVRHG+MTLGPSGAGKTKCI  LMRAMT+CGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHK KKG+H+WLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FEVHNIDNASPATVSRNGM++MSSS+LDW+PIL+ WLL     D+   TI +TF+  ++EA  YV Q+L+PKM  L+CNY+RQA +LL GL+    +++++  SHL+KLIVF++MWSLGALLEL+DR +LQE + +  ++P+P  K +DTIFEY+VN+ GEW+HW  RV EY YP D  PEY  ILVPNVDNTRTDFLINTISKQ K VLLIGEQGTAKTVIVKGYCGKY+PE  +FKSLNFSSATTPNMFQRT+ESYVDKRMG+TFGPP G+KMT+FIDDINMP+INEWGDQITNEI RQMMEM G Y+LEKPG+FT+IVDIQIIAAMIHPGGGRNDIPQRLKRQF +FNCTLPSNASIDKIFR +G G++C ERGF  +V+  V+ LV ATR+LWQ+TKI+MLPTPAKFHYVFNLRDLSRIWQGML   S+V N  S LMSLWKHEC R I DRFTEQ DKDWFEKT+K+T EEEC  E+   +Q EPYFVDFL++APE TG+E ++ +L APKIYEPI+SYEQL+D+L  YM+QYNE VRGGKLDLVFFKDAM HLVKISR+IRTTKGHALLVGVGGSGKQSLTRLASFI+GY+TFQITLT         SYNVSNL+EDLK+LYRT+G  GKG+TF+FTDNEIK+E FLEFLNNMLSSGEIANLFARDEMDEIL ELV VMKKE+PRRPPSNENLQ+YYM+RVLKYLHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWFQRWPKDAL++VS YFLS F+IV TP+VK+AVVN MG FQDLVAE C +YFQRFRR THVTPKSYLSFISGYKE+Y  K+ E+  LA RMNTGLKKL+EATESVNELSKEL  KEKEL VA KKA EVL  V VKA+AAQKVK QVQVVKDRA+ALV+ I  DKA+AE KLEAAKPAL+EAE AL+TIKP  I+TVKKL +PPHLIMRIMDCVL+LF+K++D+VT DPERPC KP+W EA+KLMSG +FL +LLNFPKDTIN E V+ + PYF MED+N+ +AK VSG+VAGLCSWT AMA+FF INKEVLPLKANL VQ+ +LE AM ELN AQ +LD KQ+ELD+VQA Y+KAM EKQAL DDAEACRRKM+NA  LI GL+GER RWTEASK F+ QI++LVGDVL+ TAFLSY GPFNQDFRN+LQR+WK ELV N IP+T+D+  ISML DNATISEWN+QGLPNDELS QNGLIVTRA R+PLLIDPQGQGK+WI+NKEKN+ELQ+T+LNHKYFR HLED+LSLGRP++IEDVGEE+DPALDN+LE+NFIKSG+  KVKVGDKE DVM GF+LY+TTKLPNP YTPE++AKTS+IDFTVT+KGLEDQLLGVVI+TEK ELE ER KLME+V  NKRK +ELEDNLLYRLTSTEGSLVEDESLIEVLRVTK TAEDV++KL +  DTEIKIN+AREEYRP+ATRGS+LYFLIVEMSMVN MYQTSL+QFLGLFD SMA S KSPIT KRI NII+YLT+EVFRYTARG YE DKFTFTILLT+K+ M+SG +KH+EF IFIKGGAALDLNAVEPKPKKWIQDL WLNLVELSKL +F  +TEQ+ KNDK WKTW D DAPEE  IPDGYD   TF KLLL+RS  PDRT+PMAK+Y+ E MG ++A+GVITNLE M EE D  TPMICFLSMGSDPT+NIERLAKK+ ++ G+ISMGQGQEVHAR+LL  SM EGRW+LLQNCHLGLNFMDE L+ +TT E+ HE+FRCW+TTE H  FPIN+LQ  IKFTYDPP GIRAGLRRTY LLTQDQLD++N  QWKP+L+ VAF+HT VQERRKFGPIGWNIPYEFNQSDF++TVQFVQNHLDDMD+KRGVSW TV YMIGEVQYGGRVTDDYDKRLLNTYA+ WFS  MF   F F KGY IP  K +DEYRAF+D LPL+D+P+ FGLHANAD+ Y+T+NAN ML TI+NIQPKDSG GGAGETRES+VYR  DDML +LPEDYNPFEV++KL+KM  LKPL+IFLKQE+DRMQ+VIS VRSTL DLKLAIDGTIIMSENL+DALDN+FDARIP+ W K+SWESATLGFWFTDLLDRN QFH+WL++GRP  +WMTGFFNPQGFLTAMRQEITR HKGWALD+V L NDVTK  KE+V+N P+EGVYV+GL+LDGAGW+ R+A+L EP  KVLYT LPVVH+YA++   P       +   YECPVYKKP+RTDLNYIFPL L+T++ PDHWILRGVALLCD K
Sbjct:    2 ADKAEVAPPLVSKEQPK------DAQTQPAAKPAAAKSQPTAVKKPPLTSNEQARQQAIKLKELKETRRSQLDARHGFMFEKMAEALGVEQSQVEEWILVDKKFGYFDRFFDADGSKSMTFYYQE-------QSGKPDIANPTGAKKLIIGEGQDVPLLGLAFVFTRTTSKAITQNNYANEINYTTMDASEGRLLEAMESYIGSILYPALKHLEDWGSLTKESENRAKIEEFLDAIQRFLDILSSAKTNMKGQMQLSQPPDE-LTHKVQSPVDLQAAVHSSEMMEKLEKLLLQWAKEIEQVLNESEQIRREADDVGPSAELLYWKSRMTRFNNLLEQMNRKEVRTVVALLHNAKSRTLKVWRQLDCRITDAANEARDNVKYLYTLDKFFGPLSKCNPVTMQEHIPALINAIRMIYTISQYYNTSERMTTLFVKVTNQMITTCKAYIREGATKIWDHPREVLVERMQHCLALNRHYQATFRKVQEHLRQNPQEKQFEFSENYIFGKFDTFCRRLHKIMDMLQVVQSLSGLQDIKTEGIEQLIVRYRTISESIRKKTYDILDHRKTDFDNDYEEFKQNISLLETALYAYIDNMFKRPMSAVQQLGILVRFERIEGIQFDWSEKYTRILQSYAKELENVRRLYQRYKDDPPVARNLPPISGKIAWSRHLLHKIEKPMMIFKHKKKEILQLPEARKIVRNYNKMAEVLLAFELLYHQKWLNTVQQFHIGLNSSLLVRN----SHTGRLLVNLDPVVVELISEAHFMKRLGLEVPDQIVRIMSAEPQIKDIYRALEEMIAEFEGISDTIPTPIQTLMKPFRDHINEVLEPGLTQLSWISTQVRDYIESARNEVADFKILVKQLSDMIECRVEAVLEEMSLTALVDLPEEEPVTPEEFVSMTEAVCNDAAEFLYKQSQLVESSVNEAVETILERLPET--KKIARDDTWDCTDESARIKRQRCQECQHCLIFAFLSYYTNRNTDALIRCTRLSLDTIRRRAHHSAALRYLG-QGEEKKPALFKSDVVLQLPNITTQPTLEEIQHKFNKAVKIMLKMSMDIPQWKHQILTQKQLQRKLQEDSAKAEGKDVDRMTDEEIEELKLPGGSVIKPLNKIIADHKDVAKLMSQMSSLISSNKIDEKETFKEFYKFKQLWMEEINVKVKEFMDRKPILSEISAVFKANVDMEMELSALPQSYQVGAIIYSTEKLKDALIEECKAWRLAYGKELNERCAKDMDDILEWFDGVKKQLARPVQDLDDVRAHMAALTDVRENEIRIDMEIGPIEETYALLAKYDILFNDGNAERVDSLSYERSNLKEQARGVQDHLLAIQPEFKEDLLQGVTKFQQDLTVFVDEYDFKGPQEPNIPPREASDRVALFQGRFDDLWRKFETYSGGEQLFGLSVTDYPDLQRIKKDLNLMQKLYGLYNQVLETVNGYYDIAWTDIDIEAINQQLTEFQNRCRKLPKALKEWQAFEDLRKTIDDFSESCPLLELMSNKAMMARHWERLENLTKHKFDVESDNFLLRNLMEAPLLENKDDIEDICISATKEKDIEAKLKQVMSDWSAQSLYFSTFKSRGELLLKGDSISETVALMEDSLMVLGSLLSNRYNAPFKPKIQEWVSKLSGSTEIIENWLQVQNLWIYLEAVFVGGDIAKQLPAEAKRFSNIDKSWQRIMQRAHEIPNVVQCCMGDETLSQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQSHLLSIFDNTKSVTFDEKVYDKILSISSQEGETVQLETPVLAQGNVESWLGDLLRVSRASVHKVIRESFLTLQDPNFNLMEFEGSYPAQVGLLGLQMLWTRDAEEALVQAKLDKKIMPQTNEHFLNILNELINVTTKELTKMERTKFETLITIHVHQKDIFDDLVKSHVKSPGDFEWLKQSRFYFKEDTDQCLVSITDVDFNYMNEFLGCTDRLVITPLTDRCYITIAQALGMALGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLACKKERKSQFIFTDGDLVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRGIIMRVKLASCGFLQNVLLAKKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRANPQDSEPMIVMRVLRDMNLSKLVDEDEPLFMSLIDDLFPGMQLDKKGYPEIEAAILHQVNEHGLIHHAPWVLKCIQLFETQRVRHGIMTLGPSGAGKTKCIATLMRAMTECGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKTKKGDHVWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKILFEVHNIDNASPATVSRNGMIFMSSSVLDWEPILKGWLLT--RPDSQRETIFSTFEACYAEAATYVKQSLNPKMPFLDCNYVRQATNLLDGLLASTEEVRDLPNSHLQKLIVFAIMWSLGALLELDDRKRLQENLKNYSSIPLPPIKGEDTIFEYLVNENGEWQHWDERVQEYAYPADETPEYTGILVPNVDNTRTDFLINTISKQGKPVLLIGEQGTAKTVIVKGYCGKYDPEAHMFKSLNFSSATTPNMFQRTIESYVDKRMGSTFGPPAGKKMTVFIDDINMPIINEWGDQITNEITRQMMEMNGFYNLEKPGEFTSIVDIQIIAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNASIDKIFRAVGLGHYCAERGFSDEVRALVDKLVPATRRLWQRTKIRMLPTPAKFHYVFNLRDLSRIWQGMLNTVSEVANDRSVLMSLWKHECTRTIADRFTEQGDKDWFEKTIKLTAEEECSPEIAELMQAEPYFVDFLREAPEPTGDEPDDADLSAPKIYEPIDSYEQLNDKLQSYMSQYNEIVRGGKLDLVFFKDAMIHLVKISRIIRTTKGHALLVGVGGSGKQSLTRLASFIAGYDTFQITLTR--------SYNVSNLLEDLKVLYRTAGGKGKGMTFVFTDNEIKEEGFLEFLNNMLSSGEIANLFARDEMDEILGELVPVMKKEFPRRPPSNENLQDYYMTRVLKYLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFQRWPKDALVSVSRYFLSAFDIVCTPQVKEAVVNVMGQFQDLVAETCTDYFQRFRRQTHVTPKSYLSFISGYKEIYGTKKSELDQLAKRMNTGLKKLLEATESVNELSKELVEKEKELAVANKKAEEVLKDVTVKATAAQKVKAQVQVVKDRAQALVDAIGADKAVAEGKLEAAKPALEEAESALQTIKPADISTVKKLAKPPHLIMRIMDCVLLLFRKKIDTVTMDPERPCLKPSWAEALKLMSG-DFLGALLNFPKDTINAETVEFLMPYFEMEDYNIETAKKVSGNVAGLCSWTTAMATFFGINKEVLPLKANLVVQEGRLEKAMAELNQAQALLDEKQRELDVVQALYDKAMAEKQALMDDAEACRRKMSNATTLIEGLSGERIRWTEASKGFEAQIQRLVGDVLLATAFLSYSGPFNQDFRNLLQRNWKKELVQNKIPYTEDLNLISMLVDNATISEWNLQGLPNDELSTQNGLIVTRAARFPLLIDPQGQGKAWIKNKEKNNELQLTSLNHKYFRTHLEDSLSLGRPMIIEDVGEELDPALDNILERNFIKSGTRLKVKVGDKECDVMDGFRLYITTKLPNPKYTPEIYAKTSMIDFTVTMKGLEDQLLGVVIVTEKAELETERVKLMEDVTANKRKMQELEDNLLYRLTSTEGSLVEDESLIEVLRVTKITAEDVREKLAVAADTEIKINTAREEYRPIATRGSLLYFLIVEMSMVNVMYQTSLRQFLGLFDLSMARSTKSPITLKRIANIIDYLTFEVFRYTARGLYEVDKFTFTILLTLKLEMQSGHVKHDEFSIFIKGGAALDLNAVEPKPKKWIQDLIWLNLVELSKLAHFNLLTEQITKNDKPWKTWCDEDAPEECVIPDGYDKASTFHKLLLVRSITPDRTIPMAKRYVAEIMGAQYADGVITNLETMAEEADCRTPMICFLSMGSDPTENIERLAKKQGIQSGAISMGQGQEVHARRLLQASMSEGRWILLQNCHLGLNFMDELLDTVTTAES-HENFRCWITTEPHRSFPINMLQSSIKFTYDPPQGIRAGLRRTYGLLTQDQLDVSNMPQWKPILYSVAFMHTVVQERRKFGPIGWNIPYEFNQSDFSATVQFVQNHLDDMDIKRGVSWVTVRYMIGEVQYGGRVTDDYDKRLLNTYARVWFSESMFMESFQFNKGYKIPKCKQIDEYRAFVDALPLVDAPDVFGLHANADVTYQTNNANSMLETILNIQPKDSGAGGAGETRESIVYRQCDDMLAKLPEDYNPFEVRDKLRKMDHLKPLHIFLKQEIDRMQRVISNVRSTLTDLKLAIDGTIIMSENLQDALDNMFDARIPNLWRKISWESATLGFWFTDLLDRNAQFHTWLFDGRPSTYWMTGFFNPQGFLTAMRQEITRAHKGWALDSVFLMNDVTKLAKEEVHNPPAEGVYVYGLFLDGAGWDRRNARLTEPPAKVLYTSLPVVHIYAINTERP------KSSNLYECPVYKKPKRTDLNYIFPLLLRTSKDPDHWILRGVALLCDTK 4597          
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A267GLR3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012039g1 PE=4 SV=1)

HSP 1 Score: 6546.84 bits (16984), Expect = 0.000e+0
Identity = 3231/4635 (69.71%), Postives = 3853/4635 (83.13%), Query Frame = 1
Query:  109 TDLTDIAPPLVSKEPNESNMAHVDNKTKPIQTNVRAQVVTKSVPKKIITG-ESXXXXXXXXXXXXXXXXXXVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDP--KKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQ-------------ELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGM-DIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSG-GGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
             D  ++APPLVSKE  +      D +T+P      A+    +V K  +T  E  ++Q   LK+ K+ RR  +D RH F+F+ +A+   ++ +QVE+ +L D+K+G F+ FF  + SK + FYYQ+       ++    I   +  KKL I  G   PL GL F+F R+T KA+T NN A +I +  +DAS GRLL+A+E +I  I++P L++LE+WGS++ +  + +KI EF + + RFL+ L +A+ NM  QMQL    DE L  K++ P     AV+SSE MEKLE LL +W K+IEQVL+ESEQIRREADDVGPSAEL YWKSRM+RFNNLLEQM  K+V  V+ +LH AKSR+L+ WR+LD RITDAANEA+DNVKYLYTLDKFFGPLSKCNPV M EHIP+LINAIRMI++ISQYYN+SERMT+LFVKVTNQMITTCK ++ EG +KIWD  RE L +R+ HC  LN  Y+  F K ++ L+++  EKQFEFSENYIFGKF+ FC+RL KI ++  +++S S LQ  K EGI+ ++VRY++I++ I+KKTYDILDHRK++FDNDY++F      LE  + A++D  F++ M   +QL +L +FE+I+ ++ D  +K+ ++LQ+++K L+NVR+LYQ+YK DPP+ RNLPPI+GKI+WSRHL  KIE PM++FK  + EIL++PEA K+V+NYNKMA+VLL FEL+Y+  W  T++ F +GL SSLL+RN        + LVN D +++ELI EA +++ L L++P+   R++  E  IKD YR ++E++ E+  I D++P  +  +M+P    I+E   PGL  L+W S ++ DY+E  R  +  F++L+K++SD+++ R+EAVL++M++TAL DLPE+EP+T EEF+SMTE    +A+E+L K+S+LVE +VN+ ++ +   L E+  K +  +D ++C       K+ RC ECQ C+ +A L+Y+T RNT+ LI+CTRL+LDTI+RR   S+    +    E+K+PALFK+D+VL +PNI T+P L+EIQ   NKAV+ +LKMS +I QW H  L  KQ+Q             +++++ +E  ++ KLPG   +K LNK+I+DHKDVAK +SQ+S ++++ K   +    EF  +  LW EE   KVKEFM  KPILSEI+A  K   DME E+ + P +Y+VGA+++ +E LK  LI EC +W+ AY +ELN +CA++MD ILE FD + K+L+RPV+DLDDVR+HMAAL+++RE+EI+I+M I PIEE Y +L KY+I FNDGN+ERVDSL Y  S L+ QA+ VQDHLL IQP+FK +L++GV  F++++  FV +YD +GP    I PREASDR+ ++Q +FD+LWRK+ TYSGGE+LFGL VTDYPD+QRI+K+LNL+QKLY LYN VL+TVN YYDIAW++I+I+ INQQL +FQN+CRKLPKALKEWQA++DLRKTIDDF+E+CPLLE MS+ AMM RHWER+E +T HKF+V+SDNFLLRNLMEAPLL NK++IEDICISA KEKDIEAKLK V +DWSAQS  FS+FKSRGELLLKGD+  E V+LMEDSLM LG+LLSNRYNAPFKPKIQEWV KL+G+TEIIENWL VQNLWIYLEAVFVGGDIAKQLP EAKRF NIDKSWQ+IMQRAHEIPNVVQCCMGD+TLSQLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQ+HLLS+FDNTK+VTFDEKVYDKIL+I+SQE E VQL+ P+ AQGNVE WLGDLL++SR S+H VIR + +T+ D  F L EFE S+P+QVGLLG+QM+WTRD+EEAL Q+K DKKIM  TN+ FL+ILNELI VTT+ LTK+ERTKFETLITIHVHQ+DIFDDLV   + +P DFEWLKQSRFYFKEDTDQC+VSITDVDF Y NEFLGCTDRLVITPLTDRCYIT++QALGM+LGGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI++VL CKKERK+QFIFTDGD+VDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDR II+RVKLASCGFLQN +L+KKF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKR NP DSEP IVMRVLRDMNLSKLVDEDE LF+SLI+DLFP M++  K YP+I AAI  Q+ +  LI+H PW LK IQLFETQRVRHG+MTLGPSGAGKTKCI  LMRAMT+CGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHK KKG+H+WLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FEVHNIDNASPATVSRNGM++MSSS+LDW+PIL+ WLL     ++   TI +TF+  ++EA  YV Q+L+PKM  L+CNY+RQA +LL GL+    +++++  SHL+KLIVF++MWSLGALLEL+DR +LQE + +  ++P+P  K +DTIFEY+VN+ GEW+HW  RV EY YP D  PEY  ILVPNVDNTRTDFLINTISKQ K VLLIGEQGTAKTVIVKGYCGKY+PE  +FKSLNFSSATTPNMFQRT+ESYVDKRMG+TFGPP G+KMT+FIDDINMP+INEWGDQITNEI RQMMEM G Y+LEKPG+FT+IVDIQIIAAMIHPGGGRNDIPQRLKRQF +FNCTLPSNASIDKIFR +G G++C ERGF  +V+  V+ LV ATR+LWQ+TKI+MLPTPAKFHYVFNLRDLSRIWQGML   S+V N  S LMSLWKHEC R I DRFTEQ DKDWFEKT+K+T EEEC  E+   +Q EPYFVDFL++APE TG+E ++ +L APKIYEPI+SYEQL+D+L  YM+QYNE VRGGKLDLVFFKDAM HLVKISR+IRTTKGHALLVGVGGSGKQSLTRLASFI+GY+TFQITLT         SYNVSNL+EDLK+LYRT+G  GKG+TF+FTDNEIK+E FLEFLNNMLSSGEIANLFARDEMDEIL ELV VMKKE+PRRPPSNENLQ+YYM+RVLKYLHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWFQRWPKDAL++VS YFLS F+IV TP+VK+AVVN MG FQDLVAE C +YFQRFRR THVTPKSYLSFISGYKE+Y  K+ E+  LA RMNTGLKKL+EATESVNELSKEL  KEKEL VA KKA EVL  V VKA+AAQKVK QVQVVKDRA+ALV+ I  DKA+AE KLEAAKPAL+EAE AL+TIKP  I+TVKKL +PPHLIMRIMDCVL+LF+K++D+VT DPERPC KP+W EA+KLMSG +FL +LLNFPKDTIN E V+ + PYF MED+N+ +AK VSG+VAGLCSWT AMA+FF INKEVLPLKANL VQ+ +LE AM ELN AQ +LD KQ+ELD+VQA Y+KAM EKQAL DDAEACRRKM+NA  LI GL+GER RWTEASK F+ QI++LVGDVL+ TAFLSY GPFNQDFRN+LQR+WK ELV N IP+T+D+  ISML DNATISEWN+QGLPNDELS QNGLIVTRA R+PLLIDPQGQGK+WI+NKEKN+ELQ+T+LNHKYFR HLED+LSLGRP++IEDVGEE+DPALDN+LE+NFIKSG+  KVKVGDKE DVM GF+LY+TTKLPNP YTPE++AKTS+IDFTVT+KGLEDQLLGVVI+TEK ELE ER KLME+V  NKRK +ELEDNLLYRLTSTEGSLVEDESLIEVLRVTK TAEDV++KL +  DTEIKIN+AREEYRP+ATRGS+LYFLIVEMSMVN MYQTSL+QFLGLFD SMA S KSPIT KRI NII+YLT+EVFRYTARG YE DKFTFTILLT+K+ M+SG +KH+EF IFIKGGAALDLNAVEPKPKKWIQDL WLNLVELSKL +F  +TEQ+ KNDK WKTW D DAPEE  IPDGYD   TF KLLL+RS  PDRT+PMAK+Y+ E MG ++A+GVITNLE M EE D  TPMICFLSMGSDPT+NIERLAKK+ ++ G+ISMGQGQEVHAR+LL  SM EGRW+LLQNCHLGLNFMDE L+ +TT E+ HE+FRCW+TTE H  FPIN+LQ  IKFTYDPP GIRAGLRRTY LLTQDQLD++N  QWKP+L+ VAF+HT VQERRKFGPIGWNIPYEFNQSDF++TVQFVQNHLDDMD+KRGVSW TV YMIGEVQYGGRVTDDYDKRLLNTYA+ WFS  MF   F F KGY IP  K +DEYRAF+D LPL+D+P+ FGLHANAD+ Y+T+NAN ML TI+NIQPKDSG GGAGETRES+VYR  DDML +LPEDYNPFEV++KL+KM  LKPL+IFLKQE+DRMQ+VIS VRSTL DLKLAIDGTIIMSENL+DALDN+FDARIP+ W K+SWESATLGFWFTDLLDRN QFH+WL++GRP  +WMTGFFNPQGFLTAMRQEITR HKGWALD+V L NDVTK  KE+V+N P+EGVYV+GL+LDGAGW+ R+A+L EP  KVLYT LPVVH+YA++   P       +   YECPVYKKP+RTDLNYIFPL L+T++ PDHWILRGVALLCD K
Sbjct:    2 ADKAEVAPPLVSKEQPK------DAQTQPAAKPAAAKSQPTAVKKPPLTSNEQARQQAIKLKELKETRRSQLDARHGFMFEKMAEALGVEQSQVEEWILVDKKFGYFDRFFDADGSKSMTFYYQE-------QSGKPDIANPTGAKKLIIGEGQDVPLLGLAFVFTRTTSKAITQNNYANEINYTTMDASEGRLLEAMESYIGSILYPALKHLEDWGSLTKESENRAKIEEFLDAIQRFLDILSSAKTNMKGQMQLSQPPDE-LAHKVQSPVDLQAAVHSSEMMEKLEKLLLQWAKEIEQVLNESEQIRREADDVGPSAELLYWKSRMTRFNNLLEQMNRKEVRTVVALLHNAKSRTLKVWRQLDCRITDAANEARDNVKYLYTLDKFFGPLSKCNPVTMQEHIPALINAIRMIYTISQYYNTSERMTTLFVKVTNQMITTCKAYIREGATKIWDHPREVLVERMQHCLALNRHYQATFRKVQEHLRQNPQEKQFEFSENYIFGKFDTFCRRLHKIMDMLQVVQSLSGLQDIKTEGIEQLIVRYRTISESIRKKTYDILDHRKTDFDNDYEEFKQNISLLETALYAYIDNMFKRPMSAVQQLGILVRFERIEGIQFDWSEKYTRILQSYAKELENVRRLYQRYKDDPPVARNLPPISGKIAWSRHLLHKIEKPMMIFKHKKKEILQLPEARKIVRNYNKMAEVLLAFELLYHQKWLNTVQQFHIGLNSSLLVRN----SHTGRLLVNLDPVVVELISEAHFMKRLGLEVPDQIVRIMSAEPQIKDIYRALEEMIAEFEGISDTIPTPIQTLMKPFRDHINEVLEPGLTQLSWISTQVRDYIESARNEVADFKILVKQLSDMIECRVEAVLEEMSLTALVDLPEEEPVTPEEFVSMTEAVCNDAAEFLYKQSQLVESSVNEAVETILERLPET--KKIARDDTWDCTDESARIKRQRCQECQHCLIFAFLSYYTNRNTDALIRCTRLSLDTIRRRAHHSAALRYLG-QGEEKKPALFKSDVVLQLPNITTQPTLEEIQHKFNKAVKIMLKMSVDIPQWKHQILTQKQLQRKLQEDSAKAEGKDVDRMTDEEIEELKLPGGSVIKPLNKIIADHKDVAKLMSQMSSLISSNKIDEKETFKEFYKFKQLWMEEINVKVKEFMNRKPILSEISAVFKANVDMEMELSALPQSYQVGAIIYSTEKLKDALIEECKAWRLAYGKELNERCAKDMDDILEWFDGVKKQLARPVQDLDDVRAHMAALTDVRENEIRIDMEIGPIEETYALLAKYDILFNDGNAERVDSLSYERSNLKEQARGVQDHLLAIQPEFKEDLLQGVTKFQQDLTVFVDEYDFKGPQEPNIPPREASDRVALFQGRFDDLWRKFETYSGGEQLFGLSVTDYPDLQRIKKDLNLMQKLYGLYNQVLETVNGYYDIAWTDIDIEAINQQLTEFQNRCRKLPKALKEWQAFEDLRKTIDDFSESCPLLELMSNKAMMARHWERLENLTKHKFDVESDNFLLRNLMEAPLLENKDDIEDICISATKEKDIEAKLKQVMSDWSAQSLYFSTFKSRGELLLKGDSISETVALMEDSLMVLGSLLSNRYNAPFKPKIQEWVSKLSGSTEIIENWLQVQNLWIYLEAVFVGGDIAKQLPAEAKRFSNIDKSWQRIMQRAHEIPNVVQCCMGDETLSQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQSHLLSIFDNTKSVTFDEKVYDKILSISSQEGETVQLETPVLAQGNVESWLGDLLRVSRASVHKVIRESFLTLQDPNFNLMEFEGSYPAQVGLLGLQMLWTRDAEEALVQAKLDKKIMPQTNEHFLNILNELINVTTKELTKMERTKFETLITIHVHQKDIFDDLVKSHVKSPGDFEWLKQSRFYFKEDTDQCLVSITDVDFNYMNEFLGCTDRLVITPLTDRCYITIAQALGMALGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLACKKERKSQFIFTDGDLVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRGIIMRVKLASCGFLQNVLLAKKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRANPQDSEPMIVMRVLRDMNLSKLVDEDEPLFMSLIDDLFPGMQLDKKGYPEIEAAILHQVNEHGLIHHAPWVLKCIQLFETQRVRHGIMTLGPSGAGKTKCIATLMRAMTECGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKTKKGDHVWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKILFEVHNIDNASPATVSRNGMIFMSSSVLDWEPILKGWLLT--RPESQRETIFSTFEACYAEAATYVKQSLNPKMPFLDCNYVRQATNLLDGLLASTEEVRDLPNSHLQKLIVFAIMWSLGALLELDDRKRLQENLKNYSSIPLPPIKGEDTIFEYLVNENGEWQHWDERVQEYAYPADETPEYTGILVPNVDNTRTDFLINTISKQGKPVLLIGEQGTAKTVIVKGYCGKYDPEAHMFKSLNFSSATTPNMFQRTIESYVDKRMGSTFGPPAGKKMTVFIDDINMPIINEWGDQITNEITRQMMEMNGFYNLEKPGEFTSIVDIQIIAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNASIDKIFRAVGLGHYCAERGFSDEVRALVDKLVPATRRLWQRTKIRMLPTPAKFHYVFNLRDLSRIWQGMLNTVSEVANDRSVLMSLWKHECTRTIADRFTEQGDKDWFEKTIKLTAEEECSPEIAELMQAEPYFVDFLREAPEPTGDEPDDADLSAPKIYEPIDSYEQLNDKLQSYMSQYNEIVRGGKLDLVFFKDAMIHLVKISRIIRTTKGHALLVGVGGSGKQSLTRLASFIAGYDTFQITLTR--------SYNVSNLLEDLKVLYRTAGGKGKGMTFVFTDNEIKEEGFLEFLNNMLSSGEIANLFARDEMDEILGELVPVMKKEFPRRPPSNENLQDYYMTRVLKYLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFQRWPKDALVSVSRYFLSAFDIVCTPQVKEAVVNVMGQFQDLVAETCTDYFQRFRRQTHVTPKSYLSFISGYKEIYGTKKSELDQLAKRMNTGLKKLLEATESVNELSKELVEKEKELAVANKKAEEVLKDVTVKATAAQKVKAQVQVVKDRAQALVDAIGADKAVAEGKLEAAKPALEEAESALQTIKPADISTVKKLAKPPHLIMRIMDCVLLLFRKKIDTVTMDPERPCLKPSWAEALKLMSG-DFLGALLNFPKDTINAETVEFLMPYFEMEDYNIETAKKVSGNVAGLCSWTTAMATFFGINKEVLPLKANLVVQEGRLEKAMAELNQAQALLDEKQRELDVVQALYDKAMAEKQALMDDAEACRRKMSNATTLIEGLSGERIRWTEASKGFEAQIQRLVGDVLLATAFLSYSGPFNQDFRNLLQRNWKKELVQNKIPYTEDLNLISMLVDNATISEWNLQGLPNDELSTQNGLIVTRAARFPLLIDPQGQGKAWIKNKEKNNELQLTSLNHKYFRTHLEDSLSLGRPMIIEDVGEELDPALDNILERNFIKSGTRLKVKVGDKECDVMDGFRLYITTKLPNPKYTPEIYAKTSMIDFTVTMKGLEDQLLGVVIVTEKAELETERVKLMEDVTANKRKMQELEDNLLYRLTSTEGSLVEDESLIEVLRVTKITAEDVREKLAVAADTEIKINTAREEYRPIATRGSLLYFLIVEMSMVNVMYQTSLRQFLGLFDLSMARSTKSPITLKRIANIIDYLTFEVFRYTARGLYEVDKFTFTILLTLKLEMQSGHVKHDEFSIFIKGGAALDLNAVEPKPKKWIQDLIWLNLVELSKLAHFNLLTEQITKNDKPWKTWCDEDAPEECVIPDGYDKASTFHKLLLVRSITPDRTIPMAKRYVAEIMGAQYADGVITNLETMAEEADCRTPMICFLSMGSDPTENIERLAKKQGIQSGAISMGQGQEVHARRLLQASMSEGRWILLQNCHLGLNFMDELLDTVTTAES-HENFRCWITTEPHRSFPINMLQSSIKFTYDPPQGIRAGLRRTYGLLTQDQLDVSNMPQWKPILYSVAFMHTVVQERRKFGPIGWNIPYEFNQSDFSATVQFVQNHLDDMDIKRGVSWVTVRYMIGEVQYGGRVTDDYDKRLLNTYARVWFSESMFMESFQFNKGYKIPKCKQIDEYRAFVDALPLVDAPDVFGLHANADVTYQTNNANSMLETILNIQPKDSGAGGAGETRESIVYRQCDDMLAKLPEDYNPFEVRDKLRKMDHLKPLHIFLKQEIDRMQRVISNVRSTLTDLKLAIDGTIIMSENLQDALDNMFDARIPNLWRKISWESATLGFWFTDLLDRNAQFHTWLFDGRPSTYWMTGFFNPQGFLTAMRQEITRAHKGWALDSVFLMNDVTKLAKEEVHNPPAEGVYVYGLFLDGAGWDRRNARLTEPPAKVLYTSLPVVHIYAINTERP------KSSNLYECPVYKKPKRTDLNYIFPLLLRTSKDPDHWILRGVALLCDTK 4597          
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A1I8IQE7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 6496.38 bits (16853), Expect = 0.000e+0
Identity = 3206/4646 (69.01%), Postives = 3828/4646 (82.39%), Query Frame = 1
Query:  109 TDLTDIAPPLVSKE-PNESNMAHVDNKTKPIQTNVRAQVVTKSVPKKIITGESXXXXXXXXXXXXXXXXXXVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDP--KKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQ-------------ELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWS-----------EINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSG-GGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
             D  ++APPLVSKE P ++             T V+   +T        + E  ++Q   LK+ K+ RR  +D RH F+F+ +A+   ++ +QVE+ +L D+K+G F+ FF  + SK + FYYQ+       ++    I   +  KKL I  G   PL GL F+F R+T KA+T NN A +I +  +DAS GRLL+A+E +I  I++P L++LE+WGS++ +  + +KI EF + + RFL+ L +A+ NM  QMQL    DE L  K++ P     AV+SSE MEKLE LL +W K+IEQVL+ESEQIRREADDVGPSAEL YWKSRM+RFNNLLEQM  K+V  V+ +LH AKSR+L+ WR+LD RITDAANEA+DNVKYLYTLDKFFGPLSKCNPV M EHIP+LINAIRMI++ISQYYN+SERMT+LFVKVTNQMITTCK ++ EG +KIWD  RE L +R+ HC  LN  Y+  F K ++ L+++  EKQFEFSENYIFGKF+ FC+RL KI ++  +++S S LQ  K EGI+ ++VRY++I++ I+KKTYDILDHRK++FDNDY++F      LE  + A++D  F++ M   +QL +L +FE+I+ ++ D  +K+ ++LQ+++K L+NVR+LYQ+YK DPP+ RNLPPI+GKI+WSRHL  KIE PM++FK  + EIL++PEA K+V+NYNKMA+VLL FEL+Y+  W  T++ F +GL SSLL+RN        + LVN D +++ELI EA +++ L L++P+   R++  E  IKD YR ++E++ E+  I D++P  +  +M+P    I+E   PGL  L+W S ++ DY+E  R  +  F++L+K++SD+++ R+EAVL++M++TAL DLPE+EP+T EEF+SMTE    +A+E+L K+S+LVE +VN+ ++ +   L E+  K +  +D ++C       K+ RC ECQ C+ +A L+Y+T RNT+ LI+CTRL+LDTI+RR   S+    +    E+K+PALFK+D+VL +PNI T+P L+EIQ   NKAV+ +LKMS +I QW H  L  KQ+Q             +++++ +E  ++ KLPG   +K LNK+I+DHKDVAK +SQ+S ++++ K   +    EF  +  LW EE   KVKEFM  KPILSEI+A  K   DME E+ + P +Y+VGA+++ +E LK  LI EC +W+ AY +ELN +CA++MD ILE FD + K+L+RPV+DLDDVR+HMAAL+++RE+EI+I+M I PIEE Y +L KY+I FNDGN+ERVDSL Y  S L+ QA+ VQDHLL IQP+FK +L++GV  F++++  FV +YD +GP    I PREASDR+ ++Q +FD+LWRK+ TYSGGE+LFGL VTDYPD+QRI+K+L              + +   Y + W            +I+I+ INQQL +FQN+CRKLPKALKEWQA++DLRKTIDDF+E+CPLLE MS+ AMM RHWER+E +T HKF+V+SDNFLLRNLMEAPLL NK++IEDICISA KEKDIEAKLK V +DWSAQS  FS+FKSRGELLLKGD+  E V+LMEDSLM LG+LLSNRYNAPFKPKIQEWV KL+G+TEIIENWL VQNLWIYLEAVFVGGDIAKQLP EAKRF NIDKSWQ+IMQRAHEIPNVVQCCMGD+TLSQLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQ+HLLS+FDNTK+VTFDEKVYDKIL+I+SQE E VQL+ P+ AQGNVE WLGDLL++SR S+H VIR + +T+ D  F L EFE S+P+QVGLLG+QM+WTRD+EEAL Q+K DKKIM  TN+ FL+ILNELI VTT+ LTK+ERTKFETLITIHVHQ+DIFDDLV   + +P DFEWLKQSRFYFKEDTDQC+VSITDVDF Y NEFLGCTDRLVITPLTDRCYIT++QALGM+LGGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI++VL CKKERK+QFIFTDGD+VDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDR II+RVKLASCGFLQN +L+KKF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKR NP DSEP IVMRVLRDMNLSKLVDEDE LF+SLI+DLFP M++  K YP+I AAI  Q+ +  LI+H PW LK IQLFETQRVRHG+MTLGPSGAGKTKCI  LMRAMT+CGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHK KKG+H+WLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FEVHNIDNASPATVSRNGM++MSSS+LDW+PIL+ WLL     ++   TI +TF+  ++EA  YV Q+L+PKM  L+CNY+RQA +LL GL+   + ++++  SHL+KLIVF++MWSLGALLEL+DR +LQE + +  ++P+P  K +DTIFEY+VN+ GEW+HW  RV EY YP D  PEY  ILVPNVDNTRTDFLINTISKQ K VLLIGEQGTAKTVIVKGYCGKY+PE  +FKSLNFSSATTPNMFQRT+ESYVDKRMG+TFGPP G+KMT+FIDDINMP+INEWGDQITNEI RQMMEM G Y+LEKPG+FT+IVDIQIIAAMIHPGGGRNDIPQRLKRQF +FNCTLPSNASIDKIFR +G G++C ERGF  +V+  V+ LV ATR+LWQ+TKI+MLPTPAKFHYVFNLRDLSRIWQGML   S+V N  S LMSLWKHEC R I DRFTEQ DKDWFEKT+K+T EEEC  E+   +Q EPYFVDFL++APE TG+E ++ +L APKIYEPI+SYEQL+D+L  YM+QYNE VRGGKLDLVFFKDAM HLVKISR+IRTTKGHALLVGVGGSGKQSLTRLASFI+GY+TFQITLT         SYNVSNL+EDLK+LYRT+G  GKG+TF+FTDNEIK+E FLEFLNNMLSSGEIANLFARDEMDEIL ELV VMKKE+PRRPPSNENLQ+YYM+RVLKYLHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWFQRWPKDAL++VS YFLS F+IV TP+VK+AVVN MG FQDLVAE C +YFQRFRR THVTPKSYLSFISGYKE+Y  K+ E+  LA RMNTGLKKL+EATESVNELSKEL  KEKEL VA KKA EVL  V VKA+AAQKVK QVQVVKDRA+ALV+ I  DKA+AE KLEAAKPAL+EAE AL+TIKP  I+TVKKL +PPHLIMRIMDCVL+LF+K++D+VT DPERPC KP+W EA+KLMSG +FL +LLNFPKDTIN E V+ + PYF MED+N+ +AK VSG+VAGLCSWT AMA+FF INKEVLPLKANL VQ+ +LE AM ELN AQ +LD KQ+ELD+VQA Y+KAM EKQAL DDAEACRRKM+NA  LI GL+GER RWTEASK F+ QI++LVGDVL+ TAFLSY GPFNQDFRN+LQR+WK ELV N IP+T+D+  ISML DNATISEWN+QGLPNDELS QNGLIVTRA R+PLLIDPQGQGK+WI+NKEKN+ELQ+T+LNHKYFR HLED+LSLGRP++IEDVGEE+DPALDN+LE+NFIKSG+  KVKVGDKE DVM GF+LY+TTKLPNP YTPE++AKTS+IDFTVT+KGLEDQLLGVVI+TEK ELE ER KLME+V  NKRK +ELEDNLLYRLTSTEGSLVEDESLIEVLRVTK TAEDV++KL +  DTEIKIN+AREEYRP+ATRGS+LYFLIVEMSMVN MYQTSL+QFLGLFD SMA S KSPIT KRI NII+YLT+EVFRYTARG YE DKFTFTILLT+K+ M+SG +KH+EF IFIKGGAALDLNAVEPKPKKWIQDL WLNLVELSKL +F  +TEQ+ KNDK WKTW D DAPEE  IPDGYD   TF KLLL+RS  PDRT+PMAK+Y+ E MG ++A+GVITNLE M EE D  TPMICFLSMGSDPT+NIERLAKK+ ++ G+ISMGQGQEVHAR+LL  SM EGRW+LLQNCHLGLNFMDE L+ +TT E+ HE+FRCW+TTE H  FPIN+LQ  IKFTYDPP GIRAGLRRTY LLTQDQLD++N  QWKP+L+ VAF+HT VQERRKFGPIGWNIPYEFNQSDF++TVQFVQNHLDDMD+KRGVSW TV YMIGEVQYGGRVTDDYDKRLLNTYA+     E  +  F F KGY IP  K +DEYRAF+D LPL+D+P+ FGLHANAD+ Y+T+NAN ML TI+NIQPKDSG GGAGETRES+VYR  DDML +LPEDYNPFEV++KL+KM  LKPL+IFLKQE+DRMQ+VIS VRSTL DLKLAIDGTIIMSENL+DALDN+FDARIP+ W K+SWESATLGFWFTDLLDRN QFH+WL++GRP  +WMTGFFNPQGFLTAMRQEITR HKGWALD+V L NDVTK  KE+V+N P+EGVYV+GL+LDGAGW+ R+A+L EP  KVLYT LPVVH+YA++   P       +   YECPVYKKP+RTDLNYIFPL L+T++ PDHWILRGVALLCD K
Sbjct:  169 ADKAEVAPPLVSKEQPKDAQTQPAAKPAAAKPTAVKKPPLT--------SNEQARQQAIKLKELKETRRSQLDARHGFMFEKMAEALGVEQSQVEEWILVDKKFGYFDRFFDADGSKSMTFYYQE-------QSGKPDIANPTGAKKLIIGEGQDVPLLGLAFVFTRTTSKAITQNNYANEINYTTMDASEGRLLEAMESYIGSILYPALKHLEDWGSLTKESENRAKIEEFLDAIQRFLDILSSAKTNMKGQMQLSQPPDE-LTHKVQSPVDLQAAVHSSEMMEKLEKLLLQWAKEIEQVLNESEQIRREADDVGPSAELLYWKSRMTRFNNLLEQMNRKEVRTVVALLHNAKSRTLKVWRQLDCRITDAANEARDNVKYLYTLDKFFGPLSKCNPVTMQEHIPALINAIRMIYTISQYYNTSERMTTLFVKVTNQMITTCKAYIREGATKIWDHPREVLVERMQHCLALNRHYQATFRKVQEHLRQNPQEKQFEFSENYIFGKFDTFCRRLHKIMDMLQVVQSLSGLQDIKTEGIEQLIVRYRTISESIRKKTYDILDHRKTDFDNDYEEFKQNISLLETALYAYIDNMFKRPMSAVQQLGILVRFERIEGIQFDWSEKYTRILQSYAKELENVRRLYQRYKDDPPVARNLPPISGKIAWSRHLLHKIEKPMMIFKHKKKEILQLPEARKIVRNYNKMAEVLLAFELLYHQKWLNTVQQFHIGLNSSLLVRN----SHTGRLLVNLDPVVVELISEAHFMKRLGLEVPDQIVRIMSAEPQIKDIYRALEEMIAEFEGISDTIPTPIQTLMKPFRDHINEVLEPGLTQLSWISTQVRDYIESARNEVADFKILVKQLSDMIECRVEAVLEEMSLTALVDLPEEEPVTPEEFVSMTEAVCNDAAEFLYKQSQLVESSVNEAVETILERLPET--KKIARDDTWDCTDESARIKRQRCQECQHCLIFAFLSYYTNRNTDALIRCTRLSLDTIRRRAHHSAALRYLG-QGEEKKPALFKSDVVLQLPNITTQPTLEEIQHKFNKAVKIMLKMSMDIPQWKHQILTQKQLQRKLQEDSAKAEGKDVDRMTDEEIEELKLPGGSVIKPLNKIIADHKDVAKLMSQMSSLISSNKIDEKETFKEFYKFKQLWMEEINVKVKEFMDRKPILSEISAVFKANVDMEMELSALPQSYQVGAIIYSTEKLKDALIEECKAWRLAYGKELNERCAKDMDDILEWFDGVKKQLARPVQDLDDVRAHMAALTDVRENEIRIDMEIGPIEETYALLAKYDILFNDGNAERVDSLSYERSNLKEQARGVQDHLLAIQPEFKEDLLQGVTKFQQDLTVFVDEYDFKGPQEPNIPPREASDRVALFQGRFDDLWRKFETYSGGEQLFGLSVTDYPDLQRIKKDL--------------NLMQKLYGLFWRPSTAITTSPGPDIDIEAINQQLTEFQNRCRKLPKALKEWQAFEDLRKTIDDFSESCPLLELMSNKAMMARHWERLENLTKHKFDVESDNFLLRNLMEAPLLENKDDIEDICISATKEKDIEAKLKQVMSDWSAQSLYFSTFKSRGELLLKGDSISETVALMEDSLMVLGSLLSNRYNAPFKPKIQEWVSKLSGSTEIIENWLQVQNLWIYLEAVFVGGDIAKQLPAEAKRFSNIDKSWQRIMQRAHEIPNVVQCCMGDETLSQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQSHLLSIFDNTKSVTFDEKVYDKILSISSQEGETVQLETPVLAQGNVESWLGDLLRVSRASVHKVIRESFLTLQDPNFNLMEFEGSYPAQVGLLGLQMLWTRDAEEALVQAKLDKKIMPQTNEHFLNILNELINVTTKELTKMERTKFETLITIHVHQKDIFDDLVKSHVKSPGDFEWLKQSRFYFKEDTDQCLVSITDVDFNYMNEFLGCTDRLVITPLTDRCYITIAQALGMALGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLACKKERKSQFIFTDGDLVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRGIIMRVKLASCGFLQNVLLAKKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRANPQDSEPMIVMRVLRDMNLSKLVDEDEPLFMSLIDDLFPGMQLDKKGYPEIEAAILHQVNEHGLIHHAPWVLKCIQLFETQRVRHGIMTLGPSGAGKTKCIATLMRAMTECGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKTKKGDHVWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKILFEVHNIDNASPATVSRNGMIFMSSSVLDWEPILKGWLLT--RPESQRETIFSTFEACYAEAATYVKQSLNPKMPFLDCNYVRQATNLLDGLLASTEEVRDLPNSHLQKLIVFAIMWSLGALLELDDRKRLQENLKNYSSIPLPPIKGEDTIFEYLVNENGEWQHWDERVQEYAYPADETPEYTGILVPNVDNTRTDFLINTISKQGKPVLLIGEQGTAKTVIVKGYCGKYDPEAHMFKSLNFSSATTPNMFQRTIESYVDKRMGSTFGPPAGKKMTVFIDDINMPIINEWGDQITNEITRQMMEMNGFYNLEKPGEFTSIVDIQIIAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNASIDKIFRAVGLGHYCAERGFSDEVRALVDKLVPATRRLWQRTKIRMLPTPAKFHYVFNLRDLSRIWQGMLNTVSEVANDRSVLMSLWKHECTRTIADRFTEQGDKDWFEKTIKLTAEEECSPEIAELMQAEPYFVDFLREAPEPTGDEPDDADLSAPKIYEPIDSYEQLNDKLQSYMSQYNEIVRGGKLDLVFFKDAMIHLVKISRIIRTTKGHALLVGVGGSGKQSLTRLASFIAGYDTFQITLTR--------SYNVSNLLEDLKVLYRTAGGKGKGMTFVFTDNEIKEEGFLEFLNNMLSSGEIANLFARDEMDEILGELVPVMKKEFPRRPPSNENLQDYYMTRVLKYLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFQRWPKDALVSVSRYFLSAFDIVCTPQVKEAVVNVMGQFQDLVAETCTDYFQRFRRQTHVTPKSYLSFISGYKEIYGTKKSELDQLAKRMNTGLKKLLEATESVNELSKELVEKEKELAVANKKAEEVLKDVTVKATAAQKVKAQVQVVKDRAQALVDAIGADKAVAEGKLEAAKPALEEAESALQTIKPADISTVKKLAKPPHLIMRIMDCVLLLFRKKIDTVTMDPERPCLKPSWAEALKLMSG-DFLGALLNFPKDTINAETVEFLMPYFEMEDYNIETAKKVSGNVAGLCSWTTAMATFFGINKEVLPLKANLVVQEGRLEKAMAELNQAQALLDEKQRELDVVQALYDKAMAEKQALMDDAEACRRKMSNATTLIEGLSGERIRWTEASKGFEAQIQRLVGDVLLATAFLSYSGPFNQDFRNLLQRNWKKELVQNKIPYTEDLNLISMLVDNATISEWNLQGLPNDELSTQNGLIVTRAARFPLLIDPQGQGKAWIKNKEKNNELQLTSLNHKYFRTHLEDSLSLGRPMIIEDVGEELDPALDNILERNFIKSGTRLKVKVGDKECDVMDGFRLYITTKLPNPKYTPEIYAKTSMIDFTVTMKGLEDQLLGVVIVTEKAELETERVKLMEDVTANKRKMQELEDNLLYRLTSTEGSLVEDESLIEVLRVTKITAEDVREKLAVAADTEIKINTAREEYRPIATRGSLLYFLIVEMSMVNVMYQTSLRQFLGLFDLSMARSTKSPITLKRIANIIDYLTFEVFRYTARGLYEVDKFTFTILLTLKLEMQSGHVKHDEFSIFIKGGAALDLNAVEPKPKKWIQDLIWLNLVELSKLAHFNLLTEQITKNDKPWKTWCDEDAPEECVIPDGYDKASTFHKLLLVRSITPDRTIPMAKRYVAEIMGAQYADGVITNLETMAEEADCRTPMICFLSMGSDPTENIERLAKKQGIQSGAISMGQGQEVHARRLLQASMSEGRWILLQNCHLGLNFMDELLDTVTTAES-HENFRCWITTEPHRSFPINMLQSSIKFTYDPPQGIRAGLRRTYGLLTQDQLDVSNMPQWKPILYSVAFMHTVVQERRKFGPIGWNIPYEFNQSDFSATVQFVQNHLDDMDIKRGVSWVTVRYMIGEVQYGGRVTDDYDKRLLNTYARR----EHVHGVFQFNKGYKIPKCKQIDEYRAFVDALPLVDAPDVFGLHANADVTYQTNNANSMLETILNIQPKDSGAGGAGETRESIVYRQCDDMLAKLPEDYNPFEVRDKLRKMDHLKPLHIFLKQEIDRMQRVISNVRSTLTDLKLAIDGTIIMSENLQDALDNMFDARIPNLWRKISWESATLGFWFTDLLDRNAQFHTWLFDGRPSTYWMTGFFNPQGFLTAMRQEITRAHKGWALDSVFLMNDVTKLAKEEVHNPPAEGVYVYGLFLDGAGWDRRNARLTEPPAKVLYTSLPVVHIYAINTERP------KSSNLYECPVYKKPKRTDLNYIFPLLLRTSKDPDHWILRGVALLCDTK 4755          
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A1S3K0Z9 (dynein heavy chain 5, axonemal-like OS=Lingula unguis OX=7574 GN=LOC106177909 PE=4 SV=1)

HSP 1 Score: 6468.26 bits (16780), Expect = 0.000e+0
Identity = 3215/4636 (69.35%), Postives = 3836/4636 (82.74%), Query Frame = 1
Query:  118 TDIAPPLVS-KEPNESNMAHVDNKTKPIQTNVRAQVVTKSVPKKIITGESXXXXXXXXXXXXXXXXXXVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVED-YSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRST--DKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPK--KPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHK-QIQ------ELEKLAEENND-DNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV----HGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKK---ALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            T++APPL+S K+  ES+ A     TK       A+ VT +    +++ E+ KE QK  K  KDERRL +D R+ ++ Q ++D     +T+VED +L D+K+G  E FF PN  +KLMF++Q+ + ++ YSRTD++S+   +  KKLFI TG +E L+GLC+ F++ T   K +T  N+A+++ F  +D S G +L   E  ++K++ P +++L+ WGS++  D  N++++EF E+L++F+N+L  A+++MD Q+ L  +     + +++ P+    A N+++ +EKLE LL  W KQI+QVL+ESEQ+RREADD+GP+AEL+YWKSR ++FNNLLE++K+ K   V+ +L+ AKS++L+ WRELDSRITDAANEAKDNVKYLYTLDKFFGPL KC+P  M E +PSL+NAIRMI+SIS YYNSSERMTSLFVKVTNQMITTCK ++  G SK+WD+ R EL + +  C  LNE Y+  F KTK+KL+E+  E+QFEFSENYIFGKF+ FCKRL+KI ++ N +E+++ L   +IEGI+++ VRYK+I D  KKK+YDILDHRK +FD DY +F  Q + L+ Q+Q F+D+WFE+++  DK L LL KFE+I    LD  +K+ KVL N+ + L+NVRK YQK+K++PP+ RNLPP++GKI+W+R L++KIE PM +FK+ RPEIL+  EA K+++NYNKMA VL+EFE++Y+ +W++ ++  K GL +SLL+R+P+ ++      VNFD  I EL+QEAKY++ LNL+IPE A RL  N + I      ++E+L EY  I+  +P ++ P+M+P   ++ E   PGL+ALTW S+ +  Y+     S+     L+K+VSDIL+ RIEAVL +M   ALCDLPEDEPIT++EFL +T +T  +AS+ L K+S+LVE +VND+++ LKMNL   +  NL+ E+ Y C  PDPK  K RCLECQPC YY +LN FTQ+NT+ LIKCTRL+LD IK+RLQ S+   S +   E++RP LFKAD++L IPN++ +P ++++Q  LNKAV  IL MS+ I QW HM LH + Q++      ELE    + +D D K+    ++K L+KLISDHKDVAK V QL  I++TFK++VQ +L+ F+ YS LW  +P+ KVKEF+ + P++SE   Q+KY+  +E EI     TY+VGAV+F ++P+K  L SE  +WK AY + LN KCA +MD IL+ FD   K L RP KDLDD+R+HMAAL+E+RE+EI+I+MTI PIEEAY ML +Y ++FNDGN+ERVD+L YG+ KL+TQA  VQ+HLL+IQP++K +L+  V+ F ++V +F  DYD++GPM QGI PREASDRL IYQ  FDELWRKY TYSGGEELFGL VTDYPD+QRIRKELNLLQKLY LYN VL+ VN YYDIAW EI+I+ IN +LLDFQNKCRKLPKALKEWQA++DLRKTIDDFNETCPLLE MS+ AMM RHW+RI +VTGH  +VD+DNFLLRNLMEAPLLANKE+IEDICISAVKEKDIEAKLK V NDWS Q+F F++FK+RGELLLKGD   E+VSLMEDSLM LG+L+SNRYNAPFKPKIQEWVQKLTGTTEIIENW++VQNLWIYLEAVFVGGDIAKQLPQEAKRF  IDKSW KIMQ+AHE  NVVQCCMGDDTL QLLPHLLEQLE+CQKSLTGYLEKKRL+F RFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTK+V FDEK YDKI+++ S E E + L+EP+ AQGNVE+WLGDLL+  RKSLHS+IRSASI+I D  F L EFE  F +QVGLLGIQM+WT D+E AL+ +K+DKKIMQATNQ+FLDILN LI +TT +LTK++RTK+ETLITIHVHQRDIFDDLV + I +  DFEWLKQSRFYFKEDTDQCI+SITDVDFIY NEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI++VLTCKKE+K  FIFTDGD VDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAII+RVKLASCGF QN +LSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKR NP+D E  IVMRVLRDMNLSKLVDEDE LFLSLIEDLFP M++    YP++ AAI K + +  LI H  W LKLIQL+ETQRVRHGMM LGPSGAGKTKCI+ LM+AMTDCG PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHK KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FEVHNIDNASPATVSRNGMV+MSSSILDW PIL+ WL  L+   A ++ I + F+ IF E Y+Y+ Q L+PKM  LEC YIRQAID+L GL+       D K+I  +HLEKLIV S+MWSLGALLEL++R KL+EF+ +KK   +L +P  + D+TIFEY+V   GEWEHW  RVPEYLYP+D  PEY SILVPNVDN RTD+LINTI+KQ K+VLLIGEQGTAKTV+VKGYCGK++PE  +FKS NFSSATT  M QRT+ES+VDKRMGTT+GPP G+KM IFIDD+NMP+INEWGDQ+TNEI RQMME  G Y+LEKPG+FT IVD+Q I+AMIHPGGGRNDIPQRLKRQF+IFNCTLPSNASIDKIF  +GCG+F  ERGF  DV  ++  LV ATR+LWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGML   S  I+  SK +SLWKHEC RVI DRFT QADKDWFEKT+K T EEECG    A L  EPYFVDF+Q+APE TGEE ++ +LEAPKIYE +E+ ++L+++L  + +QYNE++RG  +DLVFFKDAMTHLVKISRVI    GHALLVGVGGSGKQSLTRLASFI+GY+TFQITLT         SYN SNL+ED K+LYRT+GQ GKGITFLFTDNEIKDE FLE++NNML+SGE++NLFARDEMDEILQELV+VMK+E+PRRPP+NENL +YY+SR    LHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWFQRWPKDAL AVSN+FL+ F+IV TP+VK AVVN MG FQDLVAE C++YFQRFRR THVTPKSYLSFI+GYK +Y+ K+ E+G LA RMNTGLKKLVEATESVNELSKEL VKEKEL VA KKA  VL +V  KA+AA+KVK QVQ VKD+A+A+V+ IS DKAIAE KLEAA+PAL+EAE AL+TIKP HIATV+KLG+PPHLIMRIMDCVL+LF+KRL+ VT DPERPC KP+W +A+KLMS  NFL  L+ FPKD+IN E V+L+ PY  MED+NL SAK V GDVAGLCSWT+AM+ FF INKEVLPLKANL VQ+S+L  AM +L  AQ  LD KQKELD VQA Y+ AM EKQ L DDA+ACRRKMTNA ALI GLAGER RWTEASK F+ QI +LVGDVL+ T FLSY GPFNQ+FRN++ ++WK E+ TN IPF+DD+  +SML D ATI EWN++GLPNDELS+QNGLIVT+A R+PLLIDPQ QGK WI+++E  +ELQVT+LNHKYFR HLED+LSLGRPLLIEDV EE+DPALDNVLEKNFIKSGSTFKVKVGDKEVDVM+GF+LY+TTKL NP+YTPE+ AKTSIIDFTVT+KGLEDQLLG+VILTEK ELE+ERTKLME+V  NKRK +ELEDNLLYRLTSTEGSLVEDESLIEVL+ TK TA++V +KL I  +TEIKIN+AREE+RPVATRGSILYFLIVEMSMVN MYQTSLKQFLGLFD SMA S KSPIT KRI NIIEYLT+EVFRYT RG YE DKFTFTILLT+KI +  G+IK+EEFQ FIKGGAALDLNAVEPKP+KWI D+TWLNLVELSKLP F QI  QV +NDK WK WFD DAPEEA IPDGY  +L+TF+KLLLIRSW PDR +PMAKKY+ E+MG++FAE VI NL+ M EE D+  P+ICFLS+GSDPTD+IE+LAK+K+LKCG+ISMGQGQEVHAR+LLS+SMQEGRW+LLQNCHLGLNFMDE LEI+ TTE++H+ FRCW+TTE HPKFPIN+LQ  IKFT +PPLG++AGL+RTYA +TQ+QLDI+N  QW+PML+ VAFLHTTVQERRKFGPIGWNIPYEFNQSDF +TVQF QNHLDDMD KRGVSW+TV YMIGE+QYGGRVTDDYDKRLLNTYA+ WF   MF   F FYKGY IP  K+++EYR  I+++PL D+PE FGLH NADI Y+T+ AN ML TI+NIQPKDSGGG GETRE++VYRLADDML++LP DY+PFEV+++L+KMG L+PLNIFL+QE+DRMQ+VIS+VR+TLVDLKLAIDGTIIMSENL+DALDN+FDAR+P+FW K+SWESATLGFWFTDLLDRN QF +W+++GRP  FW+TGFFNPQGFLTAMRQEITR HKGWALD VVLSNDVTK MKED+ N PSEGVYVHGL+LDGAGW+ R+A+L EP PKVL+TPLPVVHVYA++   P     K N   YECPVYKKPRRTDL YIF L LKT + PDHWILRGV LLCD K
Sbjct:   27 TEVAPPLISVKKDEESSKAPKKGATKAQP----AKAVTGTKKSVVMSSEALKEMQKKAKINKDERRLQMDARYQYLIQRLSDAMGASVTEVEDFILSDDKFGMIENFFDPNGPRKLMFFHQEAVRDNVYSRTDASSVHNPNPVKKLFITTGETESLQGLCYFFLKLTVGGKGITVQNVASEVFFGFMDGSKG-VLSGFEGIMAKVLVPAIKSLDSWGSLN--DSSNAQVAEFLELLEKFVNSLSGARESMDGQVHLSEEGVGYQLDEMKTPADFQAAANNADAVEKLEELLMNWAKQIDQVLTESEQMRREADDIGPTAELAYWKSRTAKFNNLLEEIKSPKCKAVVGVLNCAKSKALKHWRELDSRITDAANEAKDNVKYLYTLDKFFGPLIKCSPSAMCELVPSLMNAIRMIYSISGYYNSSERMTSLFVKVTNQMITTCKGYIMRGSSKVWDIPRPELLQYLQECIHLNEAYQRHFQKTKEKLRENPHERQFEFSENYIFGKFDTFCKRLEKIGDMVNTMENFAGLGDIRIEGIETLAVRYKTIVDSAKKKSYDILDHRKGDFDADYLEFKNQIDGLQNQLQNFMDSWFERNLTTDKALVLLGKFERIKGANLDMNEKYMKVLMNYGRDLENVRKTYQKFKNEPPVPRNLPPVSGKIAWARQLYRKIEYPMKVFKK-RPEILRNNEAKKVIRNYNKMAAVLMEFEMLYHRSWYRAVDAAKAGLGASLLVRHPETKE----LYVNFDPQICELVQEAKYLQRLNLEIPESALRLCMNIDRINSNRIALEEMLQEYDGIVARIPHILLPLMQPFRDQVGEALLPGLMALTWNSLNLEAYLSNAYRSMSDLEKLVKQVSDILECRIEAVLAEMGSIALCDLPEDEPITVDEFLKLTGETCAQASDTLIKQSQLVESSVNDLVETLKMNLAPKDRVNLSPEESYACSSPDPKHKKQRCLECQPCSYYQLLNNFTQKNTDALIKCTRLSLDAIKKRLQMSNKYKSSEDSKEEERPPLFKADIILAIPNVMVRPTMEDMQTKLNKAVTTILDMSKVIPQWEHMKLHQRLQLKAIMVQNELEAAVSDKDDSDTKVIPQAAMKPLHKLISDHKDVAKIVVQLHNIVSTFKTEVQEVLNSFTKYSELWATDPEEKVKEFVASDPVMSEFEQQVKYYEHLEIEIEEIQGTYRVGAVIFLTDPIKLALKSETSAWKVAYGKNLNVKCAGQMDEILDFFDRTMKVLQRPCKDLDDIRAHMAALTEMRENEIRIDMTILPIEEAYAMLSRYNLFFNDGNAERVDTLSYGWKKLKTQALEVQNHLLKIQPEYKEDLLHRVEVFMQDVNTFYADYDTKGPMVQGIAPREASDRLNIYQATFDELWRKYQTYSGGEELFGLSVTDYPDLQRIRKELNLLQKLYSLYNLVLERVNGYYDIAWVEIDIEKINNELLDFQNKCRKLPKALKEWQAFEDLRKTIDDFNETCPLLEMMSNKAMMSRHWDRIASVTGHTLDVDADNFLLRNLMEAPLLANKEDIEDICISAVKEKDIEAKLKQVVNDWSGQNFQFANFKARGELLLKGDVVSELVSLMEDSLMVLGSLMSNRYNAPFKPKIQEWVQKLTGTTEIIENWMVVQNLWIYLEAVFVGGDIAKQLPQEAKRFGTIDKSWVKIMQKAHETTNVVQCCMGDDTLGQLLPHLLEQLEICQKSLTGYLEKKRLVFSRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKSVVFDEKQYDKIISLVSMEGETINLEEPVMAQGNVEVWLGDLLRNGRKSLHSIIRSASISIQDPSFNLLEFENMFAAQVGLLGIQMLWTADAETALSNAKSDKKIMQATNQKFLDILNILIEMTTTDLTKVDRTKYETLITIHVHQRDIFDDLVRMHIRSVGDFEWLKQSRFYFKEDTDQCIISITDVDFIYMNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKEKKPVFIFTDGDTVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIMRVKLASCGFQQNVMLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRSNPEDGESTIVMRVLRDMNLSKLVDEDEPLFLSLIEDLFPGMQLDKAGYPEVEAAIAKNVTEMGLIQHSAWILKLIQLYETQRVRHGMMALGPSGAGKTKCIHGLMKAMTDCGTPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKSKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKILFEVHNIDNASPATVSRNGMVFMSSSILDWSPILQGWL--LKRPPAQADVIFSLFEGIFPELYQYILQNLNPKMTILECMYIRQAIDVLEGLIPEKGDSKDDKDISKAHLEKLIVLSIMWSLGALLELDERKKLEEFLNNKKNDVSLDLPPVEGDETIFEYIVTSAGEWEHWRNRVPEYLYPSDSTPEYSSILVPNVDNVRTDYLINTIAKQGKSVLLIGEQGTAKTVMVKGYCGKFDPETFVFKSFNFSSATTAQMVQRTVESFVDKRMGTTYGPPAGKKMAIFIDDVNMPIINEWGDQVTNEITRQMMETHGFYNLEKPGEFTNIVDVQFISAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNASIDKIFLTVGCGHFVKERGFADDVVESIKTLVPATRRLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLKTISSSIDDASKAVSLWKHECYRVIADRFTMQADKDWFEKTVKQTCEEECGQATAALLHEEPYFVDFMQEAPEPTGEEADDADLEAPKIYELVETLDKLNEKLQAFQSQYNESIRGANMDLVFFKDAMTHLVKISRVIGMPGGHALLVGVGGSGKQSLTRLASFIAGYKTFQITLTR--------SYNASNLLEDFKVLYRTAGQQGKGITFLFTDNEIKDEGFLEYINNMLASGEVSNLFARDEMDEILQELVAVMKREFPRRPPTNENLYDYYLSRCRDNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFQRWPKDALQAVSNHFLANFDIVCTPQVKSAVVNVMGEFQDLVAEICVDYFQRFRRQTHVTPKSYLSFIAGYKSIYVTKKGEVGLLAQRMNTGLKKLVEATESVNELSKELVVKEKELAVASKKADVVLQEVTTKATAAEKVKAQVQKVKDKAQAIVDEISADKAIAEGKLEAARPALEEAESALQTIKPAHIATVRKLGKPPHLIMRIMDCVLLLFQKRLEPVTMDPERPCCKPSWGDALKLMSSGNFLGGLMGFPKDSINAETVELLAPYLEMEDYNLESAKKVCGDVAGLCSWTQAMSFFFGINKEVLPLKANLIVQESRLNSAMHDLGQAQAQLDEKQKELDEVQAMYDAAMREKQTLLDDADACRRKMTNATALIEGLAGERVRWTEASKQFEAQINRLVGDVLLATGFLSYTGPFNQEFRNLILKNWKKEMSTNKIPFSDDLNIVSMLVDPATIGEWNLEGLPNDELSIQNGLIVTKAARFPLLIDPQMQGKFWIKSREGKNELQVTSLNHKYFRTHLEDSLSLGRPLLIEDVAEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMEGFRLYITTKLANPAYTPEISAKTSIIDFTVTMKGLEDQLLGIVILTEKAELESERTKLMEDVTANKRKMQELEDNLLYRLTSTEGSLVEDESLIEVLKNTKVTAQEVSEKLSIAAETEIKINTAREEFRPVATRGSILYFLIVEMSMVNTMYQTSLKQFLGLFDISMARSVKSPITGKRIANIIEYLTFEVFRYTVRGLYEEDKFTFTILLTLKIEINQGRIKNEEFQTFIKGGAALDLNAVEPKPRKWILDMTWLNLVELSKLPQFGQILGQVGRNDKAWKAWFDEDAPEEATIPDGYTSSLDTFRKLLLIRSWSPDRVIPMAKKYVAESMGVQFAESVILNLDGMWEESDKRCPLICFLSLGSDPTDSIEKLAKQKSLKCGAISMGQGQEVHARRLLSISMQEGRWVLLQNCHLGLNFMDELLEIVLTTESVHDQFRCWITTEPHPKFPINLLQSSIKFTNEPPLGVKAGLKRTYAGITQEQLDISNMPQWRPMLYGVAFLHTTVQERRKFGPIGWNIPYEFNQSDFNATVQFCQNHLDDMDPKRGVSWQTVRYMIGEIQYGGRVTDDYDKRLLNTYARVWFGENMFADSFHFYKGYKIPKCKTIEEYRNNIEQMPLQDTPEVFGLHPNADITYQTNTANSMLATIMNIQPKDSGGGGGETRETIVYRLADDMLEKLPPDYSPFEVRDRLKKMGQLQPLNIFLRQEIDRMQRVISVVRTTLVDLKLAIDGTIIMSENLRDALDNMFDARVPNFWKKISWESATLGFWFTDLLDRNAQFSTWIFDGRPTYFWLTGFFNPQGFLTAMRQEITRAHKGWALDGVVLSNDVTKMMKEDITNPPSEGVYVHGLFLDGAGWDRRNARLMEPSPKVLFTPLPVVHVYAINTERP-----KGN-NLYECPVYKKPRRTDLTYIFALLLKTVKDPDHWILRGVGLLCDTK 4634          
BLAST of Dynein heavy chain axonemal-like vs. TrEMBL
Match: A0A2R2MR46 (dynein heavy chain 5, axonemal OS=Lingula unguis OX=7574 GN=LOC106157149 PE=4 SV=1)

HSP 1 Score: 6458.63 bits (16755), Expect = 0.000e+0
Identity = 3186/4562 (69.84%), Postives = 3797/4562 (83.23%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVED-YSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRST--DKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPK--KPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHK-QIQELEKLAEENND-DNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV----HGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKK---ALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D R+ ++ Q ++D     +T+VED +L D+K+G  E FF PN  +KLMF++Q+ + ++ YSRTD++S+   +  KKLFI TG +E L+G C+ F++ T   K +T  N+A+++ F  +D S G +L   E  ++K++ P +++L+ WGS++  D  N++++EF E+L++F+N+L  A+++MD Q+ L  +     + +++  +    A N+++ +EKLE LL  W KQI+QVL+ESEQ+RREADD+GP+AEL+YWKSR ++FNNLLE++K+ K   V+ +L+ AKS++L+ WRELDSRITDAANEAKDNVKYLYTLDKFFGPL KC+P  M E +PSL+NAIRMI+SIS YYNSSERMTSLFVKVTNQMITTCK ++  G SK+WD+ R EL + +  C  LNE Y+  F KTK+KL+E+  E+QFEFSENYIFGKF+ FCKRL+KI ++ N +E+++ L   +IEGI+++ VRYK+I D  KKK+YDILDHRK +FD DY +F  Q + L+ Q+Q F+D+WFE+++  DK L LL KFE+I    LD  +K+ KVL N+ + L+NVRK YQK+K++PP+ RNLPP++GKI+W+R L++KIE PM +FK+ RPEIL+  EA K+++NYNKMA VL+EFE++Y+ +W++ ++  K GL +SLL+R+P+ ++      VNFD  I EL+QEAKY++ LNL+IPE A RL  N + I      ++E+L EY  I+  +P ++ P+M+P   ++ E   PGL+ALTW S+ +  Y+     S+     L+K+VSDIL+ RIEAVL +M   ALCDLPEDEPIT++EFL +T +T  +AS+ L K+S+LVE +VND+++ LKMNL   +  NL+ E+ Y C  PDPK  K RCLECQPC YY +LN FTQ+NT+ LIKCTRL+LD IK+RLQ S+   S +   E++RP LFKAD++L IPN++ +P ++++Q  LNKAV  IL MS+ I QW HM LH + Q++ELE    + +D D K+    ++K L+KLISDHKDVAK V QL  I++TFK++VQ +L+ F+ YS LW  +P+ KVKEF+ + P++SE   Q+KY+  +E EI     TY+VGAV+F ++P+K  L SE  +WK AY + LN KCA +MD IL+ FD   K L RP KDLDD+R+HMAAL+E+RE+EI+I+MTI PIEEAY ML +Y ++FNDGN+ERVD+L YG+ KL+TQA  VQ+HLL+IQP++K +L+  V+ F ++V +F  DYD++GPM QGI PREASDRL IYQ  FDELWRKY TYSGGEELFGL VTDYPD+QRIRKELNLLQKLY LYN VL+ VN YYDIAW EI+I+ IN +LLDFQNKCRKLPKALKEWQA++DLRKTIDDFNETCPLLE MS+ AMM RHW+RI +VTGH  +VD+DNFLLRNLMEAPLLANKE+IEDICISAVKEKDIEAKLK V NDWS Q+F F++FK+RGELLLKGD   E+VSLMEDSLM LG+L+SNRYNAPFKPKIQEWVQKLTGTTEIIENW++VQNLWIYLEAVFVGGDIAKQLPQEAKRF  IDKSW KIMQ+AHE  NVVQCCMGDDTL QLLPHLLEQLE+CQKSLTGYLEKKRL+F RFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTK+V FDEK YDKI+++ S E E + L+EP+ AQGNVE+WLGDLL+  RKSLHS+IRSASI+I D  F L EFE  F +QVGLLGIQM+WT D+E AL+ +K+DKKIMQATNQ+FLDILN LI +TT +LTK++RTK+ETLITIHVHQRDIFDDLV + I +  DFEWLKQSRFYFKEDTDQCI+SITDVDFIY NEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI++VLTCKKE+K  FIFTDGD VDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAII+RVKLASCGF QN +LSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKR NP+D E  IVMRVLRDMNLSKLVDEDE LFLSLIEDLFP M++    YP++ AAI K + +  LI H  W LKLIQL+ETQRVRHGMM LGPSGAGKTKCI+ LM+AMTDCG PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHK KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN KI+FEVHNIDNASPATVSRNGMV+MSSSILDW PIL+ WL  L+   A ++ I + F+ IF E Y+Y+ Q+L+PKM  LEC YIRQAID+L GL+       D K+I  +HLEKLIV S+MWSLGALLEL++R KL+EF+ +KK   +L +P  + D+TIFEY+V   GEWEHW  RVPEYLYP+D  PEY SILVPNVDN RTD+LINTI+KQ K+VLLIGEQGTAKTV+VKGYCGK++PE  +FKS NFSSATT  M QRT+ES+VDKRMGTT+GPP G+KM IFIDD+NMP+INEWGDQ+TNEI RQMME  G Y+LEKPG+FT IVD+Q I+AMIHPGGGRNDIPQRLKRQF+IFNCTLPSNASIDKIF  +GCG+F  ERGF  DV  ++  LV ATR+LWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGML   S  I+  SK +SLWKHEC RVI DRFT QADKDWFEKT+K T EEECG    A L  EPYFVDF+Q+APE TGEE ++ +LEAPKIYE +E+ ++L+++L  + +QYNE++RG  +DLVFFKDAMTHLVKISRVI    GHALLVGVGGSGKQSLTRLASFI+GY+TFQITLT         SYN SNL+ED K+LYRT+GQ GKGITFLFTDNEIKDE FLE++NNML+SGE++NLFARDEMDEILQELV+VMK+E+PRRPP+NENL +YY+SR    LHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWFQRWPKDAL AVSN+FL+ F+IV TP+VK AVVN MG FQDLVAE C++YFQRFRR THVTPKSYLSFI+GYK +Y+ K+ E+G LA RMNTGLKKLVEATESVNELSKEL VKEKEL VA KKA  VL +V  KA+AA+KVK QVQ VKD+A+A+V+ IS DKAIAE KLEAA+PAL+EAE AL+TIKP HIATV+KLG+PPHLIMRIMDCVL+LF+KRL+ VT DPERPC KP+W +A+KLMS  NFL  L+ FPKD+IN E V+L+ PY  MED+NL SAK V GDVAGLCSWT+AM+ FF INKEVLPLKANL VQ+S+L  AM +L  AQ  LD KQKELD VQA Y+ AM EKQ L DDA+ACRRKMTNA ALI GLAGER RWTEASK F+ QI +LVGDVL+ T FLSY GPFNQ+FRN++ ++WK E+ TN IPF+DD+  +SML D ATI EWN++GLPNDELS+QNGLIVT+A R+PLLIDPQ QGK WI+++E  +ELQVT+LNHKYFR HLED+LSLGRPLLIEDV EE+DPALDNVLEKNFIKSGSTFKVKVGDKEVDVM+GF+LY+TTKL NP+YTPE+ AKTSIIDFTVT+KGLEDQLLG+VILTEK ELE+ERTKLME+V  NKRK +ELEDNLLYRLTSTEGSLVEDESLIEVL+ TK TA++V +KL I  +TEIKIN+AREE+RPVATRGSILYFLIVEMSMVN MYQTSLKQFLGLFD SMA S KSPIT KRI NIIEYLT+EVFRYT RG YE DKFTFTILLT+KI +  G+IK+EEFQ FIKGGAALDLNAVEPKP+KWI D+TWLNLVELSKLP F QI  QV +NDK WK WFD DAPEEA IPDGY  +L+TF+KLLLIRSW PDR +PMAKKY+ E+MG++FAE VI NL+ M EE D+  P+ICFLS+GSDPTD+IE+LAK+K+LKCG+ISMGQGQEVHAR+LLS+SMQEGRW+LLQNCHLGLNFMDE LEI+ TTE++H+ FRCW+TTE HPKFPIN+LQ  IKFT +PPLG++AGL+RTYA +TQ+QLDI+N  QW+PML+ VAFLHTTVQERRKFGPIGWNIPYEFNQSDF +TVQF QNHLDDMD KRGVSW+TV YMIGE+QYGGRVTDDYDKRLLNTYA+ WF   MF   F FYKGY IP  K+++EYR  I+++PL D+PE FGLH NADI Y+T+ AN ML TI+NIQPKDSGGG GETRE++VYRLADDML++LP DY+PFEV+++L+KMG L+PLNIFL+QE+DRMQ+VIS+VR+TLVDLKLAIDGTIIMSENL+DALDN+FDAR+P+FW K+SWESATLGFWFTDLLDRN QF +W+++GRP  FW+TGFFNPQGFLTAMRQEITR HKGWALD VVLSNDVTK MKED+ N PSEGVYVHGL+LDGAGW+ R+A+L EP PKVL+TPLPVVHVYA++   P     K N   YECPVYKKPRRTDL YIF L LKT + PDHWILRGV LLCD K
Sbjct:   24 MDARYQYLIQRLSDAMGASVTEVEDFILSDDKFGMIENFFDPNGPRKLMFFHQEAVRDNVYSRTDASSVHNPNPVKKLFITTGETESLQGTCYFFLKLTVGGKGITVQNVASEVFFGFMDGSKG-VLSGFEGIMAKVLVPAIKSLDSWGSLN--DSSNAQVAEFLELLEKFVNSLSGARESMDGQVHLSEEGVGYQLDEMKTAADFQAAANNADAVEKLEELLMNWAKQIDQVLTESEQMRREADDIGPTAELAYWKSRTAKFNNLLEEIKSPKCKAVVGVLNCAKSKALKHWRELDSRITDAANEAKDNVKYLYTLDKFFGPLIKCSPSAMCELVPSLMNAIRMIYSISGYYNSSERMTSLFVKVTNQMITTCKGYIMRGSSKVWDIPRPELLQYLQECIHLNEAYQRHFQKTKEKLRENPHERQFEFSENYIFGKFDTFCKRLEKIGDMVNTMENFAGLGDIRIEGIETLAVRYKTIVDSAKKKSYDILDHRKGDFDADYLEFKNQIDGLQNQLQNFMDSWFERNLTTDKALVLLGKFERIKGANLDMNEKYMKVLMNYGRDLENVRKTYQKFKNEPPVPRNLPPVSGKIAWARQLYRKIEYPMKVFKK-RPEILRNNEAKKVIRNYNKMAAVLMEFEMLYHRSWYRAVDAAKAGLGASLLVRHPETKE----LYVNFDPQICELVQEAKYLQRLNLEIPESALRLCMNIDRINSNRIALEEMLQEYDGIVARIPHILLPLMQPFRDQVGEALLPGLMALTWNSLNLEAYLSNAYRSMSDLEKLVKQVSDILECRIEAVLAEMGSIALCDLPEDEPITVDEFLKLTGETCAQASDTLIKQSQLVESSVNDLVETLKMNLAPKDRVNLSPEESYACSSPDPKHKKQRCLECQPCSYYQLLNNFTQKNTDALIKCTRLSLDAIKKRLQMSNKYKSSEDSKEEERPPLFKADIILAIPNVMVRPTMEDMQTKLNKAVTTILDMSKVIPQWEHMKLHQRLQLKELEAAVSDKDDSDTKVIPQAAMKPLHKLISDHKDVAKIVVQLHNIVSTFKTEVQEVLNSFTKYSELWATDPEEKVKEFVASDPVMSEFEQQVKYYEHLEIEIEEIQGTYRVGAVIFLTDPIKLALKSETSAWKVAYGKNLNVKCAGQMDEILDFFDRTMKVLQRPCKDLDDIRAHMAALTEMRENEIRIDMTILPIEEAYAMLSRYNLFFNDGNAERVDTLSYGWKKLKTQALEVQNHLLKIQPEYKEDLLHRVEVFMQDVNTFYADYDTKGPMVQGIAPREASDRLNIYQATFDELWRKYQTYSGGEELFGLSVTDYPDLQRIRKELNLLQKLYSLYNLVLERVNGYYDIAWVEIDIEKINNELLDFQNKCRKLPKALKEWQAFEDLRKTIDDFNETCPLLEMMSNKAMMSRHWDRIASVTGHTLDVDADNFLLRNLMEAPLLANKEDIEDICISAVKEKDIEAKLKQVVNDWSGQNFQFANFKARGELLLKGDVVSELVSLMEDSLMVLGSLMSNRYNAPFKPKIQEWVQKLTGTTEIIENWMVVQNLWIYLEAVFVGGDIAKQLPQEAKRFGTIDKSWVKIMQKAHETTNVVQCCMGDDTLGQLLPHLLEQLEICQKSLTGYLEKKRLVFSRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKSVVFDEKQYDKIISLVSMEGETINLEEPVMAQGNVEVWLGDLLRNGRKSLHSIIRSASISIQDPSFNLLEFENMFAAQVGLLGIQMLWTADAETALSNAKSDKKIMQATNQKFLDILNILIEMTTTDLTKVDRTKYETLITIHVHQRDIFDDLVRMHIRSVGDFEWLKQSRFYFKEDTDQCIISITDVDFIYMNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKEKKPVFIFTDGDTVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIMRVKLASCGFQQNVMLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRSNPEDGESTIVMRVLRDMNLSKLVDEDEPLFLSLIEDLFPGMQLDKAGYPEVEAAIAKNVTEMGLIQHSAWILKLIQLYETQRVRHGMMALGPSGAGKTKCIHGLMKAMTDCGTPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKSKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKILFEVHNIDNASPATVSRNGMVFMSSSILDWSPILQGWL--LKRPPAQADVIFSLFEGIFPELYQYILQSLNPKMTILECMYIRQAIDVLEGLIPEKGDSKDDKDISKAHLEKLIVLSIMWSLGALLELDERKKLEEFLNNKKNDVSLDLPPVEGDETIFEYIVTSAGEWEHWRNRVPEYLYPSDSTPEYSSILVPNVDNVRTDYLINTIAKQGKSVLLIGEQGTAKTVMVKGYCGKFDPETFVFKSFNFSSATTAQMVQRTVESFVDKRMGTTYGPPAGKKMAIFIDDVNMPIINEWGDQVTNEITRQMMETHGFYNLEKPGEFTNIVDVQFISAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNASIDKIFLTVGCGHFVKERGFADDVVESIKTLVPATRRLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLKTISSSIDDASKAVSLWKHECYRVIADRFTMQADKDWFEKTVKQTCEEECGQATAALLHEEPYFVDFMQEAPEPTGEEADDADLEAPKIYELVETLDKLNEKLQAFQSQYNESIRGANMDLVFFKDAMTHLVKISRVIGMPGGHALLVGVGGSGKQSLTRLASFIAGYKTFQITLTR--------SYNASNLLEDFKVLYRTAGQQGKGITFLFTDNEIKDEGFLEYINNMLASGEVSNLFARDEMDEILQELVAVMKREFPRRPPTNENLYDYYLSRCRDNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFQRWPKDALQAVSNHFLANFDIVCTPQVKSAVVNVMGEFQDLVAEICVDYFQRFRRQTHVTPKSYLSFIAGYKSIYVTKKGEVGLLAQRMNTGLKKLVEATESVNELSKELVVKEKELAVASKKADVVLQEVTTKATAAEKVKAQVQKVKDKAQAIVDEISADKAIAEGKLEAARPALEEAESALQTIKPAHIATVRKLGKPPHLIMRIMDCVLLLFQKRLEPVTMDPERPCCKPSWGDALKLMSSGNFLGGLMGFPKDSINAETVELLAPYLEMEDYNLESAKKVCGDVAGLCSWTQAMSFFFGINKEVLPLKANLIVQESRLNSAMHDLGQAQAQLDEKQKELDEVQAMYDAAMREKQTLLDDADACRRKMTNATALIEGLAGERVRWTEASKQFEAQINRLVGDVLLATGFLSYTGPFNQEFRNLILKNWKKEMSTNKIPFSDDLNIVSMLVDPATIGEWNLEGLPNDELSIQNGLIVTKAARFPLLIDPQMQGKFWIKSREGKNELQVTSLNHKYFRTHLEDSLSLGRPLLIEDVAEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMEGFRLYITTKLANPAYTPEISAKTSIIDFTVTMKGLEDQLLGIVILTEKAELESERTKLMEDVTANKRKMQELEDNLLYRLTSTEGSLVEDESLIEVLKNTKVTAQEVSEKLSIAAETEIKINTAREEFRPVATRGSILYFLIVEMSMVNTMYQTSLKQFLGLFDISMARSVKSPITGKRIANIIEYLTFEVFRYTVRGLYEEDKFTFTILLTLKIEINQGRIKNEEFQTFIKGGAALDLNAVEPKPRKWILDMTWLNLVELSKLPQFGQILGQVGRNDKAWKAWFDEDAPEEATIPDGYTSSLDTFRKLLLIRSWSPDRVIPMAKKYVAESMGVQFAESVILNLDGMWEESDKRCPLICFLSLGSDPTDSIEKLAKQKSLKCGAISMGQGQEVHARRLLSISMQEGRWVLLQNCHLGLNFMDELLEIVLTTESVHDQFRCWITTEPHPKFPINLLQSSIKFTNEPPLGVKAGLKRTYAGITQEQLDISNMPQWRPMLYGVAFLHTTVQERRKFGPIGWNIPYEFNQSDFNATVQFCQNHLDDMDPKRGVSWQTVRYMIGEIQYGGRVTDDYDKRLLNTYARVWFGENMFADSFHFYKGYKIPKCKTIEEYRNNIEQMPLQDTPEVFGLHPNADITYQTNTANSMLATIMNIQPKDSGGGGGETRETIVYRLADDMLEKLPPDYSPFEVRDRLKKMGQLQPLNIFLRQEIDRMQRVISVVRTTLVDLKLAIDGTIIMSENLRDALDNMFDARVPNFWKKISWESATLGFWFTDLLDRNAQFSTWIFDGRPTYFWLTGFFNPQGFLTAMRQEITRAHKGWALDGVVLSNDVTKMMKEDITNPPSEGVYVHGLFLDGAGWDRRNARLMEPSPKVLFTPLPVVHVYAINTERP-----KGN-NLYECPVYKKPRRTDLTYIFALLLKTVKDPDHWILRGVGLLCDTK 4561          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4672.46 bits (12118), Expect = 0.000e+0
Identity = 2366/3670 (64.47%), Postives = 2884/3670 (78.58%), Query Frame = 1
Query: 3004 LNYFTQRNTETL---IKCTRLTLDTIKRRLQSSSNKFSIDPMNE--DKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQW----THMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFK-LFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK-EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA--LPVPICKDD--DTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEV--VAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            ++ F  R T  L   + C+    DT+      S++  +  P  +  + +P +F+A + L IP+I+  P LDE+Q  LNKAV+ ++ +++ + QW    + + +   Q+                  P   K+  K +S++K++ K VS LS  +N+ K +++  L  FS Y  +W+++ ++ ++EF Q  P+L+E  +QI Y+ D+E EI++ P    VGA+  Y+  LK  L +E   W   +      K   EM+ +    D  SK+L+RP+KDLDD+R  MAAL E+RE +I I+  + PIEE+Y ML+KYE+       E+VD+L Y + KL  ++  VQ+ L+ +QP F+GELI  V+ F E+   F  +YD  GPM  G+ P++ASDRL ++Q +FD L+RK+ T++GGEELFGL VT +P +  IRK+L LLQKLY LYNNV++TVN YYD+ W++++I+ IN +LLDFQ +CRKLP+ALKEWQA+ DL+KTIDDF+E CPLLE M++ AMM RHW+RI  VTGH FEV++D F LRN+MEAPLL  KEEIEDICISAVKE+DIE KLK V  +W  ++F+F+ FK+RGELLL+GD+T EI+S MEDSLM LG+L+SNRYN PFK +IQ+WVQ L+ TT+IIENW+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+PNVVQ C+GD+T+ QLLPHLL+QLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN K+V F    +DK   +N                          + +S++  H  I           FK +F+F     +QVGLLGIQMIWT+DSEEALT ++ D+KIM  T Q FL++LN LI +TT++L  +ERTK+ETLITIHVHQ+DIFDDL  L I +P DFEWLKQ RFYF ED D+ +++ITDV F YQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRIYKGLAQSGSWGCFDEFNRI+L VLSVAAQQI+VVLT KKERK  F FTDGD+V+M+PEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDR IIIRVKLASCGF+ N  L++KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP +++    YP++ AAIDKQ+ +A LINH PWRLK+IQLFETQRVRHGMM LGPSGAGK+ CI+ LM+AMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW++LDGPVDAIWIENLNSVLDDN+TLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+L+W PIL  WL+  + +   S  + + F   F   Y++  Q+L  KM  LE   I Q I++L GL+   D   E+   H+E+L VF++MWS+GALLE +DR K++ ++ H  +  L +P    D  DT+F+Y V + G+W HW  RV EY+YP D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KGY  K NPE    KSLNFSSATTP MFQR++ESYVDKRMGTT+GPP G+KM+IFIDDINMPVINEWGDQ+TNEIVRQ+ME  G ++LEKPG+FT IVDIQ +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF ++G G++C++RGF+ DV+  V+ LV  TR+LWQ TK+KMLPTPA FHY+FNLRDLSRIWQGML VN+DVI++   L+ LWKHEC RVI DRFT   D  WF+  L    EEE G E   V   + + YFVDFLQDAPEATGEE E  + + PK+YEPI S+  L DRL  ++  YNE++RG  +DLVFF DAM HLVKISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY  FQITLT         SYN +NLMEDLK LYRT+GQ GKGI+F+ TDNEIKDESFLE++NN+LSSGE++NLFARDEMDEIL +L+ VMK+E+PRRPP+NENL EY+MSRV + LHVVLCFSP           FP LISGCT+DWF RWPKDAL+AVS +FLS+++I  TP+VK  VV  MG FQD VAE C++YFQR+RR THVTP SYLSFI GYK +Y +K  E    A  MNTGL+KL EA+ESV  LSKEL VKEKEL++A +KA  VL +V VKA AA+KVK +VQ VKD+A+A+V++IS DKAIA+EKLEAAKPAL+EAE AL+TIKP  IATV+ L RPPHLIMRIMDCVL+LF++RL++V  D E+ C  P+W E++KLM+  NFL SL  FPKDTIN+EVV+L+ PYF+M D+N+ +AK V G+VAGLCSWTKAMA+FFSIN+EVLPLKANL VQ+++L  A  +L  AQ  LDAKQ ELD+VQAEY KA+ EKQ L +DAE CR KM  A +LI GLAGE+ RWTE SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FRN+L   W+ E+    IPF  ++    ML D  T+SEWN+QGLPND+LS+QNG+IVT+A R+PLLIDPQ QGK WIRNKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLEKNFIK+GST+KVKVGDKEVDVMKGF+LYVTTKLPNP+YTPE+ A+TSIIDFTVT++GLEDQLLG VILTEKQELE +R  L+E+V  NKRK KELED+LLYRLTST+GSLV+DESLI VL  TK T+E+V QKL I  +TE+KIN+AREEYRPVATRGSILYFLI EMSMVN MYQTSL+QFLGLFD S+A S KSPITSKRI NIIE++TYEV  Y ARG YE  KF FT+LLT+KI M+S +IKHEEF   IKGGA+LDL A  PKP KWI D+TWLNLVELSKL  F  I +Q+ +++K W++WFD +APEE  IP+ YD +L+ FK+LLLIRSWCPDRT+  A+KYI ++MG R+AEGVI +LE   EE D  TP+IC LSMGSDPTD I  L K++ ++   +SMGQGQEVHARKLL   M  G W LLQNCHLGL+F+DE ++ +T T++IHESFR W+TTE H  FPI +LQ+ IKFT +PP G++AGL+RTY  + Q+ LD++N  QW+PML+ VAFLH+TVQERRK+GP+GW+IPYEFNQ+DF +TVQFVQNHLDDMD+KRGVSW TV YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MFN +F FYK Y IP   S+D+Y  +I  LP  D+PE FGLH NADI Y++  A  +L TI++IQPKDS  G GETRE+ V RLADDML++LP DY+PFEV ++L+ MG L+P+NIFL+QE+DRMQ+V+++VRSTL DLKLAIDGTI+MSENL+DALD ++DARIP+ W K SW S+TLGFWFT+LL+RN+QF +W++EGRP CFWMTGFFNPQGFLTAMRQEITR +KGWALD +VL N+VT++MK+D+   P EGVYV+GLYL+GAGW+ R+ +L +  PKVL+  +PVV +YA   NN V D      R Y CP+YKKP RTD N I  ++L+T++ P++WILRGVALLCD+K
Sbjct:  597 IDKFLSRVTAALGNGVHCSSTLWDTV-----GSADTEADSPSRQKINSQPPIFRAGVCLAIPSIVMVPGLDEVQQALNKAVEYVVSVNKGVGQWNGSTSDISVSAHQVL-----------------PFQAKNYYKSVSENKEIVKLVSVLSTSINSSK-KMKNALERFSRYHHIWRKDRESTIQEFSQGNPLLAEFESQILYYKDLELEINAEPEFITVGALALYTADLKLALTAETKGWMLDFGHHCKRKYRTEMEQVFTFVDEASKKLNRPIKDLDDIRIAMAALKEIREHQITIDFQVGPIEESYAMLNKYELSVAKEEMEKVDTLRYTWEKLLARSSEVQNELVSLQPNFRGELISNVQTFVEDCDHFYQEYDKDGPMVMGLAPQDASDRLIMFQNRFDNLYRKFVTFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIETVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVF----HDKTRRVNH-------------------------VLISKQVKHHCIL----------FKVMFKF-VFLLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLM--KRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPKDQGGELSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTR--------SYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLESVKFA--MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA--ENNGVKDS-----RLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGVALLCDVK 4173          

HSP 2 Score: 511.146 bits (1315), Expect = 2.803e-144
Identity = 274/665 (41.20%), Postives = 411/665 (61.80%), Query Frame = 1
Query:  661 MLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMY-EGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESL 2649
            M+D +G  LL + E+ +S++  P L+N+   WG +++      K  +F   L+ F++ L  AQ++++ ++   N       A +     R +++   E         H      EQVL+ES+Q+R+E DD+GP AEL +WK RMSRFN LL+Q+K+  V  V+ +L  AKS+ ++ WRELD RITD+ANEAKDNVKYLYTL++FF PL   NPV M+E I  LINAIRMIHSIS+YYN+SE++TSLFVKVTNQMIT CK ++   G + IWD  ++ +A++I    RLNEEY+ CFHKTK+KL++  +E+QF+FSE YIFGKF+ F +RL+KI  + + + +YS LQ  KIEG++++  R ++I   +KKK Y  LD R+++FD DY++F  Q   L              S+P                  L  ++K+ K  QN+S+ ++ V ++Y K K +PP+ RNLPP+AGKI WSR L+ +IE PM LF++  P +L  PEA ++++NYN++AK L+E+E+IY+  W   +   ++GL +SLL+R PD      +  VNFD  IL  I+E   I  + L+IP  A+ L   +N++K  Y  ++  L         + P    M+ PH+ ++DE   PGL +L W+S+ I  ++ +V  +L
Sbjct:    1 MMDTTGVGLLKSTEQLLSEVFIPTLRNMNHGWGELASPQAQTVK-QDFISSLESFVSVLAGAQESLEEKVTHLNTHHTHTHAHLHT-YIRSISIQLCE--------FH---GVAEQVLAESDQLRKEGDDLGPRAELDHWKKRMSRFNYLLDQLKSPDVKSVLGVLLMAKSKLIKTWRELDIRITDSANEAKDNVKYLYTLERFFDPLYNSNPVSMVEAIAGLINAIRMIHSISRYYNTSEKITSLFVKVTNQMITACKAYITNNGSATIWDQPQDVVAEKIRAAIRLNEEYQKCFHKTKQKLEQSPSERQFDFSEMYIFGKFDTFQRRLNKILTMFSTISTYSALQDSKIEGLETMATRLQNIVVTMKKKPYSFLDQRRTDFDQDYEEFCKQTTEL-------------LSIP-----------------DLGIEEKYQKAFQNYSRDIEMVSRIYTKQKMEPPIGRNLPPVAGKILWSRQLYLRIEEPMKLFQQ-HPNVLATPEAKRIIRNYNRVAKTLVEYEVIYHRGWMSQL--VRIGLQASLLVRCPDTR----ELYVNFDPQILTQIRETDCISRMGLEIPPFAAVLRQKQNVLKTHYNNLQVTLC-------GIQPAFEQMLTPHVAKVDEAILPGLTSLNWSSLNIDKFLSRVTAAL 608          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3679.8 bits (9541), Expect = 0.000e+0
Identity = 1823/2682 (67.97%), Postives = 2185/2682 (81.47%), Query Frame = 1
Query: 5941 CYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSE-AYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQ-QKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNL-ETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNH--KGWALDAVVLSNDVTKFMKEDVNNSPS---EGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            CYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMDYRGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK +K QFIFTDGDVVDMD EFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDRAII+RVKLAS GF  N VLS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP +SE  +VMRVLRDMN+SKLVDEDE LF+SLI DLFP + +    YPD+ AAI KQ E+A LI H PW LKL+QL+ETQRVRHGMMTLGPSG GKT CI+ L++AMTDCG PHKE+RMNPKAITA QMFG LDVATNDWTDG+FSTLWR+T K KKGE+ W++LDGPVDA+WIENLNSVLDDNKTLTLANGDRIPMAP  K++FE HNIDNASPATVSRNGMV+MSSS+L+W+PIL++WL  L  + A    ILN F   +S   Y Y+T+ +                                   + +L VF++MWS+GALLELEDR +++ F+  H  AL +P  + D TIFE+VVN+ GEW+ W+ +VPEY YP D +P+Y SILVPNVDNTRTDFL+ TI KQ KAVLLIGEQGT KTV++KGY  KY+PE  + KSLNFSSAT P+MFQ+T+ESY+DKRMG+T+GPP G+KMT+FIDDINMPVINEWGDQITNEIVRQ+ME  G YSLE+PG+F ++VD+Q++AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF  L  GYFC+ERGF   V      LV   R++WQ  K KMLP+PAKFHY+FNLRDLSRIWQGML V ++V      L+SL++HEC RVI DRF +Q D++ F+  L+    EE GS++V G+  E YFVDFL+DAPE TG+E E+TE+  PKIYEPI S+  LS+RL  ++ QYNE+VRG  +DLVFFKDAM HLVKISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY++FQI LT         +YN +NLMEDLK LYR +G  GKG+TF+F DN+IKDESFLE++ N+++SGE++NLF RDE+ EI Q+L+  MK+++PR PP+ +NL  Y++SRV   LHVVLCFSPVGEK  +R+++FPGLISGCT+DWFQRWPKDAL+AV+ +FLS + +  + EVK++V+ TMG FQDLVA+ C  YFQRFRR T+VTPKSYLSFI GY+ +Y +K   + TLA RMNTGL +L EA ++VNELSK LAVKEKELEVA KKA  VL +V VKA AA+KVK QVQ VKD+A+A+V+ I  DK +AE KLEAAKPAL  AE AL+TIKP  IATV+KLG+PPHLIMRIMD VL+LF++R+DSVT DPERPC +P+W EA+KLM+ S FL+ LLNF KDTIN+E+V+L+ PY +MED+NL +AK + G+VAGLCSWT+AMA FF INKEVLPLKANL +Q+++L  A  EL  AQE LDAKQKELD  Q  Y+ A+ EKQ+L +DAEACRRKM+NA ALI GL GE+ RWTE+S  F +QIK L GDVL+ T FLSY GPFNQ++RN+L + WK E+  N IP++     I+ML DNAT+ EWN+QGLPND+LS+QNG+IVT A RYPLLIDPQGQGK+WI+N+E NH+LQVT+LNHKYFR H+ED LSLG+PLLIEDVGEE+DP LDN+LEKNFI+SGST+KVKVGDKEVDVMK F LY+TTK+ NP+Y+PEV AKT+I+DFTVT+KGLEDQLLG VILTEKQELE+ER K++ EV  NKRK +ELEDNLLYRLTST+GSLVEDESLIEVLRVTK TAE+V  +KL++  +TEIKIN AREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLG+FD S+  S KS ITSKR+ NI+++LTYEVFRYT RG YE  KF FT+LLT+KI +++  I H EFQ  IKGGA+LDLN+VEPKP++WI D+TWLNLV LS L  F ++  QV++ND+GWK+WFD  APEEA +PDGY++L   F KLLLIRSWCPDRT+  A+ YI E++G R+AEGVI +++ M  E D+ TPM CFLSMGSDPT+NIERLAK K   C  ISMGQGQEVHAR+LL+ SM +G W+LLQNCHLGL+F+DE LE I T+ENI ESFR WVTTE HPKFPIN LQ  +KFT +PP GI+AGLRRTY+ +TQDQL+ITN  QW+P+LF VAFLHTTVQERRKFGP+GWNIPYEFNQ+DFTS+VQFVQNHL+D+D+K GV+W  + YM+GEVQYGGRVTDD DKRLLNT+ + WFS  MF  KF FY+GY IP+ K+L EY + ID LPL+D+PE  GLH NADI  +T+ A+++L+TI+NIQPKDS GG  ETRES V RLA++ML++LP DY   EV+  LQKMG ++P+ IFL+QE+DRMQ +I  VRSTL DLKLAIDGTIIMSE+L+DALD+++DAR+P  W + SW+SATLGFWFT+LL+RN+QFHSW + GRP  FW+TGFFNPQGFLTAMRQE TR +  KGW LD VVL NDVT+ M+EDV   P+    GVY++GL+LDGAGW+ R+ K+ E LPKVL+TPLPVVHVYAVS  +    K       Y CPVY+KPRRTDL +IF L L+T + PDHW LRG+ALLCD K
Sbjct:   12 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKPQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPSESEKTVVMRVLRDMNISKLVDEDEPLFMSLINDLFPGIVLDKAGYPDLEAAIVKQAEEAGLIAHQPWVLKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLLKAMTDCGTPHKELRMNPKAITASQMFGTLDVATNDWTDGVFSTLWRKTLKAKKGEYTWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIPMAPTCKVVFEPHNIDNASPATVSRNGMVFMSSSVLNWKPILQAWLKKLPASQA--ELILNFFNTFYSRLKYIYLTEKV-----------------------------------IGRLFVFAVMWSVGALLELEDRSRMEMFLRNHPAALDLPNTQQDQTIFEFVVNEAGEWDPWSVKVPEYHYPKDSVPDYSSILVPNVDNTRTDFLLQTIMKQGKAVLLIGEQGTGKTVMIKGYTTKYDPETHLSKSLNFSSATLPSMFQQTIESYIDKRMGSTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQGGFYSLERPGEFVSVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCSERGFTESVSSLAKALVPTIRRVWQTVKAKMLPSPAKFHYIFNLRDLSRIWQGMLTVGAEVCRDPEVLVSLFRHECTRVIADRFIDQNDRNVFDGILEKISTEEHGSDLVKGVAWEEYFVDFLRDAPEITGDEPEDTEVVIPKIYEPIPSFSALSERLTLFLQQYNESVRGSAMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASFIAGYQSFQIVLTR--------TYNATNLMEDLKTLYRIAGLQGKGVTFIFADNDIKDESFLEYMTNVVASGEVSNLFTRDEISEITQDLIPTMKQQHPRLPPTIDNLYSYFLSRVRSNLHVVLCFSPVGEKLGSRAVKFPGLISGCTVDWFQRWPKDALVAVAQHFLSGYSLQCSEEVKQSVIGTMGTFQDLVAQTCTEYFQRFRRQTYVTPKSYLSFIKGYQTIYSEKIGNVRTLAERMNTGLDRLKEAEQAVNELSKALAVKEKELEVASKKADAVLQEVAVKAQAAEKVKTQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALAAAEAALQTIKPADIATVRKLGKPPHLIMRIMDAVLLLFQRRVDSVTMDPERPCLRPSWAEALKLMNNSGFLSMLLNFNKDTINEEMVELLLPYLSMEDYNLEAAKRICGNVAGLCSWTEAMADFFGINKEVLPLKANLKLQEARLAVAQDELAKAQEQLDAKQKELDEAQELYDGAVSEKQSLLEDAEACRRKMSNAMALIDGLGGEKIRWTESSTEFQRQIKHLPGDVLLATGFLSYAGPFNQEYRNLLLQQWKKEMSGNHIPYSQSFNLITMLVDNATLGEWNLQGLPNDDLSIQNGIIVTSASRYPLLIDPQGQGKTWIKNREANHDLQVTSLNHKYFRAHIEDCLSLGKPLLIEDVGEELDPVLDNILEKNFIRSGSTYKVKVGDKEVDVMKEFTLYITTKMANPAYSPEVSAKTAIVDFTVTVKGLEDQLLGRVILTEKQELESERVKMLAEVTSNKRKMQELEDNLLYRLTSTQGSLVEDESLIEVLRVTKSTAEEVSLKKLLVAAETEIKINEAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDSSIEKSPKSQITSKRLINIMDFLTYEVFRYTVRGLYEDHKFLFTLLLTLKIDLQAKNISHPEFQALIKGGASLDLNSVEPKPRRWILDMTWLNLVHLSSLHPFSRLPSQVSQNDRGWKSWFDEAAPEEAPLPDGYESLLGAFHKLLLIRSWCPDRTIAQARHYITESIGQRYAEGVILDMDSMCTENDKRTPMTCFLSMGSDPTENIERLAKSKGFPCRPISMGQGQEVHARRLLAQSMADGGWLLLQNCHLGLDFLDELLETINTSENIAESFRVWVTTEVHPKFPINFLQSSVKFTNEPPQGIKAGLRRTYSSITQDQLEITNMPQWRPLLFAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLEDVDVKLGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFTRIWFSENMFGEKFCFYRGYTIPNAKTLPEYHSHIDALPLVDTPEVLGLHPNADISCQTNMASEILSTIINIQPKDSSGGGDETRESTVLRLANEMLEKLPPDYVAHEVRTHLQKMGLVQPMTIFLRQELDRMQNIIGCVRSTLTDLKLAIDGTIIMSEDLRDALDSVYDARVPKLWQRSSWDSATLGFWFTELLERNQQFHSWTFNGRPHQFWLTGFFNPQGFLTAMRQETTRMNLAKGWTLDTVVLLNDVTRMMREDVTGPPTGDVGGVYIYGLFLDGAGWDKRNCKILESLPKVLFTPLPVVHVYAVS--SATDPKRPQGVSLYPCPVYRKPRRTDLTFIFTLFLRTVQNPDHWTLRGLALLCDCK 2646          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 3658.61 bits (9486), Expect = 0.000e+0
Identity = 1835/2680 (68.47%), Postives = 2183/2680 (81.46%), Query Frame = 1
Query: 5941 CYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA--LPVPICKDD--DTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEV--VAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            CYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRIYKGLAQSGSWGCFDEFNRI+L VLSVAAQQI+VVLT KKERK  F FTDGD+V+M+PEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDR IIIRVKLASCGF+ N  L++KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IVMRVLRDMNLSKL+DEDE LFLSLIEDLFP +++    YP++ AAIDKQ+ +A LINH PWRLK+IQLFETQRVRHGMM LGPSGAGK+ CI+ LM+AMTDCG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW++LDGPVDAIWIENLNSVLDDN+TLTLANGDRIPMAPN KI+FE HNIDNASPATVSRNGMV+MSSS+L+W PIL  WL+  + +   S  + + F   F   Y++  Q+L  KM  LE   I Q I++L GL+      ++   H+E+L VF++MWS+GALLE +DR K++ ++ H  +  L +P    D  DT+F+Y V + G+W HW  RV EY+YP D  PEY SILVPNVDN RTDFLI TI+KQ KAVLLIGEQGTAKTVI+KGY  K NPE    KSLNFSSATTP MFQR++ESYVDKRMGTT+GPP G+KM+IFIDDINMPVINEWGDQ+TNEIVRQ+ME  G ++LEKPG+FT IVDIQ +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF   G G++C++RGF+ DV+  V+ LV  TR+LWQ TK+KMLPTPA FHY+FNLRDLSRIWQGML VN+DVI++   L+ LWKHEC RVI DRFT   D  WF+  L    EEE G E   V   + + YFVDFLQDAPEATGEE E  + + PK+YEPI S+  L DRL  ++  YNE++RG  +DLVFF DAM HLVKISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY  FQITLT         SYN +NLMEDLK LYRT+GQ GKGI+F+ TDNEIKDESFLE++NN+LSSGE++NLFARDEMDEIL +L+ VMK+E+PRRPP+NENL EY+MSRV + LHVVLCFSP           FP LISGCT+DWF RWPKDAL+AVS +FLS+++I  TP+VK  VV  MG FQD VAE C++YFQR+RR THVTP SYLSFI GYK +Y +K  E+ TLA RMNTGL+KL EA+ESV  LSKEL VKEKEL++A +KA  VL +V VKA AA+KVK +VQ VKD+A+A+V++IS DKAIA+EKLEAAKPAL+EAE AL+TIKP  IATV+ L RPPHLIMRIMDCVL+LF++RL++V  D E+ C  P+W E++KLM+  NFL SL  FPKDTIN+EVV+L+ PYF+M D+N+ +AK V G+VAGLCSWTKAMA+FFSIN+EVLPLKANL VQ+++L  A  +L  AQ  LDAKQ ELD+VQAEY KA+ EKQ L +DAE CR KM  A +LI GLAGE+ RWTE SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FRN+L   W+ E+    IPF  ++    ML D  T+SEWN+QGLPND+LS+QNG+IVT+A R+PLLIDPQ QGK WIRNKE  +ELQ+T+LNHKYFRNHLED+LSLGRPLLIEDVGEE+DPALDNVLEKNFIK+GST+KVKVGDKEVDVMKGF+LYVTTKLPNP+YTPE+ A+TSIIDFTVT++GLEDQLLG VILTEKQELE +R  L+E+V  NKRK KELED+LLYRLTST+GSLV+DESLI VL  TK T+E+V QKL I  +TE+KIN+AREEYRPVATRGSILYFLI EMSMVN MYQTSL+QFLGLFD S+A S KSPITSKRI NIIE++TYEV  Y ARG YE  KF FT+LLT+KI M+S +IKHEEF   IKGGA+LDL A  PKP KWI D+TWLNLVELSKL  F  I +Q+ +++K W++WFD +APEE  IP+ YD +L+ FK+LLLIRSWCPDRT+  A+KYI ++MG R+AEGVI +LE   EE D  TP+IC LSMGSDPTD I  L K+       +SM     +H     + + ++G W LLQNCHLGL+F+DE ++ +T T++IHESFR W+TTE H  FPI +LQ+ IKFT +PP G++AGL+RTY  + Q+ LD++N  QW+PML+ VAFLH+TVQERRK+GP+GW+IPYEFNQ+DF +TVQFVQNHLDDMD+KRGVSW TV YMIGE+QYGGRVTDDYDKRLLNT+AK WFS  MFN +F FYK Y IP   S+D+Y  +I  LP  D+PE FGLH NADI Y++  A  +L TI++IQPKDS  G GETRE+ V RLADDML++LP DY+PFEVK  L  MG L+P+NIFL+QE+DRMQ+V+++VRSTL DLKLAIDGTI+MSENL+DALD ++DARIP+ W K SW S+TLGFWFT+LL+RN+QF +W++EGRP CFWMTGFFNPQGFLTAMRQEITR +KGWALD +VL N+VT++MK+D+   P EGVYV+GLYL+GAGW+ R+ +L +  PKVL+  +PVV +YA   NN V D      R Y CP+YKKP RTD N I  ++L+T++ P++WILRGVALLCD+K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLM--KRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQ----PKLSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF---GTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTR--------SYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRHISTSRLLSMLFFSYIHTH---THTHEQGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVK-GLNTMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA--ENNGVKDS-----RLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGVALLCDVK 2659          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2023.44 bits (5241), Expect = 0.000e+0
Identity = 1231/3602 (34.18%), Postives = 1949/3602 (54.11%), Query Frame = 1
Query: 3367 KSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEI-----------NIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAIN--SQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSK--TDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC---GEPH----KEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTL-------ECNYI---RQAIDLLAGLVHGMDI--KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGE-WEHWTARVPE-YLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGS------EVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXD-------RAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKL---EFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFR-NILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKP-KKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNL-ETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCG--SISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIIT--TTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLD-ITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKF---SFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPK---DSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGR-PVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTD----LNYIFPLNLKTNEAP-DHWILRGVALLCDI 13956
            K ++ +I   +++ K  + ++  M    S +Q  L  +  +  +W+    + ++ +    P +S  ++ I  +S++   +        V  V+    PLK  L+  C+ W+  + Q L+   +  +  +       + RLS+P + L ++   +  L  L+    KIE  I PI E + +L KYE+       + +++L   +   +         L + + KFK  L    + FK+ + + + D++S GP    +    A +++++ + + + L  +  T   G  +F  E     D+Q + K+++ L ++++        ++  +D  W E            N+++  Q +    NK  +  K  K+W+  +  +  I+ F  T P++  +   AM  RHW +I+      F+ +S  F L  ++   L  + E I +I  +A KE  IE  L+ +   W   S   + +K +G        T E+   +ED+ + L  + ++R+   F+ ++  W + L+   E+IE  L VQ  W+YLE +F+G DI KQLP E+  F +I+ SW+ IM R ++  N ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN K++  ++   +K  A    S + E V+   P+  +G VE WL D+ +  R +L   +R+    +     K  ++   +P Q+ +   Q+ WT D  + L   K   DK  +++  ++ + +L+        NL+KI R K   L+T+ VH RD+ D L          F+WL Q R Y+++D D CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCSD +DY+ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+        FIF   D+  +    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L   GF    VL+KK +TLY L  +QLSKQ HYDFGLR + S+LR  G  +R  PD ++  I++  ++DMN++KL   D  LF  +I+DLFP ++  T  Y  +   I++++ Q+ L        K+IQL+ET+  RH  M +G +G+ K+    +L +A++     GEP      E  +NPKA++  +++G  D++TN+WTDG+ S+L R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W+P ++SW+      D      ++  K +F    RY+ +T+S K           E N +    +  D LA   +G++    E     +E   +FS++WS+ A ++ + R K+  F+   +        + DTI+EY V+ K + W  +  ++P+ + YP++    +  I+VP VD  R  FL+N++      VLL G  GT KT + +      +P +    ++N SS TT N  Q  +ES V+KR   T+ P GG+KM  F+DD+NMP ++++G Q   E++R  ++    Y      D    +D+ ++A+M  PGGGR  I  RL+ +F++ N T P+ + I  IF   G       + F+ +V+   + L  AT +L+     + LPTPAK HY+FNLRD+S+++QG+L  + D  ++   +  LW HEC RV +DR  +QAD + F   L     E+ GS        +   + +P F DFL++                P +YE +  ++ L   +   +  YN T     + LV F+DA+ H+ ++ RVI   +G+ LLVG+GGSG+QSL+RLA++I  Y  FQ+ +T          Y      ED+K LYR +G   K   FLF D +I DESFLE +NN+LSSGE+ NL+  DE +E+   L    +KE      + + +  Y + RV   LH+VLC SPVGE FRNR  ++P L++  T+DWF  WP+DAL+ V+  +L    + +  +++  V          VA+         +R  +VTP +YL  +SGYK++  +KR E+G   +++  GL K+ +    V  +S EL   +K++   +K+  E L  +  +   A + +  V    +       + +A+  N  RD       L+ A PAL+EA +ALE++  + +  +K  GRPP L+  +M  V+IL             R C +PTW EA + +  SNF+  L++F KD I+D V+  +  Y    DF       VS     LC W +AM  +  I + V P +A L    ++L   + A+ E  N +  ++ K K+L   + +Y++ +++K+ L   +E    K+  A  L+ GLAGER RW +  ++ +K +  LVGD L+  AFLSY GPF  ++R  +L   W  +     +P +      + L+    + +WNIQGLP+D  S +NG+IVTR  R+PL++DPQGQ   WI+N E    L+V  L    F   LE+A+  G P+L+++V EE+DP+L  +L K+F   G    +K+GDKEV+    FQ Y+TTKL NP YTPE+  KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  KRK +ELED +L  L    GSL++D  L+  L+ +K TA +V  +L     TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+ S+  SQ+S    +RI N+ +Y TY V+RYT RG +E  K  F+  +  KI   +G++  +E+  F++GG  LD       P   W+ D  W N+ EL KL  F  +     K  K W  W+ S  PE A +P  ++ +    +K+L++RS   DR       +I   +G RF E  + +++ + E+    TP+I  LS G DPT  + +LA+   +     ++S+GQGQ   A +++   ++ G W+ L NCHL L++M +  +++     E+ H  FR W+++  HP+FPI ILQ GIK T +PP G+++ ++R Y L+T+ Q    +    ++ +LF + F H+ + ER+KF  +GWNI Y FN SDF  +   +  +LD+ +    + W  + Y+I  V YGG VTDD+D+RLL TY  ++F     N  F   S    Y IP   S D YR +I +LP ++ PE FG H NADI  + S    +  T++++QP+    +  GAG +RE  V  ++ D+ Q++PE  +    ++ LQ   S  PLN+ L QE+ R   ++  +R++L +L+  I G ++MS +L++    I DAR+P  W K       L  W  DL  R EQF  W      PV FW++GF  P GFLTA+ Q   R H   ++D +     V+     ++   P +GV++ GLYL+GAGW+ +++ L E  P  L  P+P +H        PV ++ K  +  Y CP Y  P R+      +++  ++LK+     +HWI RG ALL  +
Sbjct:  913 KPVHNIIEQDEEICKIQAAIAAGMTANASHLQAYLKTWDKHREIWEINKDSFIRRYQHLNPPVSSFDSDIARYSEVANNVQKEETVLSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWE--------ISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKD-KQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKG--------TEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTH-HPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDIC-LVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWI------DKRQKMEVDHLKRLFD---RYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLREMEG----TFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSN--APFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWY------DRQMKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIF---GTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLA----EKLGSLFDLTYHNICPNKQQPIFGDFLKE----------------PHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQ--------YRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLE--TADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRD-------LDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL-------------RGC-EPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQL---KNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYE---EIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQKLLQDDPS--PLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNV-SVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHF------RPVENRKKVAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSL 4405          

HSP 2 Score: 86.6557 bits (213), Expect = 8.449e-16
Identity = 50/159 (31.45%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  931 VAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKV 1407
            VA    E ++++E ++  W +QI++VL+  E +    D  GP  E+ +WKSR S  + + +Q++   V  +  IL  AKS  +  +  L  +I D   +A+ N+ +L  L +    L+   P ++   +  +IN  R+I   S YYN+ ER+T+LF KV
Sbjct:  238 VAARDKELVKRMEVVMIHWTRQIKEVLNAQETVEI-GDSSGPLEEIDFWKSRCSDLSGISQQLQKPGVLHIQAILQLAKSSYVPPFCRLAKQIQDGTQQAQSNLSFLSLLREPCEELALLKPREVEPKLAHIINVSRVIWVNSVYYNTRERLTTLFRKV 395          

HSP 3 Score: 66.2402 bits (160), Expect = 1.093e-9
Identity = 76/336 (22.62%), Postives = 140/336 (41.67%), Query Frame = 1
Query: 1753 IIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQI---DCLKLDCQDKHAKVLQNFSKTLDNVRK-LYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYN-KMAKVLLEFELIYYNNWFKTIENFKL-GLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALC 2742
            +++     ILD R + + + Y  F  + + LE  +Q  ++T F+    +++ + LL  F+ +   + +K     K   V    SK +  V K L Q +                  W+R + ++I+G M +        L   E  K V+    ++ + L E     Y+ W ++++   L  L   L+IR   KEK G    +NFD  +L++  E  Y   L  +IP   S        ++     +  ++ +Y+ II ++      + R  I  +D+   PGL  L W+S    ++       +   RL   KV  I+D   E    ++A++  C
Sbjct:  441 VLRSVRKGILDVRNTSWHDSYNRFRAEVKDLEVMMQNLINTAFKTVNSVEEGVQLLDVFQHLSAREAIKRTLSRKTVDVYAMLSKEVYLVNKELSQAH------------------WARAMQRRIQGQMQVCVLENAHFLPQIENDKKVREACMQLLQKLDELVRRMYSEWSQSLDRGSLKNLNQPLMIRC--KEKAGM-LDINFDKNLLKMFNEMYYWERLQFEIPHHVSEAYQRREDLRTMRENVLLVVRDYNRIISALSADEVGLFRERIRFLDKKLQPGLSKLLWSSHGASNFF------ISECRLHASKVQLIVD---EYKAANLAISKHC 746          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1937.15 bits (5017), Expect = 0.000e+0
Identity = 1346/4430 (30.38%), Postives = 2247/4430 (50.72%), Query Frame = 1
Query:  919 SYRLVAVNSSETMEKLENLLHRWIKQIEQVLS-ESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDII--------------KKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSL-NLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMA--VTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPA---LFKADLVLHIPNILTKPNL-----DEIQVILNKAVQAILKMSENIEQWT-HMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQV-------QTLLSEFSGYS-TLWKEEPQTKVKEFM-QTKPILSEINAQIKYFSDMEAEIHSFPPTYKV-GAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLD--DVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIV-PREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGG-DIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTF----DEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTD-KKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEK-----LIVFSMMWSLGALL---ELED-RLKLQE-FITHKKALPVPICKDDDTIFEYVVN-DKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKP-TWDEAVKLMSGSN-FLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHEL--VTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEP---KPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKK-----KNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHL---GLNFMDEFLEIITTTENIHESFRCWVTT------EGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDI-TNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKD--SGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWES-ATLGFWFTDLLDRNEQFHSWLYE-GRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDI 13956
            S R+  +     +  +E+++  W  QI  VL  +S +   E  +  P  EL++WK+R +    + +Q K+ KVT +  +L   +S     +R +   +  A  EA D       ++ F  PL +     + E + S           +++ N  ER+  L   V   +    KH  Y   +++  L +E                 FC    ++ + ED      ++  N                  ++ +L   +++   K+E ++   VR +S++  +               +K+YD LD    EF+ D+ DF  + E  + ++ A     F+ S  ++    +         +++   +     L  +S                 P+ +N+P +AG + W++ L ++I+                  A K V                         E  +  L   L+ R+P          VNF+  ++ +++E KY+++  + DIP++ + +  N+ ++      +  ++  Y+++I +V  V FP+++  +  ID         + WTS  I +Y++ VRE++      ++K  D +D  I++++   A  V    D   D  + +E+     E+T  +     AK           I  +LK NL+                + DP            + + + Y  +           + +D     + SS  KF +D  N D++P    LF+A L L + +++  P+L     D    ++   +  + ++S  + +   H    H Q  ++E +A+             +  + +L+ +   V + ++Q     N F+          +  + +F  Y   L  EE +    E + +  P L     Q+  +  M  E+    P +   G +   +   K  L++    W   + Q L +     +  + E        L   V++ D   +   M  L  ++E +   +   +P++    +L  YE    D   ++++ L   +  ++ QA  V+ H+  +Q      L      F      F   +   GP    IV P E  D       + + +  K    +G   LF + + DY  +++ RKE+++L++L+ + + V   + ++    W EIN++ +  +   F  + R L K  + W A+  L  T+ +   +   + ++ + A+ PRHW+++ T TG +F +D ++  L +L+   L   ++E+  I   AVKE  +E  L  +   W+A  F + S       LLK D   ++V  +ED+ + L  L+S+++ A F  ++  W ++L+    +I  W  VQ  W +LE++F+G  DI  QLP+++KRF  ID  ++++   AH+ PNVV+       L   L  +  +L LC+K+L  YL+ KRL FPRF+F+S   LL+IL   +D H +Q HL  +FDNT  + F    D K     + + S+E E V  +EP +  G VE+WL  +L   R ++   +  A +   D   + + F+  +P+QV L   Q+ WT D   A ++ +   +  M+   ++ +  LN LI +    L+  +R K  T+ TI VH RD+   ++  K+   + F WL Q R  + E    C  +I D  F+Y  E+LG T RLVITPLTDRCYITL+Q+L +++ GAPAGPAGTGKTETTKD+GR LG  V VFNCS+QMDY+  G IYKGLAQ+G+WGCFDEFNRI + VLSV A Q+  +    +++K +F F  G+ +++ P  GIF+TMNPGYAGR ELPENLK  FR  AM+VPD  +I  + L + GF++  +L++KF TLY+LC+E LSKQ HYD+GLR I SVL   G+ KR +P+  E  ++MR LRD N+ K+V +D  +F+ LI DLFP + V  K   D    + + +   KL   D + LK++QL E   VRH +  +G +G GK++ +  L +   +         +NPKA+T  ++FG ++ AT +W DG+FS + R    V      W++LDG +D +WIE+LN+V+DDNK LTLA+ +RIP+ P  +++FE+ ++  A+PATVSR G++Y++ + L W P + SW+   E     +N       ++F +       TL  +   +     +  + +L  L+  +   E       K       VF+ +W+ G  L   +L D R++  + ++T  K +  P      T+F+Y ++ +  ++E W+  VP +   +  IP   + LV   +  R  + +  + ++ + ++L+G  GT K+V+V G  G  +P++   K++ F+  TT  M Q  LE  ++K+ G  +GPPG +++  FIDD+NMP ++ +G    + ++RQ M+    Y   K      I  +Q ++ M +P  G   I  RL+R FS+F  + P   +++ I+  +  G   +  GF   VQ +   LV       Q+     LPT  KFHY+FNLRDLS I+QGML   S+ + +   L+ ++ HE  RV  D+  E  D   F+K           SE+V     +    + L++A       +    +  P+ Y P++S+E L+  L++ +  YNE      ++LV F DAM+H+ +I+R++ + +G+ALLVGVGGSGKQSLTRLA+FIS  E FQITL           Y +++L  DL  L   +G    G  FL TD ++ DE FL  +N++L+SGEI +L+  DE++ I+  + + ++ +      S EN  ++++ RV + L V LCFSPVG K R RS +FP +++   IDWF  WP++AL +VS  FL   E +  PEVK +V   M      V +   +Y    RR  + TPKS+L  I  Y+ +   KR+++     R+  GL+KL   +  V++L  +LA +E +L+   + A  ++  V V+     + K      +++  ++   ++R +   EE L  A+PAL  A+EAL T+   ++  +K  G P   +  +   V++L           P    PK  +W  A  +M+  + FL SL+NF K+ I++  +  ++PY    +F        S   AGLCSW   +  F+ +  EV P +  L    ++L  A ++L+  +  ++   + L  + A++ KA  +K   + +AE   R ++ A  L+GGLA E  RW EA   F +Q + L GDVL++TAF+SY G F + +R+ ++  +WK  L  +   IP T  +  +SML D+A ++ W  +GLP D +S +N  I+T   R+PL++DPQ QG  WI+NK  ++ LQV  +  + + + +E ALS G  +LIE++ E +DP L  +L +  IK G    +K+GDKE +    F+L + TKL NP Y PE+ A+ ++++FTVT  GLEDQLL  V+  E+ +LE  ++ L ++    K   K LEDNLL RL+S  G+ + D  L+E L +TK TA ++++K+   + TE KIN ARE YRP A R S+LYF++ +++ ++ MYQ SLK F  +F K++  +       +R+ N+I+ +T  VF+YT RG +E DK T+T  L  +I + + +I   E    ++         V+P    P  ++   +W  +  L  +  F+ +   +  + K WK + + + PE+   P  + N  + +KL ++R+  PDR     + ++EE +G ++  G   +     EE    TPM   LS G DP  ++E+  +       N    ++S+GQGQEV A + L ++ +EG W++LQN HL    L  +++ LE     E   ++FR +++       EGH   P  IL+  IK T +PPLG+ A L +      QD L++     ++K +LF + + H  V ERRKFGP GWN  Y FN  D T +V  + N+L   +    V +  + Y+ GE+ YGG +TDD+D+RL  TY + +  PEM   +     G+P+P     + Y  +ID     +SP  +GLH NA+I + T  + ++  T++ +QP+D  SG G+G +R+  V  + ++ L++LPE++N  E+  K+++     P  +   QE +RM  +   ++ +L +L L + G + M+ ++++  + I+  ++P  W K ++ S   L  WFTDLL+R  +  SW  +   P   W+ GFFNPQ FLTA+ Q   R ++ W LD + L  DV K  +ED ++ P EG YVHGL+++GA W+ ++  + +   K L   +PV+ + AV V+       +     Y+CPVYK  R+    Y++  NLKT E P  W L GVALL  I
Sbjct:  174 SERIEHLVDKSIIHSIESMVIDWSHQIHGVLKRDSSEPLLEGTNPTPQVELNFWKNRYADLQCINDQFKSPKVTKMAQLLDVIESSYYPAYRNMVQDVERALEEATD-------INLFLKPLQR-----LTEDLES-----------TEFSNVKERIAPLMHTVC-LVWANSKH--YNTPARVIVLLQE-----------------FCNLFIQQSVFEDKRNSLSQYQRN-----------------GMEALL--LAVVDMMKLEKLEFGGVRGRSLSQQVVWLHEEFQERFKTFAEKSYDCLDVCNLEFEADFNDFKHKLEDTDRRLGAIFCQAFDDSGNLEHAFKI--------GVEVLFTNLFIVALPGYS-----------------PVNKNMPVVAGGLRWAQQLQERIQ---------------TTAACKSVG------------------------EKSQYNLNQPLISRDPTT----TLITVNFNPQLVSVLREVKYLKARESEDIPDLTADIYSNKELLWQYVANLDLMVGWYNKVIGTVLEVEFPLIQDQLRTIDLQLKEAEDTINWTSNGIWEYIQGVREAVHDLEKRLQKTKDNVD-EIQSIMKTWANPVFERKDGKNDSLLNLEDRPERLEKTYGQFRTSGAK-----------IHLLLKNNLS--------------LFKADPSSDE--------WRSYVEYIDE-----------MVIDGFFNSIDSSL-KFFLD--NTDQKPGLAPLFEAQLDLQVHDLVFHPSLEFGASDGFYDLVESLINDVYRISSLVPRLAEHSSFPHYQ-ADMEDMAD-------------LADMRQLLMER--VHRVMAQCCEHRNAFERYAYLYVDDRKEFMRQFLLYGHVLTTEEIEAHADEGVPEDPPTLERFREQVDSYERMYEEVQKLEPVHVFEGWMRVDARAFKSALLNIIKKWSLMFKQHLIDHVTNSLSELEEFIKCTEGGLGIKVEEGDYAGLVKVMGHLMAVKERQGATDEMFEPLQHTIDLLKTYEQELPDVVYKQLEELPEKWINMKKQAVVVKQHVAPLQASEVANLRRKCATFDVEQFKFREHFRKNGPFRFDIVNPYEMLDTTHKQIQEMESIMAKLIESAG---LFEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRFSKELRLLDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMD-EDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDE--DLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEAT-NKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFD--YPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFM-GEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQNMKRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKREIQSEKAN-----LTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCHKELYELYFVFAAIWAFGGALFQDQLVDYRVEFSKWWVTEFKTIKFP---SQGTVFDYYIDPETKKFEPWSKMVPRFEM-DPEIP-LQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKL-QLKEIHSVQYVSCM-NPTSGSFTINPRLQRHFSVFALSFPGVDALNTIYCSI-LGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDK---------LQSEMVGKFYED--MEEALEEAKVMNMYCHFALGIGEPR-YMPVQSWESLNKTLLEALDSYNEV--NAAMNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKK--------GYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQ--GLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIE-PEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMA---------PGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGDN-LQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKGRY--IKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLR-------YPVQPGVTSPVDFLSHHSWGGIKALCSMDEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKNKTSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLE--QHGEGSSQNFRVFISAEPSSSPEGH-IIPQGILENSIKITNEPPLGMHANLHKALDNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYL---EANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEGELYLAPGFPLPGNMDYNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGKVEERS---PYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNE-WPLDKMSLQCDVLKKNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDK------QETRNVYQCPVYKT-RQRGPTYVWTFNLKTKENPSKWTLAGVALLLQI 4325          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 4032.64 bits (10457), Expect = 0.000e+0
Identity = 2064/3470 (59.48%), Postives = 2637/3470 (75.99%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVED---YSRTDST--SIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISE-FFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNL----TESELKNLNAE-----------DGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKC-----TRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQ---------------------ELE-KLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINA----QGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFI-THKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGER 10569
            +D RH ++   +ADV   D   VEDA+L DE++   ++FF  N SK+LMF+ Q+        YSR + +   +G   +HK+LFI TG+ E   G C+ F+R+T+KA+++ N+A +I F +L+   G +L  +E  +S +M P L++ E WG +  K G N    E F + ++ F+ +L   ++N+  ++QL   D   +     IP +  V V ++E +E+LE  L  W+KQIEQVL ESEQIR+EAD+VGPSAEL YWK R SRFN+LLE++K+++V  V  +L  A+SRSL+ W+ELDSRIT+ A+EAKDNVKYLY+L+KFFGPL+K +PV +   I  L++ IRM+H+IS+YYNSSE MTSLFVKVTNQMI TCK ++++G  KIWD   + L +R+S C RLNEEY+ CFH+TK+ L++ +  +QFEFSENYIFGKF++FC RL K++++   ++S + LQ  +IEGID I +RY+++    K KTYD+LDHRKSEFD DY++F  Q E L   +Q F+D+WF  ++  +K L LL KFE+I   +L   +K+  VL  +++ +D VR+ YQK K +PP+ RN+PP++GKI W+R LF+KI+ PM      R ++L+  E    V+NYNKMA VLLEFEL+Y+  W + ++  +  L SSLL+R P K++    F VNFD  I EL+ EAK++  L   +PE    L   E  IK  +  + E L EY++ + S+PP++ P+M P +  +++   PGL  ++WTS+ I  Y+E+++ ++   +   K+V DI++ R+EA L DM+ T L  LPE+EP+ +  F++ TE  V  A++ LA +S  VE +V D++D+LK       T S+ ++++A             G      +P        Q  V+ ++  ++  +    L+K      TR +LD ++RRLQ++        + +   P LF  +++L IPN+L KP+LD++Q  LNKAV  +L M+++I  W + HL  KQ Q                     +LE ++A E  D+N +    + ++L+K I++HKDV K +  LS +++  + +   +L  FS +S+LW +EP+  VKEFM T P +SE NAQ+ Y++ +E ++   P  + VG V+  +EPLK  L+ EC +WK A+   LN K +   D +L   ++++K L+RP+ DL+DVR+ MAAL+ELR +EI++E  I P+EEA+ ML KY++ F D +++RVD L Y +  L TQ+  VQ+ L+ +QP  K +L+ GV  F +++ SF  DYD++GP   GI P+EASDRL + Q +FD+LWRK+TTYSGGEELFGL VTDYP++QRIR+EL LLQKLY LYN V+++V+ YY+I WS+++I+ IN +LLDFQNKCRKLPKALKEWQA++DL+K ID+FNETCPLLE M++ AMM RHWERI  VTGH F+++SD+F L+N+MEAPLL  K++IEDICISA KE+DI+AKLK V ++WS+Q F+F+ FKSRGELLLKG  T E V+LMEDSLM L +L+SNRYN PFKP IQ+WVQKL+ TTEIIENW++VQNLWIYLEAVFVGGDIAKQLPQEAKRF NIDKSWQKIMQRAHEIP +V CC+GD+TL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQAHLL +FDN   V F EK Y++IL+I SQE E+V L EP+ A    QGNVE WLG LL   R ++H+VIR A+  I D  FKL EF+TSFP+QVGLL  QMIWTRDSE AL  +K D+KIM ATNQ+FLD+LNELI +TT++LTK ER K+ETLITIHVHQ+DIFDDLV + I +  DFEWLKQSRFYF E+TD+C++ ITDVDF Y NE+LGCTDRLVITPLTDRCYITLSQALGMS+GGAPAGPAGTGKTETTKDMG+CLGK+VVVFNCSDQMDYRGLGRIYKGLAQSG+WGCFDEFNRIELPVLSVAAQQI +VL CKK ++ QF+FTDGD+V+MD EFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDRAII+RVKLAS GF  N +LS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP++ E  +VMRVLRDMNLSKLVDEDE LF+SLI DLFP + +    YP++  AI  Q + A L++H PW LK+IQL+ETQRVRHGMM LGPSGAGKT CI++LM+AMTDCGEPH+EMRMNPKAITAPQMFG LDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+LDW+PI+++WL  L T  A    + +T   +F +   +V   ++PKM  LEC YI+QAI+LL GL+   D + ++ SHL++L+VFS+MWS+GALLELEDR +++ F+  H   L +P   +DD+IFEYVV D G WEHW  RVPE+ YP D +PEY +ILVPNVDN RTDFL+  I KQ KAVLLIGEQGTAKTV++KGY  KY+ E  + KSLNFSSATTPNMFQRT+ESYVDKRMGTT+GPP GRKMTIFIDDINMP+INEWGDQITNEIVRQ+ME  G Y+LEKPG+FTTIVD+Q +AAMIHPGGGRNDIPQRLKRQF IFNCTLPSNASIDKIFR    G+FC ERGF  +V      LV  TR+LWQ TK+KMLPTPAKFHY+FNLRDLSRIWQGMLI+NS+V  S   L++L+ HEC+RVI DRFT Q DKDWF  T+     ++ G+   A ++ E YFVDF++DAPE TGEE ++ +LEAPK+YEPI S+ QL++RL  ++ QYNE+VRG  +DLVFF DAM HL+KISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY +FQITL+         +YN+SNLMEDLK LYR +GQ GKG+TF+FTDNEIKDE+FLE++NN+L+SGE++NLFARDE+DEI QEL+ V+KKE+PRRPP+NENL +Y++SRV   LHVVLCFSPVGEKFR R+L+FP LISGCT+DWFQ WP+DAL AV+ +FL+ + +  TPEVK+ VV+ M +FQD+VAE C+ YF+RFRR T+VTPKSYLSFI GYK +Y +K   +  L+ RM TGL KL EA +SV++LS+EL VKEKEL VA ++A EVL +V  KA AA+ VK+QVQ VKD+A+A+V+ I+ DKA+AE+KLEAAKPAL+EAE AL+TIKP  I TV+KL +PPHLIMRIMDCVL+LF++R+D+V  +PERPC +P+W EA KLM+ + FL SLL F KDTIN+E+VDL+ PY  MED+NL +A+NV G+VAGLCSWTKAM +FF INKEVLPLKANL +Q+S+L  A  EL+ AQ  LD KQ+ELD VQA Y+ A+ EKQ L DDAEACRRKM NA ALI GL GE+
Sbjct:   21 LDGRHKYLISKLADVLGQDEAAVEDAILADERFEQIKDFFVANGSKRLMFFCQESTQPRDTLYSRGEMSVSHVGSNVSHKRLFITTGADEAFAGTCYFFLRTTEKAISTANMAQEINFGVLECPEGDILQGVESFLSSLMIPALKSQETWGVI--KSGENDPAVEVFLDSVNYFMQSLSGVRQNIQQKVQLMEADLGTITYLCCIP-HCPVTVGNTEMVERLEAALRVWMKQIEQVLVESEQIRKEADNVGPSAELVYWKKRTSRFNSLLEELKSERVQKVTGLLQAARSRSLKHWKELDSRITEEASEAKDNVKYLYSLEKFFGPLAKYSPVSIKSGIEGLMSNIRMVHTISRYYNSSEHMTSLFVKVTNQMIATCKAYLHQGGGKIWDHDWDNLLQRMSECIRLNEEYQHCFHETKQHLRQSNNPRQFEFSENYIFGKFDSFCMRLRKLSDMLQTMQSLAGLQHVRIEGIDKIFLRYQALATNTKAKTYDVLDHRKSEFDIDYKEFCSQTEGLYQSLQTFVDSWFGDALKTEKMLELLGKFERIAGGRLQLMEKYQLVLHRYARDMDMVRRTYQKQKQNPPIPRNIPPVSGKIMWARQLFRKIDIPMKFLNNKR-DVLQTSEGKITVRNYNKMAAVLLEFELLYHRAWSRAVDLVRNSLLSSLLVRYPKKKE----FFVNFDLAIFELLMEAKHLHKLGFQVPEAVINLCQKEQQIKHHHTRLLEALQEYTQAVSSIPPILQPLMTPCVALVEDAILPGLTIISWTSLNIDTYIEEIQAAVVQLKQTTKQVVDIMECRVEATLYDMSFTPLLTLPEEEPLDMLAFMAATETMVASATKSLATQSDFVEKSVLDLLDLLKSACRAPTTTSQGRSVSATRRRSSAVSVQFPGTANTTQEPWGLATNIIQAEVFLSI--HYIYKTWSCLLKLSVRAGTRRSLDALRRRLQTAGPYAEQQRVQQGHMP-LFCTEIILAIPNVLLKPSLDDLQSSLNKAVNVMLGMAKDISVWKYAHLQQKQQQVRLIDQGSSQQNSSLGTYCCPQLEMQVARELGDENIVIKQINPRTLDKQITEHKDVGKVMFHLSSVLSFLRVESTEVLKNFSCFSSLWSQEPEEMVKEFMTTDPTMSEFNAQMVYYAQLEQQVQDLPAHFAVGPVLAMTEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPICDLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTMKADLLTGVAEFHKDLSSFQLDYDTQGPGEAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQA--QVLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLLPEADERRLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPSHLDLPGSANDDSIFEYVVGDSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHGTAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSR--------TYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGEK 3468          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2659.4 bits (6892), Expect = 0.000e+0
Identity = 1362/2030 (67.09%), Postives = 1636/2030 (80.59%), Query Frame = 1
Query: 4651 EDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA----LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQT--EPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHEL 10719
            +DICISAVKE+DIE KLK V  +W  ++F+F +FK+RGELLL+GD T EI++ MEDSLM LG+L+SNRYNAPFK +IQ+WV  L+ TT+IIENW+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+ NVVQCC+GD+T+ QLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F EKVYD+ILA+ S+E E VQLD+P+ A GNVE+WL  LLK S++SLH VIRSA++ + DS F L EF  S+P+QVGLLGIQ++WTRDSEEAL  ++ ++K M  TNQ FL +LN LI++TTQ+L+ +ER K+ETLITIHVHQRDIFDDL  + I +P DFEWLKQ RFYFKED D+ IV ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQI++VLTCKKER++QF FTDGD+V+M+PEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGFL N VL++KFYTLYKLCEEQLSKQV++ +G+  ++  L+T  A  + +   +     +R  R +++ K++DEDE LFLSLI+DLFP + +    YP + AAI++Q+EQA L+ H PW+LK+IQL+ETQ VRHGMM LGPSGAGKT CI+ LMRAMT+CG PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+LDW PIL  WL   + +     T+ + +   F E YRY   +LS KM TLE   I Q++++L GL+   D   E+   HL +L VF++MWS+ A LEL+DR +++ ++   ++    LP      +D++F+Y+V   G+W HW++RV EY YP DH PEY SILVPNVDN RTDFLI+ I+KQ K+VLL+GEQGTAKTV++KGY  KY+PE  + K+LNFSSATTP MFQRT+ESYVDK+MGTT+GPP G+K+T+FIDDINMP+INEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT IVD+Q +AAMIHPGGGRNDIPQRLKRQ SIFNCTLPSNASIDKIF ++G G++   RGF   V+     LV ATR+LWQ TKIKMLPTPAKFHYVFNLRDLSRIWQG+L   +DV++S   L+ L+KHEC RVI DRFT   D DWFE+ L     EE G+     L      +FVDFL+DAPEATG+E E+ + + PKIYEPI SY++L DRL  ++ QYNE+VRG ++DLVFF DAM HLVK   V+  T  +  L+   G   Q            +  Q  LT ++      SY+ SNL+EDLK+LYR +GQ GKGITFLFTDNEIKDE+FLE++NN+LSSGE++NLFARDEMDEIL EL  VMKK++PRRPP+ ENL E++M+RV   LHVVLCFSPVGE+FR R+LRFP LISGCT+DWF RWPKDAL+AVS +FLS++ +  T EVK+ VV  MG FQD VAE C +YFQRFRR THVTPKSYLSF+ GYK VY +K  E+ TLA RM  GL+KL EA+ESV  LS EL +KEKEL+VA +KA +VL +V VKA AA+KVK +VQ VK+ AE +V++IS DKA+AE+KL AAKPAL+EAE AL+TIK   IATV+ LGRPPHLIMRIMDCVL+LF++R++ V  DPER C  P+W E++KLM+  NFL SL  FPKDTI +E+V+L+ PYF+M D+N+ +A+ V G+VAGLCSWTKAMA FF INKEVLPLK+NL VQQ +L  AM +L +AQ  LDAKQ ELD+VQA Y KA+ EKQ L DDAE CRRKM  A  LI GLAGE+ERWT  SK F  QIK+LVGDVL+ TAFLSY GPFNQ+FRN+L   W+ EL
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWL--KQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDWAVPGVVRHDAQHIQFDLTFST------SYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQREL 2020          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2657.86 bits (6888), Expect = 0.000e+0
Identity = 1362/2030 (67.09%), Postives = 1638/2030 (80.69%), Query Frame = 1
Query: 4651 EDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA----LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQT--EPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHEL 10719
            +DICISAVKE+DIE KLK V  +W  ++F+F +FK+RGELLL+GD T EI++ MEDSLM LG+L+SNRYNAPFK +IQ+WV  L+ TT+IIENW+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+ NVVQCC+GD+T+ QLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F EKVYD+ILA+ S+E E VQLD+P+ A GNVE+WL  LLK S++SLH VIRSA++ + DS F L EF  S+P+QVGLLGIQ++WTRDSEEAL  ++ ++K M  TNQ FL +LN LI++TTQ+L+ +ER K+ETLITIHVHQRDIFDDL  + I +P DFEWLKQ RFYFKED D+ IV ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQI++VLTCKKER++QF FTDGD+V+M+PEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGFL N VL++KFYTLYKLCEEQLSKQV++ +G+  ++  L+T  A  + +   +     +R  R +++ K++DEDE LFLSLI+DLFP + +    YP + AAI++Q+EQA L+ H PW+LK+IQL+ETQ VRHGMM LGPSGAGKT CI+ LMRAMT+CG PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+LDW PIL  WL   + +     T+ + +   F E YRY   +LS KM TLE   I Q++++L GL+   D   E+   HL +L VF++MWS+ A LEL+DR +++ ++   ++    LP      +D++F+Y+V   G+W HW++RV EY YP DH PEY SILVPNVDN RTDFLI+ I+KQ K+VLL+GEQGTAKTV++KGY  KY+PE  + K+LNFSSATTP MFQRT+ESYVDK+MGTT+GPP G+K+T+FIDDINMP+INEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT IVD+Q +AAMIHPGGGRNDIPQRLKRQ SIFNCTLPSNASIDKIF ++G G++   RGF   V+     LV ATR+LWQ TKIKMLPTPAKFHYVFNLRDLSRIWQG+L   +DV++S   L+ L+KHEC RVI DRFT   D DWFE+ L     EE G+     L      +FVDFL+DAPEATG+E E+ + + PKIYEPI SY++L DRL  ++ QYNE+VRG ++DLVFF DAM HLVK   V+  T  +  L+   G   Q +   AS  +  +   +T       +   SY+ SNL+EDLK+LYR +GQ GKGITFLFTDNEIKDE+FLE++NN+LSSGE++NLFARDEMDEIL EL  VMKK++PRRPP+ ENL E++M+RV   LHVVLCFSPVGE+FR R+LRFP LISGCT+DWF RWPKDAL+AVS +FLS++ +  T EVK+ VV  MG FQD VAE C +YFQRFRR THVTPKSYLSF+ GYK VY +K  E+ TLA RM  GL+KL EA+ESV  LS EL +KEKEL+VA +KA +VL +V VKA AA+KVK +VQ VK+ AE +V++IS DKA+AE+KL AAKPAL+EAE AL+TIK   IATV+ LGRPPHLIMRIMDCVL+LF++R++ V  DPER C  P+W E++KLM+  NFL SL  FPKDTI +E+V+L+ PYF+M D+N+ +A+ V G+VAGLCSWTKAMA FF INKEVLPLK+NL VQQ +L  AM +L +AQ  LDAKQ ELD+VQA Y KA+ EKQ L DDAE CRRKM  A  LI GLAGE+ERWT  SK F  QIK+LVGDVL+ TAFLSY GPFNQ+FRN+L   W+ EL
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWL--KQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDILS-ASLRTDSDPAVLTPVVTPASR---SYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQREL 2022          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001365.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2633.98 bits (6826), Expect = 0.000e+0
Identity = 1368/2041 (67.03%), Postives = 1643/2041 (80.50%), Query Frame = 1
Query: 4651 EDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFG-LRNI-LSVLRTLGAFKRENPDDSEPFI--VMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMT--DCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA----LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQT--EPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKI-SRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETF-QITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLAT---RMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHEL 10719
            +DICISAVKE+DIE KLK V  +W  ++F+F +FK+RGELLL+GD T EI++ MEDSLM LG+L+SNRYNAPFK +IQ+WV  L+ TT+IIENW+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+ NVVQCC+GD+T+ QLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F EKVYD+ILA+ S+E E VQLD+P+ A GNVE+WL  LLK S++SLH VIRSA++ + DS F L EF  S+P+QVGLLGIQ++WTRDSEEAL  ++ ++K M  TNQ FL +LN LI++TTQ+L+ +ER K+ETLITIHVHQRDIFDDL  + I +P DFEWLKQ RFYFKED D+ IV ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQI++VLTCKKER++QF FTDGD+V+M+PEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGFL N VL++KFYTLYKLCEEQLSKQV++ +G L NI LS++ +L          ++P+    +R LR+  LS  +DEDE LFLSLI+DLFP + +    YP + AAI++Q+EQA L+ H PW+LK+IQL+ETQ VRHGMM LGPSGAGKT CI+ LMRAMT  +CG PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+LDW PIL  WL   + +     T+ + +   F E YRY   +LS KM TLE   I Q++++L GL+   D   E+   HL +L VF++MWS+ A LEL+DR +++ ++   ++    LP      +D++F+Y+V   G+W HW++RV EY YP DH PEY SILVPNVDN RTDFLI+ I+KQ K+VLL+GEQGTAKTV++KGY  KY+PE  + K+LNFSSATTP MFQRT+ESYVDK+MGTT+GPP G+K+T+FIDDINMP+INEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT IVD+Q +AAMIHPGGGRNDIPQRLKRQ SIFNCTLPSNASIDKIF ++G G++   RGF   V+     LV ATR+LWQ TKIKMLPTPAKFHYVFNLRDLSRIWQG+L   +DV++S   L+ L+KHEC RVI DRFT   D DWFE+ L     EE G+     L      +FVDFL+DAPEATG+E E+ + + PKIYEPI SY++L DRL  ++ QYNE+VRG ++DLVFF DAM HLVK  ++++ T      + GV     Q +    +F + +  F QITL+         SY+ SNL+EDLK+LYR +GQ GKGITFLFTDNEIKDE+FLE++NN+LSSGE++NLFARDEMDEIL EL  VMKK++PRRPP+ ENL E++M+RV   LHVVLCFSPVGE+FR R+LRFP LISGCT+DWF RWPKDAL+AVS +FLS++ +  T EVK+ VV  MG FQD VAE C +YFQRFRR THVTPKSYLSF+ GYK VY +KR  +  + T   RM  GL+KL EA+ESV  LS EL +KEKEL+VA +KA +VL +V VKA AA+KVK +VQ VK+ AE +V++IS DKA+AE+KL AAKPAL+EAE AL+TIK   IATV+ LGRPPHLIMRIMDCVL+LF++R++ V  DPER C  P+W E++KLM+  NFL SL  FPKDTI +E+V+L+ PYF+M D+N+ +A+ V G+VAGLCSWTKAMA FF INKEVLPLK+NL VQQ +L  AM +L +AQ  LDAKQ ELD+VQA Y KA+ EKQ L DDAE CRRKM  A  LI GLAGE+ERWT  SK F  QIK+LVGDVL+ TAFLSY GPFNQ+FRN+L   W+ EL
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILENILLSLIHSLSDSVIIRHLTAKPWAKRTLRALRNTGLSTPIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWL--KQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKKEAKLLVTAYCDWAVPGVVRHDAQHIQFDLTFSTLFPVFTQITLSR--------SYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKRLCVCVIYTWGDRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQREL 2031          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001375.1 (pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2613.18 bits (6772), Expect = 0.000e+0
Identity = 1359/2044 (66.49%), Postives = 1624/2044 (79.45%), Query Frame = 1
Query: 4651 EDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMT--DCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA----LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSK--------------------LMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQT--EPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNIL 10695
            +DICISAVKE+DIE KLK V  +W  ++F+F +FK+RGELLL+GD T EI++ MEDSLM LG+L+SNRYNAPFK +IQ+WV  L+ TT+IIENW+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE+ NVVQCC+GD+T+ QLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F EKVYD+ILA+ S+E E VQLD+P+ A GNVE+WL  LLK S++SLH VIRSA++ + DS F L EF  S+P+QVGLLGIQ++WTRDSEEAL  ++ ++K M  TNQ FL +LN LI++TTQ+L+ +ER K+ETLITIHVHQRDIFDDL  + I +P DFEWLKQ RFYFKED D+ IV ITDV FIYQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQI++VLTCKKER++QF FTDGD+V+M+PEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLASCGFL N VL++KFYTLYKLCEEQLSKQV++ +G+  ++  L+T G    +  D    F  + V  +   + L+DEDE LFLSLI+DLFP + +    YP + AAI++Q+EQA L+ H PW+LK+IQL+ETQ VRHGMM LGPSGAGKT CI+ LMRAMT  +CG PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+LDW PIL  WL   + +     T+ + +   F E YRY   +LS KM TLE   I Q++++L GL+   D   E+   HL +L VF++MWS+ A LEL+DR +++ ++   ++    LP      +D++F+Y+V   G+W HW++RV EY YP DH PEY SILVPNVDN RTDFLI+ I+KQ K+VLL+GEQGTAKTV++KGY  KY+PE  + K+LNFSSATTP MFQRT+ESYVDK+MGTT+GPP G+K+T+FIDDINMP+INEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT IVD+Q +AAMIHPGGGRNDIPQRLKRQ SIFNCTLPSNASIDKIF  L    F   RGF   V+     LV ATR+LWQ TKIKMLPTPAKFHYVFNLRDLSRIWQG+L   +DV++S  +                    L+ L+KHEC RVI DRFT   D DWFE+ L     EE G+     L      +FVDFL+DAPEATG+E E+ + + PKIYEPI SY++L DRL  ++ QYNE+VRG ++DLVFF DAM HLVK   V+  T  +  L+   G   Q +       S   T  +            SY+ SNL+EDLK+LYR +GQ GKGITFLFTDNEIKDE+FLE++NN+LSSGE++NLFARDEMDEIL EL  VMKK++PRRPP+ ENL E++M+RV   LHVVLCFSPVGE+FR R+LRFP LISGCT+DWF RWPKDAL+AVS +FLS++ +  T EVK+ VV  MG FQD VAE C +YFQRFRR THVTPKSYLSF+ GYK VY +K  E+ TLA RM  GL+KL EA+ESV  LS EL +KEKEL+VA +KA +VL +V VKA AA+KVK +VQ VK+ AE +V++IS DKA+AE+KL AAKPAL+EAE AL+TIK   IATV+ LGRPPHLIMRIMDCVL+LF++R++ V  DPER C  P+W E++KLM+  NFL SL  FPKDTI +E+V+L+ PYF+M D+N+ +A+ V G+VAGLCSWTKAMA FF INKEVLPLK+NL VQQ +L  AM +L +AQ  LDAKQ ELD+VQA Y KA+ EKQ L DDAE CRRKM  A  LI GLAGE+ERWT  SK F  QIK+LVGDVL+ TAFLSY GPFNQ+FRN+L
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCGPPISDARDRYNVFRPLAVNAETK-ANLIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWL--KQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGSLANSRFIAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPEESTAVDLCPVIRPAPPDRPQLLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDMLCDIDVRSANHTIYLL----------RSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLL 2029          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 644/2685 (23.99%), Postives = 1217/2685 (45.33%), Query Frame = 1
Query: 3952 VDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTG----HKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGG-DIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEI--WLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDK--KIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDT----DQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC-GEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHK----VKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTI----LNTFKLIFSEAYRYVTQ----TLSPKMVTL----ECNYIRQAIDLLAGLV-------HGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLE---SYVDKRMGTTFGPPGG-RKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGG-GRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSK-----LMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLD--LVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVST----PEVKKAVVNTMGI--FQDLVAENCI----NYFQRFRRLTHVTPKSYLSFISGYK---EVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNF-------PKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKA-------LIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAP-RYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKS-MALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTM 11772
            +D L   +S LR     V+  L + +      L EGV+       S    +  R P++  + P EA   L  +     +L +K  + +   ++  + V     +  + +E+     +++   N+ + V   ++  W  +++  +   L +F  +  +LP+A+K+++ Y  L   ++       +L ++   A+ PRHW  I    G     K  +D   F L+++M   L  N+  +  I   A KE  IE  L  +   W    +      S  +L+ + D   +     ++ L  L ++ ++ Y   F+    +   KLT  +EI  NW+ VQ  W+ L  +     DI   LP E  +F ++   ++ I  RA ++   ++  +        L   ++ L++ + SL+ +LE++R  FPRF+F+ +  LL+I+G       +   +  +F + +++ F E   D I  + S E E + L+E I  + +++   WL  L    + S+ +  R     + D    +    + +  Q  LL  Q++WT   E+ L  ++  K  K +    +  LD LN+    ++ N+ K    K E L+  ++H  ++   L            W K  +FY K DT    +   +S +     Y+ E++G  +RL+ TPL    + TL+ +L    GG   GPAGTGKTET K  G+ LG+ VVVFNC D  DY+ L R+  G+ Q G+WGCFDEFNR++  VLS  +  I  +    +  K+     + +   + P   +F+T+NPGY GR ELPENLK +FR  +M  P    I  + L   GF  +  L+ K     +L   + S   HY FGLR +  VLR       E  +  +   V+  L+ + L  L D DE +F   +  +F        +   +    D   +++     + +  K +Q +  Q+ +  ++ +G +G GKT     ++ AM    G  +    ++ K +T   ++G +  AT +W DG+F+++ RR +       K   IW++ D  +D  ++E +NSVLDDNK LTL NG+R+P+ PN +I+FE  N+D+ +PAT++R G+++ S+ +      +    L+ ++ +A+ N +    L+  K + S+++   +     T S  +V +      N +  A+ L   L+         +D K +K   +  LI  S++++L      E +    + I            D  TI   + NDK  +  + + +P  +    H      I++P +D  + + +   +    + ++L G  G+ KT+I+       N        +NFS  TT       L    +YV    G T  P    + + +F D+IN+P ++++G Q     +RQ+ME  G +   +   + TI  I I+ A   P   GR  + +R  R  +I     PS  S+ +I+ I    Y+       P+ +        A+  L+ + K +   T  + HY+F+ R+L+R+ +G+       IN+G +     L+ LW +E  R+  DR     +K+ FE+ L  T ++   ++ +  + +                                ++  E     L+ ++ +  +T    +L+  +V  +  + H+++I R ++  +GH +L+G   +GK  LTR  ++++G +  Q  +  +S        N+S+    LK               +  ++ I + +FLE +N +L++ +I +LF  +E D++L  L +   +       + + L ++++  + K LHVV           +  +  P L + C I+W   W    +  V+N  +    +  T    PEV K +V T  I   +D V    I    N++Q+ +    V P+S   FI G +   ++   K +++      +N GL+KL E+   VNEL+K L+ K  EL    K+A   L ++ ++ + +++ +E  + +K   +    +I + K +  + ++  +P + EA+  ++ IK Q +  ++ +  PP  +  +M+ V  +   +  +             W +  + +   +F+ +++++       P+     E   L +P F  E  N AS          L  W  A  +F  + + V PL+  +     ++EF  + L     +L A++   D+ +A    +  +   L  D EA + +M+N +A       L+  L  E+ERW   +K F K  ++L+G+ +I + + +Y G  N+  R  +    K  L    + +  +   I  L       +W   GL  ++  ++N  IV  +    P L+DP     + I N   N  + ++ L   + +  LE+A+  G  ++I+D GE  DP +  ++ + F  +G+   V++GD EVDV   F+L++ +  P+      + ++  ++ F    + +E ++  + +  E  E++ +R  L++   E K K K LE  LL  L +++G+++E++ L+  L   K+ A ++++KL    +   + ++  EEY  +      ++ ++ +    +  Y  S+ QFL  F +  +  S+++     R++ I+  L  EV+   +       KF   + +TM
Sbjct: 1118 IDQLDNDFSSLRQSLSYVEQELQKHRVVIAKSLEEGVENINNLSQSLNESWSVRKPISPTLTPPEALKILEFFNESITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHSSGLKLVREWDVLEQAC---KEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEV-IHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLE---DFITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGT-DIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNK----SSDNVKK----KIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEET-PLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKT--VVESLKRVILPSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQCLKDAG-QRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDH--LLNKSYEALDNKLSMFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDV-ITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIV--IANDKLSFSSFCSEIPS-VSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNN--ALRNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPE-NKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEI----YYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYT----AINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISS----------------------TSLLFSGLLSLDFKEVNKTDLVNFIEERFKTFCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHS--------NLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRN-KTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMK--VGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSN-------------WRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKA-----CGPLYQWVNAQINFSKVLENVDPLRQEM----KRIEF--ESLKTKANLLAAEEMTQDL-EASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVK-RLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTAL--DKKFKMIMAMTM 3702          

HSP 2 Score: 60.4622 bits (145), Expect = 8.229e-9
Identity = 54/224 (24.11%), Postives = 99/224 (44.20%), Query Frame = 1
Query: 12208 FLSMGS----DPTDNIERLAKKKNLKCGSISMGQGQEV-HARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEII---TTTENIHESFRCWVTTE-GHPKFPINILQLGIKFTYDPPLGIRAGLRRTYA--LLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYD 12846
            + +M S    D T  +  LAK        I +G  + + +A++ +S S  EG W+LLQN  + L+++  +L      T     HE F+ ++T      K P  +LQ   +F Y+   GI   ++  +     T     + + +      F +++ H  +  R +  P G++  Y FN  DF     +++N L   +    + W  V   I  + YGG++ ++ D
Sbjct: 3785 YFTMASERDVDGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGSQFFTGKISGVWSVY----CTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVL-ATNSTNNIPWAQVRDHIATIVYGGKIDEEKD 4003          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 5635.07 bits (14617), Expect = 0.000e+0
Identity = 2833/4643 (61.02%), Postives = 3535/4643 (76.14%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQ--DVMVEDYSRTDSTSIGPVSAHK-------KLFIATGSSEPLKGLCFLFIR-STDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYE-GVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQ--IDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPD-------PKKPRCLECQPCVYYAML------------------------------NYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKR-------PALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLN------------------------------------KLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNT-FKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGM-DIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH  +  T+A    L    + +A+L   +    E FF P+  +K+MFYYQ  D + E     +   +GP  A +       K+F+  G    L G C  FIR +  K + + NI  + +F +LD  G  +L+A+ER +  +  P L     WG +S K G + +  EF   L+ F+  L +AQ +++  + L+  D  DL + I  P+  + A +SSET+E++E ++  WIKQIEQVL+ESEQ+R+EADDVGP AEL +WK RM++FN+LL+Q+K      V+ +LH AKS+ L+ WRELD RITD ANEAKDNVK+LYTL+KF  PL   +PV M++ IP LINAIRMI+S S+YYN+SERMT+LFVKVTNQMIT CK+++ E G   +W+    EL +++ +C RLNEEY+ CF KTK++L+++  E+QFEFSE YIFGK   F +RL+KI  + N ++ +  L   +IEG++ +  + + I   +KKK YD+LD+RK EFD D+++F  Q   L+ Q+Q F+D  FEK     + L L++KFE   +D L+   Q+K+ ++L  F + ++ ++K+YQ++K+DPP+ R+LPPIAGKI+W+R ++++I+ PMI+F++  P IL+  +A K++KNYNK++KVLLEFEL+Y+  W K +E  K GL +SLL+R+PD +    K  VNFD  I+ LI+E + +  L LDIP  A  L+  ++ +K     ++ +L E   ++  +P    P+M PH+ +++    PGL  L WTS+ +  Y++ V ESL    LLI + +D++  RI+AVL++M+   LC+LP D P TIE+FL  TE   +  ++ L  +S  VE A N++I +L     E E K    +   E    +       P +P     +P    + L                              +YF  RN + +++ TR TLD+ +RR+ +S+    + P +  +        P LFKA++ L IPN+  +P LDEIQ  LNKA Q ++ +S+ + QW       + +++ EK  + +N+D++     +V S +                                    K +S++K+VAK +S LS ++N+ K +V T L  F+ YS++W+ +    +  F+Q  P LSE  AQI ++ +ME  I   P +Y VG++   +E LK  L +E  +W  ++++  N K   EM+ I    + ++KRLSRP+KDLDD+R  M AL E+R  EIKI+M I PIEE+Y ML +Y++      SERVD+L Y + KL++ A   QDHL+ IQ  FKG LI+ V+ F  +V SF GDY+S GPM   + PREASDRL I+Q +FD LWRKY TYSGGEELFGL VT+YP++ +I++ELNLLQKLY LYN+V+DTVN YYDI W ++NI+ INQ+LLDFQN+CRKLP+ALK+WQA+ DL+KTIDDFNE+CPLLE M++ AM  RHW+RI  +TGH F+++SD F LRN+MEAPLL +KE+IED+CI+AVKEKDIEAK+K V  DWS +  +F++FK+RGELLL+GD T EIVSLMEDSLM LG+L+SNRYNAPFK  IQ WVQKL+ TT+IIENW+ VQNLWIYLEAVFVGGDIAKQLP+EAKRF NIDK W KIM RAHE  NVVQCC+GD+TL QLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDSHTIQAHLL+VFDN K+V F EK YD+I+A+ S E E V++ +P+ AQGNVEIWLG LL MSR+SLH+VIR A + INDS F L EF  +FP+QVGLLGIQMIWTRD+ EALT +K DKK+MQ TN  F ++LN LI  TT+ LT++ RTKFETLITIHVHQRDIFDDL  + I TP DFEWLKQ RFYF +DTD C V+ITDV FIYQNEFLGCT+RLVITPLTDRCYITL+QAL MS+GGAPAGPAGTGKTETTKDMG+ LGK+VVVFNCSDQMDYRGLGRI+KGLAQSGSWGCFDEFNRI+LPVLSVAAQQI ++LT KKERK QFIF+DGDVVDM+PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR IIIRVKLASCGF+ N  LS+KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP DSE   VMRVLRDMNLSKL+DEDE LFLSLI DLFP + +    YP++  AI  + E+  LINH PWRLKLIQLFETQRVRHGMM LGPSGAGKTKCI+VLM+AMTDCG PHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKGE IW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P  KI+FE HNIDNASPATVSRNGMVYMSSS LDW+P++++W   +         ILN  F+  + E   ++ ++L  KM  L+ NYI Q + LL GL+    D  +  + HLE L VFS+MWS+GALLEL+DR K++ F+     L +P   +++ IFE++VND GEW HW  RV EY+YP DH+P+++SILVPNVDN   D+LI T+SKQ+KA LLIGEQGTAKTV++KGY  KY+PE+ + KS NFSSA+TP +FQRT+ES+VDKRMG+T+GPP G+KMT+F+DDINMP+INEWGDQ+TNEIVRQ+ME  G Y+LEKPGDFT I DIQ ++AMIHPGGGRNDIPQRLKRQF IFNCTLPSNASIDKIF ++G GYFC ERGF  DVQ     LV  TRKLWQ TK+KMLPTPAKFHY+FNLRDLSRIWQG+L   ++VINS   L+SLWKHEC RV++DRFT Q DKDWFEKT+K    +E G +    +    YFVDFL+DAPEATG+E E+ + E PKIYEPI S++ L +RL  YM  YN+++RG  +DLVFF+DAM HL+++SR+IRT +G+ALLVGVGGSGKQSLTRL+SFI+GY+TFQITLT         SYN SNLMEDLK LYRT+GQ G+GITF+FTDNEIKDE FLE+LNN+LSSGE++NLFARDE+DEI  EL+ VMKKE+PRRPP+ ENL EY+++R    LHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWF RWPKDALIAV+++FLS+F+IV T E+K  VV++MG+  D VA  C +YFQRFRR THVTPKSYLSFI+GYK +Y +KR EIG LA RM+TGL KL+EA++SV +LSKELAVKEKEL VA +KA +VL +V +KA AA+KVK QVQ VKD+A+A+V+ I+ DKA+AE KLE AKPAL+EAE AL+TIKP HI+TV+KL +PPHLIMRIMDCVL+L  K++D V  DPER   KP+W E++KLMS S+FL +LLNF KD+INDE V+L+  Y   +D+N+ +AK V GDVAGLCSWT+AM++FF INKEVLPLKANLAVQ+++L  A  +LN AQ  LD KQ ELD  QA Y  A+ EKQ L DDAEACRRKM  A ALI GL GE+ERWTE SK F +QI +LVGDVL+ T FLSY GPFNQ+FR +L  +W+ E+ +  IPFT ++    M+ D AT+ EWN+QGLPNDELSVQNG+IVT+A R+PLL+DPQGQGK+WI+N+EK++E+Q+T+LNHKYFR HLEDALSLGRPLLIEDVGEE+DPALDNVLEKNFIKSGST KVKVGDKEVDVMKGF LYVTTKLPNP+YTPE+ A+TSIIDFTVTIKGLEDQLLG+VILTEK ELE+ERTKL+E+V+ NKRK KELEDNLLYRLTST+GSLV+DESLIEVL VTK TAE+V QKL++  DTEIKIN AREE+RPVATRGSILYFLIVEMS VN MYQTSLKQFLGLF +SM  S  SPITSKRINNII+YLT+EV+RY+ RG +E+ KF FT+LL  KI +++ +IKH EF   IKGGA+LDL A  PK  +WI D+TWLNLVELSKL  F  I  Q+++N+K WK WFD DAPEEA IPDGY N L+TF+KLLLIRSWCPDRT+  A+KYI E+MG ++ E VI  LE+  EE D  TP+I FLSMGSDPT  IE LAKK    C +ISMGQGQEVHARKLL+  MQ G W LLQNCHLGL FM E ++ +  +E+IHE FR W+TTE H +FPI +LQ+ IKFT +PP G+RAGL+RTY  ++QDQLD++N  QW+PML+ VAFLH+TVQERRK+GP+GWNIPYEFNQ+DFT++VQFVQNHLDDMD+K+GVSW TV YM+GEVQYGGRVTDD+DKRLLNT+AK WFS  MF+P F+FYKGY IP G S+ ++   ID L L+DSPE FGLH NADI Y+++ A   L TI++IQPKDS  G GETRES+V+++ADDML++LPEDY   EVK +LQKMG L P+NIFL+QE+DRMQ+VI+ VR TL DLKLAIDGTIIMSE L+D+LD ++DARIP+ W K+SWES+T+GFWFT+L++RN QF +W ++GRP  FWMTGFFNPQGFLTAMRQE+TR HKGWALD+VVL NDVT+F K+D+   P+EGVYVHGL+LDGAGW+ R  KL EP  KVL+TP+PV+H+YA++           + R Y+CP+YKKPRRTDL YI  ++LKTN+ PDHWILRGVALLCDIK
Sbjct:    2 IDFRHDHLISTVASALGLAQDDLTEAMLDGNQIETMENFFKPDGLQKIMFYYQETDNIPE---AVEHVRLGPGGAQRTTIKTKPKVFVTDGKDNQLSGACVFFIRINPSKQINTANIYQETSFGVLDTRGDGMLNAVERVLGDVFIPALGKNSSWGELSDKQGSSVR-HEFMNQLESFVAILASAQASLEDAVTLKECDTVDL-SNINTPTDFIAAASSSETLEQIEAVVSAWIKQIEQVLAESEQMRKEADDVGPKAELDHWKKRMAKFNSLLDQIKGSDCKAVVGVLHAAKSKLLKTWRELDIRITDYANEAKDNVKFLYTLEKFCDPLYNSDPVGMMDGIPGLINAIRMINSYSRYYNTSERMTALFVKVTNQMITACKNYITEHGYKNVWEYTHSELIEKLGNCIRLNEEYQRCFQKTKQRLEQNPDERQFEFSEMYIFGKINTFSRRLNKIIEMMNTMQKFMTLGESRIEGLEQMWNKVQLIMTTMKKKPYDLLDYRKMEFDADFEEFKRQISELQAQLQNFMDICFEKIPSTQRALRLIRKFESLGLDSLRDTIQEKYERILIYFGRDIETIQKIYQRHKTDPPVARDLPPIAGKIAWARQMYRRIQEPMIMFQKY-PSILQTSDARKIIKNYNKLSKVLLEFELLYHQAWVKQVEVIKSGLQASLLVRHPDNK----KLFVNFDPQIMTLIRETECMVRLGLDIPFSAHALLQKQSSLKKNSDTLQLLLNERERVLGKIPQTFRPLMAPHLAKVEAAIDPGLTMLNWTSLNLDTYVDSVYESLGELELLIDRANDLVAFRIDAVLEEMSSVPLCELPTDTPKTIEQFLKTTEGLCKRGADLLETKSARVEEAANELITMLLELENEEEAKEDEKDKDEEKTGEEEKDRSRSPTRPHTGSSRPGSRASRLGSAAISPAAAAAKRKREMRDYLAEEAQELLSYFNHRNVDAIVRVTRATLDSTRRRIAASAAHHFVKPRSNVEGENSSSFVPPLFKANVTLQIPNVTMQPALDEIQQGLNKAAQCVVSVSKGVSQWDRT---CRALRKAEKRDDSDNEDSRSRSASNVGSDDESRSEAAPTRRSARMPTDDASTVVSMPIFPQKMNYFKNVSENKEVAKLLSMLSTVVNSQKKEVITALELFNKYSSVWQGDRDHTISAFLQNDPKLSEFEAQILHYKEMEQTIVQEPESYSVGSIALMTEKLKSSLCAETKAWCISFSRYCNQKYRMEMEEIFTFVEDMTKRLSRPIKDLDDIRLAMNALKEIRSQEIKIDMNIGPIEESYQMLARYDMPIAREESERVDTLRYSWEKLQSLATESQDHLIGIQSNFKGGLIDEVQTFILDVGSFAGDYNSTGPMVPNVPPREASDRLIIFQNRFDTLWRKYITYSGGEELFGLPVTEYPELMQIKRELNLLQKLYGLYNDVIDTVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFKNRGELLLRGDNTSEIVSLMEDSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKDYDRIMAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAFQELLNVLIEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAW---INKRPIPEGEILNGFFEKSYEELLTFLRESLVSKMDILDHNYIIQTLTLLDGLIPKKDDGGQFSSQHLEHLYVFSLMWSIGALLELDDRAKMETFMRENFDLDLPQVSENENIFEFMVNDAGEWAHWNTRVEEYVYPKDHVPDFLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGYFCKERGFINDVQDFALKLVPCTRKLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDYQPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTR--------SYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVSIKAQAAEKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLMSNWQKEMKSRKIPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELSKLSQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKYDCRAISMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEFMLELIDTVVESEHIHEDFRLWMTTEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDVSNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHLDDMDIKKGVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNFYKGYVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGGGETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWESSTIGFWFTELIERNAQFRTWCFDGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAIN------STGGRDNRLYQCPIYKKPRRTDLTYIACVDLKTNQNPDHWILRGVALLCDIK 4614          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO42024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L5])

HSP 1 Score: 5088.09 bits (13197), Expect = 0.000e+0
Identity = 2552/3927 (64.99%), Postives = 3141/3927 (79.98%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIR-STDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKE---------------------------SKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFK-----------ADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQW-THMHLHHKQIQELEK------LAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDI-KEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPX-XXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQV 11955
            +D RH +IF  I+D   +D   VED +LGD ++   +EFF+ +  KKLMFYYQ+    +  R D  S    ++HKKLFI+TG++E L G C +F+R S  K +T+ NIA +++F   DAS G +L+  E+ +  IM P LQ  E WG MST+    S++ EF E L+RF++ L  A+ N+  ++QL + D   L+  ++ P+  ++A N+ + ++KLE L+  W + IEQVL+ESEQ+R+EADD+GP+AEL +WK RM++FN LL+Q+K+      + +LH AKSRSL++W+ELDSRITDAANEAKDNVKYLYTLDKFFGPL KC+P +MIE++PSL+NAIRMIHSISQYYN+SERMTSLFVKVTNQMITTCK ++  GV KIW+  RE L+ R++ C +LN+EY+ CFHKTK+KL+E+  E+QFEFSENYIFGKF+AFCKRL+KI+++   +E+ S +   KIEGI++I+VRY +I   +KKK YD+LDHRK EFD+DY++F    E L+ Q+Q F+D+WF+KS+   + L LL KFE I  ++L   DK+ +VL  + + L+  RK+YQK K+DPP++RNLPP+AGKI+W+R LF++I  PM++FK T+ ++LK  EA ++VKNYNKMA VL+EFEL+Y+  WF+ +E  K GL +SLL+R+P+ ++      VNFD  I+ELIQEAK +  LNL+IP  A  L   E  IK +   + ++L +Y+ ++  +P V  P+M+P ++R+DET  PGL  L WTSM I  Y++ ++ S++    L K++ DI + RIEAVL+++  T LCDLPE++ IT+EEF+  TE+T   A+E L++                             +LVE +V  +++ LK NLT +E++ L   + Y C+ P+ K+ +  +C  C Y+ ++  + QR  + L++CTRL+LDTIKRR+ ++ NK+  +  N   R ALFK           AD+VL IP++L KP+LD+IQ  LNKAVQ +LK +++I +W  H  +H   I  +E+            +   +P P   KSL K++S+HKDV K V  L+ I++TFK+  + LLSE   +  LW E+P TKV EFM++KP+LS+ +AQIKY+  +E +I   P  Y++G+V++ +E LK+ +++E  +WK ++ + L  K + +M+ I    D+L+KRL+RP+ DLDDVR  MAAL E+RESEIKI+MTI PIEE++ M+++Y ++F+  ++ERVD L Y + K+ TQA  V  HLL+IQP+FK +L++GV  FK  V +FV DY  +GPM  GI PREASDRL I+Q +FDELWRKY TYSGGEELFGLEVT+YPD+QRIR+EL LLQKLY LYN+V+D VN YYDI W EI+I+ INQ+LLDFQN+ RKLPK LKEWQA+ +L+KTIDDF+E CPLLE M++ AM  RHW RI  + G   +V+S+ F LR LM APLL NKEEIEDICI+AVKEKDIE+KLK V  +WSAQSFSF+ FK+RGELLLKG  T +IVSLMEDSLM LG+LLSNRYNAPFK +IQ+WV KLTG+TEIIENWL+VQNLW+YLEAVFVGGDIAKQLPQEAKRF  IDKSW KIMQRAHE  NVVQCC+GDDTL QLLPHLLEQLE+CQKSL+GYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL VFDN KTVTFDEK YDKILAINS+ENE + L++P+ AQGNVE+WL  LLK +  SLH+VIR AS+ I D  FKL EF  ++P+QVGLLG+QMIWTRD+E+AL+ +++DKKIM   NQ FLD+LNELI VTT+ LTK+ER KFET ITIHVHQRDIFDDLV   I TP DFEWLKQSRFY++E+TDQC+VSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGM++GGAPAGPAGTGKTETTKDMG+ LGK+VVVFNCSDQMDYRGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERK QFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR IIIRVKLA+CGF++N VLS KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLGA KR NP+DSE  IVMRVLRDMNLSKLVDEDE LFLSLI+DLFP +++    YPDI  AI + +E+AKLINH PW LKLIQL+ETQRVRHGMM LGPSGAGKTKCIN+LM+AMT CG PHKE RMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T + KKG+HIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P  K++FE HNIDNASPATVSRNGMVYMSSS LDW+PIL+SWL    +T+  S  + N F+ +F +   ++T ++ P+M  LECNYI QA +LL GL+ G D  K+   SHLEKL +FS+MWS+GALLEL DR K++  +     L  P     DTIFEYVVND+G+W+HW+ RV  Y YP D +PEY  ILVPNVDN RTDFLIN I+KQ KAVLLIGEQGTAKTV+ KGYC +Y+PE  +FK++NFSSATTPNMFQRT+ESYVDKRMGTT+GPP G+KMT FIDDINMP+INEWGDQITNEIVRQ+MEM G YSL+KPG+FT+IVDIQ I+AMI PGGGRNDIP RLKRQF++FNCTLPSNASIDK+F  +GCGYF   RGF  +V + ++ LV +TRKLWQKTK+KMLPTPAKFHY+FNLRDLSRIWQGML+V S+++ +   L++LWKHEC RVI DRFT Q D+DWFEK+L    EE+ G+EV A +  EPYFVDFL+DAPE       E+ E EAPK+YEP+E++E L++RL  ++  YNETVRGG++DLVFFKDAMTHLVKISR+IRT +G+ALLVGVGGSGKQSLTRLASFI+GY+ FQITLT         SYNVSNLM+DLK+LY+T+G  GKGITF+FTDNEIKDE+FLE++NN+L+SGE++NLFARDE+DE+  +L+SVMK EYPRRPP+NENL +Y+++RV   LHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWF RWPKDALIAV++YFLS+F++   PEVK+A+VNTMGIF D VAE C  YF+RFRR THVTPKSYLSFISGYK++Y ++  +I  LATRMNTGL KLVEATESV +LS+EL +KEKEL VA +KA  VL +V V A+AA+KVK QVQ VKD+A+A+V+ I+ DK IAE KLEAAKPAL+EAE AL+TIKP HI+TV+KL +PPHLIMRIMDCVL+LF K++D V  DP+RPC KP+W E++K+MS   FLT+LLNFPKDTIN+E V+L+ PY  MED+ + +AK V GDVAGL SWT+AMA F+ INKEVLPLKANL +Q+++L  A  ELN AQ  LD KQKELD VQA+Y++AM +KQ L DDAEACRRKM NA ALI GL GE+ RWTE SK FD+QI++LVGDVL+ T FLSY GPFNQ+FRN+LQ +WK ++    IPF++D+   +MLTD ATI EWN+QGLPNDELS+QNG+IVT+A RYPLLIDPQGQGK+WIR KE+ +ELQ+T+LNHKYFRNH+EDALSLGRPL+IEDVGEE+DPALDN+LEKNFIKSG T+KVKVGDKEVDVM GF+LY+TTKL NPSYTPE+ A+TSIIDFTVT+KGLEDQLLG VILTEKQELEAERTKLMEEV  NKR+ K+LEDNLLYRLTST+GSLVEDESLIEVL  TK T+E+V +KLI+  +TE+KIN+AREEYRPVA RGSILYFLIVEMS VN MYQTSLKQFLG+FD SMA SQKSPI +KRI NII+YLT+EVFRYT RGFYE  KF FT+LLT+KI ++  +IKHEEFQ+ IKGGAALDLNAVEPKPKKWI DLTWLNLVELSKLP F  I  QV
Sbjct:   19 MDTRHAYIFTKISDTLGMDPNLVEDFILGDSRFPQIDEFFATDGIKKLMFYYQEC---NLRRVD-LSTQASNSHKKLFISTGNTEKLTGTCLVFMRMSNSKNITTANIAQEVSFMQFDASKGNILEGFEKLLGGIMIPALQKQENWGEMSTQI---SQVQEFLESLERFVSILNGARGNLSGRVQLGDHDLGPLLDSLKTPTDYVMAANNPDVVDKLEGLIAHWARDIEQVLAESEQMRKEADDIGPTAELEHWKKRMAKFNVLLDQIKSPHCKAAVGVLHAAKSRSLKQWKELDSRITDAANEAKDNVKYLYTLDKFFGPLIKCSPTEMIEYVPSLMNAIRMIHSISQYYNTSERMTSLFVKVTNQMITTCKAYINRGVVKIWEHPREVLSGRLNECIKLNDEYQRCFHKTKQKLRENPKERQFEFSENYIFGKFDAFCKRLEKIDDMLTTMENLSGICKVKIEGIETIIVRYTTIVSNVKKKAYDLLDHRKGEFDSDYEEFKESIEQLKNQLQMFVDSWFDKSLSTMRSLELLNKFENIAGVQLYLHDKYQRVLLQYGRDLETCRKIYQKQKTDPPILRNLPPVAGKITWARQLFRRIHEPMLIFK-TKSDLLKGEEAKRIVKNYNKMASVLVEFELLYHRGWFRAVEAAKSGLYASLLVRHPETKE----LFVNFDPQIVELIQEAKCMARLNLEIPNSAQVLRLKEEQIKSSSNRLVDVLKDYNHVVSGIPEVFVPLMKPFLNRVDETVKPGLTMLNWTSMNIMQYIDNIQVSIRGLERLTKEIKDIQECRIEAVLEEIGSTPLCDLPEEDAITVEEFVETTEKTCLSAAEVLSRYVTQICNAIKHVSRRSSRIPNNQQSSAYGELVETSVEVLLETLKRNLTAAEIQPLEKAN-YPCMFPESKQAKNNKCMACSYWNLIVTYNQRTIDALVRCTRLSLDTIKRRMHTA-NKYIGE--NGQGRAALFKVSHNHFLCVFQADIVLEIPSVLMKPSLDDIQQALNKAVQIMLKTTQSIPEWKAHSAIHKPPIPVVEEGKPYFTFILYKVNLTPIP-PVQAKSLFKIVSEHKDVVKVVIVLNSIISTFKADAKDLLSEMDQFKELWNEDPNTKVHEFMESKPLLSDFDAQIKYYQHLETQIEDLPSFYRIGSVIYLTERLKEAVVTETKAWKQSFGKALAEKASADMEEIFTFIDNLNKRLARPITDLDDVRGSMAALGEIRESEIKIDMTIGPIEESFAMMNRYGLHFSSSDAERVDGLTYAWKKVNTQAGVVAAHLLKIQPEFKADLLDGVTKFKVLVQNFVEDYTEKGPMVPGIPPREASDRLAIFQARFDELWRKYETYSGGEELFGLEVTEYPDVQRIRRELGLLQKLYNLYNSVIDNVNGYYDILWQEIDIEKINQELLDFQNRIRKLPKGLKEWQAFLELKKTIDDFSECCPLLEMMANKAMKERHWGRISQMVGVTLDVESETFQLRQLMSAPLLPNKEEIEDICIAAVKEKDIESKLKGVIGEWSAQSFSFAGFKNRGELLLKGSDTSDIVSLMEDSLMVLGSLLSNRYNAPFKAEIQKWVAKLTGSTEIIENWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFSQIDKSWVKIMQRAHENANVVQCCVGDDTLGQLLPHLLEQLEICQKSLSGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLGVFDNVKTVTFDEKEYDKILAINSRENEQIMLEKPVVAQGNVELWLFALLKEAMNSLHAVIRMASVGIKDPSFKLIEFLDAYPAQVGLLGLQMIWTRDAEDALSSARSDKKIMAQRNQYFLDMLNELIEVTTRELTKVERIKFETFITIHVHQRDIFDDLVRKNIKTPSDFEWLKQSRFYWREETDQCLVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMAMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKKQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKLAACGFIRNIVLSAKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRANPEDSEDRIVMRVLRDMNLSKLVDEDEPLFLSLIDDLFPGLQLDKAGYPDIEQAIAQCVEEAKLINHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTKCINILMKAMTICGAPHKEFRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGDHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPTCKVVFEPHNIDNASPATVSRNGMVYMSSSALDWKPILQSWLKTRSSTE--SEILFNLFEQLFDDVQNFLTVSVVPRMELLECNYIVQASNLLNGLIPGEDAPKQADASHLEKLFIFSIMWSIGALLELSDRKKVKFMMETFPDLKWPPVSGQDTIFEYVVNDQGDWQHWSERVEAYDYPTDSVPEYSGILVPNVDNVRTDFLINCIAKQEKAVLLIGEQGTAKTVMTKGYCERYDPELHVFKAMNFSSATTPNMFQRTIESYVDKRMGTTYGPPAGKKMTSFIDDINMPIINEWGDQITNEIVRQLMEMKGFYSLDKPGEFTSIVDIQFISAMIQPGGGRNDIPSRLKRQFTVFNCTLPSNASIDKVFSTIGCGYFHKARGFPVEVVNMISPLVASTRKLWQKTKVKMLPTPAKFHYIFNLRDLSRIWQGMLVVTSEILKTPKVLLNLWKHECHRVIADRFTNQPDRDWFEKSLMAVVEEDFGAEVSAMIDPEPYFVDFLRDAPEPTGKSHPEDAEFEAPKVYEPVETFESLNERLDSFVEMYNETVRGGRMDLVFFKDAMTHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTR--------SYNVSNLMDDLKVLYKTAGHEGKGITFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEMTNDLISVMKAEYPRRPPTNENLYDYFITRVKNNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVASYFLSSFDVKCKPEVKEAMVNTMGIFHDTVAEFCTQYFERFRRQTHVTPKSYLSFISGYKQIYSQQHSDIDLLATRMNTGLAKLVEATESVAKLSEELVIKEKELAVASRKADVVLQEVTVSATAAEKVKSQVQKVKDKAQAIVDEIAEDKQIAEGKLEAAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLFMKKIDPVQQDPDRPCVKPSWGESLKVMSQGGFLTTLLNFPKDTINEETVELLAPYLEMEDYTMENAKKVCGDVAGLASWTRAMAIFYGINKEVLPLKANLVIQEARLNKATTELNVAQAQLDEKQKELDAVQAKYDQAMRDKQTLVDDAEACRRKMANATALIDGLGGEKIRWTEQSKKFDQQIQRLVGDVLLATGFLSYSGPFNQEFRNLLQSTWKKDMRKAKIPFSEDINLTNMLTDAATIGEWNLQGLPNDELSIQNGIIVTKASRYPLLIDPQGQGKAWIRTKEQPNELQITSLNHKYFRNHMEDALSLGRPLIIEDVGEELDPALDNILEKNFIKSGKTYKVKVGDKEVDVMDGFRLYITTKLGNPSYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEAERTKLMEEVTANKRRMKDLEDNLLYRLTSTQGSLVEDESLIEVLSSTKATSEEVSEKLIVAAETELKINTAREEYRPVANRGSILYFLIVEMSYVNVMYQTSLKQFLGVFDISMARSQKSPIPAKRIQNIIDYLTFEVFRYTTRGFYEEHKFLFTLLLTLKIDLQEKKIKHEEFQVLIKGGAALDLNAVEPKPKKWILDLTWLNLVELSKLPQFTSILGQV 3918          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO32004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB3])

HSP 1 Score: 4429.78 bits (11488), Expect = 0.000e+0
Identity = 2240/3500 (64.00%), Postives = 2732/3500 (78.06%), Query Frame = 1
Query: 2275 LGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTE--------------------SELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQ-SSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHH---------KQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVG--AVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLV-----HGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDD--DTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQ 12654
            LGL +SLL+R+PD      +  VNFD  + +LI+E + +  +NL +P  A  L  N + +K T   +K +L E   +  ++P +  P+M PHI R+D   +PG+  L W S+ I +Y + V   L+   LLIK V+DI D RI++VL +++   LC++P+D+P T +EF++ T++        L K+S  VE AV++++DI K++L +                    SE +    ++G     P P   + LE +      ++ YF QR  + L++ TR  LD IKRR     SN  +++      +   FKA++ L IP ++ +P+L++IQ  LNKA Q +L++S ++ QW                +   +  K  E     N+   P  +K+  K IS+HKDV K +  L+  +++ K++V   L +FS Y  +W+ + ++ VK F+ + P+LS+   +I  +  +E EI + P +++VG  A+  YSEPLK  L  E   WK  +   +NNK    MD I +     SKRL RP++DL+DVR  MAAL ++R++EI+I+MT+ P+EEAY ML+K+E+       ERVD+L Y + KL  QA+ +Q HL++IQPKFK +L+  V+ ++ NV+ F  +Y+  GPM  GI P+EAS+RL+++Q++FD+LWRK+ TYSGGE+LFGLEVT+YPD+ RI+KEL LLQKLY LYN V+D VN YYDI W+E++I+ IN +LLDFQN+CRKLPKALKEW A+++L+K IDDFNE CPLLE M++ AM  RHWER+  +TGHKF+V+++NFLLRN+MEAPLL +KE+IEDICISAVKEKDIEAKL  V  DW +Q FSF+SFK+RGELLLKG  T EIVSL+EDSLM LG+LLSNRYNAPFK  IQ WVQKL+ T++IIENW++VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  NVV CC+GD+T+ QLLPHLLEQLELCQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN KTV F EK YD+IL+I S E E V L+  + A+GNVEIWLGDLL  +  SLH VIR A   IND  F L  F  +FP+QVGLLGIQMIWTRD+EEAL  ++ DKKIM +TNQ+FL++LN LI VTTQ LTK+ERTKFETL+TIHVHQRDIFDDLV + I +  DFEWLKQSRFYFKED D CIVSITDVDF YQNEFLGCTDRLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTETTKDMG+ LGK+VVVFNCSDQMD+RGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQI +VLT KK+RK QFIF+DGDVVD++PEFGIFLTMNPGYAGRQELPENLKI FRTVAMMVPDR II+RVKLASCGF++N +L++KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR +P DSE   VMRVLRDMNLSKLVDEDE LFLSLI DLFP + +    YP++ AAI K  E A LI H PW LKLIQL+ETQRVRHGMM LGPSGAGKT CINVLM+AM +CG+PH+E+RMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T K KKGE+IW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P  K++FE HNIDNASPATVSRNGMVYMSSS++DW+PIL++WL   E  +   +     F  +F E + Y+ Q+L PKM  LECN I Q +D+L GL+     HG+    +  SHL +L VF++MW +GALLELEDR K++EF+     L +P   +   +TIFE+VV+ KGEWEHW  RV E++YP D  P+Y SILVPNVDN RT+FL++TI+KQ+KAVLLIGEQGTAKTV++KGY   YNPE  + KS NFSSATTP +FQRT+ESYVDKR+GTT+GPP GRKMT FIDDINMP+INEWGDQITNEIVRQ+MEM G Y+LEKPG+FT IVDIQ +AAMIHPGGGRNDIP+RLKRQFSIFNCTLPSN SIDKIF ++GCG+FC ER F  +V   +  LV  TR LWQ+TKIKMLPTPAKFHY+FNLRDLSRIW+GML V  D I+S    ++LWKHE  RVI DRFT + D++WFEK +  +  +  G +    L  EP+FVDFL+DAPE TGEE E+ +L+APKIYE + S E L+++L  YM  YN+TVRGG LDLVFFKDAM HLVK+SR+IRT  G+ALLVGVGGSGKQSLTRLASFI+GY+ FQITLT         SYN +NLM+DLK LYR +G  G+GITF+FTDNEIKDE+FLEFLNN+LSSGE++NLFARDE+DEI Q L+SVMKKE PR PP+ +NL  Y++SR  K LHVVLCFSPVGEKFRNRSL+FPGLISGCT+DWF RWPKDALIAV++YFLS FEIV + E+K+ VV TMG+  D+VAE CI YF RFRR THVTPKSYLSF+ GYK +Y + +  IG LA RM TGL KLVEAT SVN+LSKEL VKEK+L VA  KA +VLA+V V A AA+KVK  VQ VKD+A+ +V+ I+ DK +AE KL AAKPAL+EAE AL+TIK   I+TV+KL +PPHLIMRIMDCVL+LF++ + +V  D +R CP P+W EA KLMS S FL +L+NF KDTIN+E V+L++PY  MED+NL +AK V G+VAGLCSWT+AM+ F+ +NKEVLPLKANL VQ+++L+ AM +LN AQ  LD KQ ELD VQA Y+ A+ EKQ L DDAE+C+ KM  A ALI GL GE+ERWT+ SK F  QI +LVGDVL+ T FLSY GPFNQ FR +L   W+ EL  N IPFT+++   SML D ATI EWN+QGLP D+LS+QNG+IV +A RYPLLIDPQ QGK+W+ N+EK ++LQVT+LNHKYFRNHLED+LSLGRP+LIEDVGEE+DPALDNVLEKNFIKSGST+KVKVGDKE DVM GF +Y+TTKL NP+YTPE+ A+T+IIDFTVT+KGLE+QLLG VI TEK+ELEAER KLME+V  NKRK KELEDNLLYRLTST+GSLVEDESL+ VL++TKETAE+V +KL I  +TE KIN AREE+RPVATRGSILYFLIVEMSMVN MYQTSL+QFLG+FD SMA S+KSPI +KRI NIIE+LTYEVF+Y+ RG YE+ KF FT+LL +KI ++ G++K++EFQ  IKGGAALDL A   KP KWI D+TWLNLVELSKLP F  I +QV +ND GW+ WFD DAPEE  IPDGY  +L+TF+KLLL+RSWCPDRT+P A+KYI + MG R+AEGVI NLE   EE D  TP+ICFLSMGSDPT +IE LAK+K ++C ++SMGQGQEVHAR+L+  S   G W+LLQNCHLGLNFMDE LE +T TEN HE+FR W+T E HP+FPI++LQ  IKFT +PP G++ GL+RTYA +TQDQLDITN  QWKP+L+ VAFLHT VQ
Sbjct:    5 LGLQASLLVRHPD----SGELYVNFDPQLYQLIRETECMMKMNLQVPNNAKLLYMNRHQLKKTSSKLKLMLEEVVSVKANIPNIFQPLMAPHIERVDAAISPGITMLNWNSLNIENYCKNVYTRLRELDLLIKTVNDIRDSRIDSVLKEISEITLCEVPDDQPWTTDEFITKTQKICNRVGGILDKKSLQVEEAVHELVDIFKLSLEQIGVHELGSKAKPPDKEKERKSESREGKEKEGQREKTPKPTDEKTLEEE---IGELILYFNQRTFDALLRATRNALDGIKRRRAFYVSNALAVESYT---KGPFFKAEITLAIPQVIIQPSLEDIQQALNKAAQRVLEVSRSVGQWGQKRFRTLGFYDEPDPRGTFQHTKKTERAATSNEELAPSKLKNYYKAISEHKDVTKLLMILTSSISSTKAEVMGCLDQFSQYHFVWEGDKESVVKVFVASDPLLSDFKTEILKYQTLEQEIENIPASFRVGHGAIELYSEPLKIALTVEIRGWKLLFGHSINNKYRVCMDEISQFLGDYSKRLGRPIQDLEDVRGAMAALEDVRQNEIRIDMTLGPVEEAYAMLNKFEVAVAREEVERVDTLRYSFEKLLAQARDIQSHLVKIQPKFKADLLGSVEIYQHNVVDFTSNYEEIGPMVGGITPQEASERLSVFQSRFDDLWRKFVTYSGGEQLFGLEVTEYPDLVRIKKELGLLQKLYGLYNAVIDGVNGYYDILWTEVDIEKINNELLDFQNRCRKLPKALKEWDAFNELKKKIDDFNECCPLLELMANKAMKERHWERLANLTGHKFDVENENFLLRNIMEAPLLKHKEDIEDICISAVKEKDIEAKLSQVVADWKSQEFSFASFKNRGELLLKGGETTEIVSLLEDSLMVLGSLLSNRYNAPFKKDIQSWVQKLSNTSDIIENWMVVQNLWVYLEAVFVGGDIAKQLPKEAKRFGNIDKSWVKIMTRAHETSNVVTCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNVKTVDFHEKDYDRILSIVSSEGETVPLETAVMAKGNVEIWLGDLLNQAMSSLHGVIRDAFHAINDPAFALMSFMNTFPAQVGLLGIQMIWTRDAEEALKHARHDKKIMASTNQKFLNLLNSLIDVTTQELTKMERTKFETLVTIHVHQRDIFDDLVKMHIRSVTDFEWLKQSRFYFKEDIDDCIVSITDVDFSYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTAKKDRKTQFIFSDGDVVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFIENVILAQKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPQDSESTTVMRVLRDMNLSKLVDEDEPLFLSLINDLFPGITLDKAGYPELEAAIQKNTEDAGLIFHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTACINVLMKAMGECGQPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGENIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKVVFEPHNIDNASPATVSRNGMVYMSSSVMDWKPILKAWLNSREPQE--HDVFEQLFDCVFDELHTYMKQSLHPKMDVLECNVIAQCLDILQGLIPSKEEHGI----LSASHLSRLFVFALMWGVGALLELEDRAKMEEFLVDHGKLDLPKLAEGSHETIFEFVVDSKGEWEHWNNRVEEWVYPTDSKPDYASILVPNVDNVRTNFLVDTIAKQSKAVLLIGEQGTAKTVMIKGYMSTYNPELHMTKSSNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGRKMTAFIDDINMPIINEWGDQITNEIVRQLMEMKGFYNLEKPGEFTHIVDIQFLAAMIHPGGGRNDIPERLKRQFSIFNCTLPSNTSIDKIFGVIGCGWFCPER-FNSEVSDIIKQLVVCTRILWQQTKIKMLPTPAKFHYIFNLRDLSRIWEGMLNVTGDEIDSRKLALALWKHEVTRVIADRFTNEVDREWFEKQITKSLVDTVGDDAAGELMAEPFFVDFLRDAPEVTGEEPEDADLDAPKIYELVPSLEFLNEKLGMYMMMYNDTVRGGHLDLVFFKDAMIHLVKVSRIIRTPCGNALLVGVGGSGKQSLTRLASFIAGYKMFQITLTR--------SYNATNLMDDLKYLYRVAGSDGQGITFIFTDNEIKDEAFLEFLNNVLSSGEVSNLFARDELDEITQNLISVMKKELPRVPPTQDNLYNYFISRARKNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFTRWPKDALIAVADYFLSKFEIVCSAEIKQKVVQTMGVVHDMVAEACIEYFDRFRRQTHVTPKSYLSFLDGYKTIYAENKGHIGELANRMKTGLDKLVEATMSVNQLSKELVVKEKDLAVASVKADKVLAEVTVSAQAAEKVKASVQKVKDKAQIIVDEINADKVVAEGKLAAAKPALEEAEAALQTIKAADISTVRKLAKPPHLIMRIMDCVLLLFRRSISNVVPDFDRGCPTPSWGEAQKLMSSSGFLQALMNFQKDTINEETVELLQPYLEMEDYNLETAKKVCGNVAGLCSWTQAMSFFYGVNKEVLPLKANLIVQEARLKVAMGDLNKAQGQLDEKQAELDKVQAMYDAAVGEKQTLLDDAESCKNKMVAASALINGLGGEKERWTQQSKEFQAQIGRLVGDVLLATGFLSYSGPFNQTFRTLLSARWQQELEANKIPFTENLNLTSMLADPATIGEWNLQGLPTDDLSIQNGIIVNKATRYPLLIDPQTQGKAWLLNREKANDLQVTSLNHKYFRNHLEDSLSLGRPMLIEDVGEELDPALDNVLEKNFIKSGSTYKVKVGDKECDVMSGFTMYITTKLGNPAYTPEISARTAIIDFTVTMKGLEEQLLGRVINTEKEELEAERVKLMEDVTSNKRKMKELEDNLLYRLTSTKGSLVEDESLVAVLKITKETAEEVSEKLAIAAETETKINLAREEFRPVATRGSILYFLIVEMSMVNIMYQTSLRQFLGVFDMSMARSEKSPIPAKRIQNIIEFLTYEVFKYSCRGLYENHKFLFTLLLALKIEIQDGKVKNQEFQTLIKGGAALDLKACPAKPFKWITDMTWLNLVELSKLPQFSGILDQVRRNDSGWRGWFDKDAPEEHPIPDGYQTSLDTFRKLLLVRSWCPDRTLPQARKYIADAMGERYAEGVILNLEATWEESDTKTPLICFLSMGSDPTGSIESLAKRKGIECRAVSMGQGQEVHARRLIQQSCATGGWVLLQNCHLGLNFMDELLETVTNTENAHETFRTWITCEAHPQFPISLLQSSIKFTNEPPQGVKPGLKRTYAGITQDQLDITNMPQWKPILYAVAFLHTVVQ 3479          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 2021.13 bits (5235), Expect = 0.000e+0
Identity = 1370/4447 (30.81%), Postives = 2286/4447 (51.41%), Query Frame = 1
Query:  955 MEKLENLLHRWIKQIEQVLSESE-QIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFM--YEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDS------IVVRYKSIND---IIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCL---------KLDCQDKHAKVLQNFSKTLDNVRKLYQK------YKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFK-ETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENF-KLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLD----IPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLD-EIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFM--------------------QTKPILSEINAQIKYFSDMEAEIHS------FPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVK--DLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDS-LMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGG-DIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDE----KVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRF---LDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSN--TILNTFKLIFSEAYRYVTQTLSP----KMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRL--KLQEF----ITHKKALPVPICKDDDTIFEYVVN-DKGEWEHWTARVPEY-LYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKT-LKVTGE--EECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGS--NFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFR-NILQRSWKHELVTNG--IPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTK-----LMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKK-------KNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITT-TENIHESFRCWVTTE--GHPK---FPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDI-TNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAG--ETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESA-TLGFWFTDLLDRNEQFHSWLYE-GRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALL 13947
            +  +E+++  W  QI+ VL  S  Q   E  + GP  EL +WK+R +    + EQ+   KV  +  +L   +S     ++++   +  A +EA+D   +L  L +    + + +  ++ + +P++++   ++ + S++Y S+ R+  L  ++ N +I   + ++   E      +   E++ K I +C    + +E       K   E +  K +EF+   +F + + F +RL  + ++      +  L+  +I GI        +V  ++  N+   +    TYD L+    EF +D+  F  +   L+ ++ + +   F+     +  L LL      DCL           D + K+  +L+ F K LD  + +Y +       +   P+ +N+P +AG + WS  L ++I  PM   K       L+  EA+ +   Y++M K+L   +   Y +W + + N  +  L   L++R+P+ +       VNFD  ++ +++E KY+   + +    IPE A+ +             +   +  Y+++ +++  V FP++   +  ID        +L W S  + +Y+EK R+ +      ++   D     IEA+   M   +   L E +    E  L++     EE      K   ++  +   I  +LK NL              E  Q D            ++ A ++       +    C   +L+ +   L+ +  K + +        ALF+A L LH P+++  P+LD  +       V+ I+    +I         +K    +++LAE N  ++       +  L+++  D  D      +++GIMN    +     S F  YS LW ++    +++F+                    ++ P L +   QI  +  +  E+        F   ++V A      P KQ L++    W   + Q L +     ++ +          L++ V+  D + + + M  L  +++ +   +   +P+++   +L  Y     +    ++  L   ++  +  A TV+  +  +Q      +      F      F  D+    P A      +  DRL     +   +  +    S    LF +   DY  ++  R+E+ LL++L+ +   VL ++  +    W+EI+++ +  +   F  + R L K ++ W  +  L  T+ +   +   + ++ + A+  RHW+++   T  KF +D D   L +L+   L   ++E+  I   A KE  +E  LK +   WS   F           LLK  ++ E++  +ED+ ++ L  L++++Y   F  ++  W +KL+    +I  W  VQ  W +LE++F+G  DI  QLP+++KRF  ID  ++++     +IPNVV+CC     L + L +L E+L LC+K+L  YLE KRL FPRF+FVS   LL+IL   +    +  HL  +FDN   + F E     V    + + S+E E V+ D   +  G VEIWL  ++   R ++      + ++  +   + + F+  FP+QV L G Q+ WT  +E  +   + ++    A    +   +  L+ LI +   +L+K +R K  T+ TI VH RD+   L+  K+++ + F WL Q R  + +    C  +I D  F Y  E+LG T RLVITPLTDRCYITL+Q+L +++ GAPAGPAGTGKTETTKD+GR LG  V VFNCS+QMDY+  G IYKGL+Q+G+WGCFDEFNRI + VLSV A Q+  +    +++K +FIF   D+  + P  G+F+TMNPGYAGR ELPENLK  FR  AM+VPD  +I  + L + GFL+   L++KF TLY LC+E LSKQ HYD+GLR I SVL   G+ KR +    E  ++MR LRD N+ K+V +D  +F+ LI DLFP + V  K  PD  A + K +   KL   D + LK++QL E   VRH +  LGP+G GKT+ I  L +   +         +NPKA+TA ++FG ++ AT +W DG+FST+ R    +      W++LDG +D +WIE+LN+V+DDNK LTLA+ +R+P+ P+ +++FE+ ++  A+PATVSR G+++++ + + W P + SW+   E     +N   + + +  +  +  R   + ++P     MVT  C Y+ + +     L       +      E   VF+ +W+ G  +  +D+L     EF    +T  K +  P      T+F+Y ++ +  ++  WT +V ++ L P   +P   ++LV   + TR  F ++ + +  + V+L+G  GT KTV+V  Y    +P+  +  ++ F+  TT  M Q+ LE  ++K+ G  +GPPG +K+  FIDD+NMP+++ +G    + ++RQ ++ +  +   K      I + Q IA M +P  G   I  RL+R F++F  + P   ++  I+  +  G+      F   V      +  A   + QK     LPT  KFHYVFNLRDLS I+QG+L    + I +      LW HEC RV  D+  +  D + F+K  + +T +  EE   E    +  +P                     +  PK Y  +  +E LS  L + +  YNE      ++LV F+DAM H+ +I+R++ + +G+ALLVGVGGSGKQSL RLA+FIS  E FQITL           Y + ++  DL  L   +G    G  FL TD ++ +E+FL  +N++L+SGEI  L+  DE++ I+  + + +K    +   + EN   +++ RV + L VVLCFSPVG   R RS +FP + +   IDWF  WP++AL++VS  F+   E +   E K  V   M      V E    Y    RR  + TPKS+L  I+ Y+ +  KK +E+     R+  GL KL    + V++L  +LA +E EL+   + A +++ +V V+     K K      + + + +  ++S  +   EE L  A+PAL  A+EAL T+   ++  +K  G PP  ++ +   V++L           P    PK    +A K+M G    FL  L+N+ K+ I++  +  ++PY +  +F     K  S    G+C+W   +  F+ I  +V P +  L    ++L  A ++L+  +  +    + L  + A + +A  EK   + +AE+  + +  A  L+GGLA E  RW E+ K+F +Q K L GDVL+ TAF+SY G F + +R N+L   W   L +    IP T+ +  +S+LTDNATI+ WN + LP D +S +N  I+T   R+PL+IDPQ QG  WI+ +E N +L++  L  K + + +E A+S G  +LIE++GE +DP LD ++ +N IK G    +K+GDKEV+    F++ + TKL NP Y PE+ A+T++I+FTVT +GLEDQLL  V+  E+ +LE  +       L ++      K KELED+LL RL++  G+ + D +L+E L +TK TA +++ ++   + TEIKIN ARE YRP A R S+LYF++ +++ +N MYQ SLK F  +F K++  ++ +     R+ N+I+ +TY VF YT RG +E DK  FT  +  ++ +   +I   E    ++  A +++ +    P  ++ +L+W  +  LS +  F+ +   +  + K WK + +S+ PE+   P  + N    +KL ++R+  PDR       ++EE +G ++ E   T      EE    TP+   LS G DP  ++E   KK       KN    ++S+GQGQE+ A + L ++ +EG W++LQN HL  N++ +  + +   +E  +  +R +++ E  G P     P  IL+  IK T +PP G+ A L +      QD L++     ++K +LF + + H  V ERRKFGP GWN  Y FN  D T +V  + N+L   +    V W  + Y+ GE+ YGG +TDD+D+RL  TY + +  PEM   + +   G+P+P       Y  +ID+    +SP  +GLH NA+I + T+ ++ +  T++ +QP+D+GGG G  +TRE  V ++ DD+ ++LPE++N   V E + ++    P  +   QE +RM  + + ++++L  L L + G + ++  ++D  + +F   +P  W + ++ S   L  WF DLL R ++   W  +   P   W++GFFNPQ FLTA+ Q + R ++ W LD + L  DVTK  KED N+ P EG YVHGL+++GA W+ ++  + +   K L   +PV+ + A+ V+       +  +  YECPVYK  R+    Y++   LKT E P  W L GVALL
Sbjct:  189 VHSIESVIIDWSHQIQTVLKRSSAQPLLEGTNPGPLVELDFWKARAANLECIFEQLHDPKVRRMAELLEKTQSSYFPAFKKIFKDVVAALDEARDITLHLKPLRRQLEDMEQYDFSELHKILPAILHVCGLLWANSKFYCSAPRIIVLLQELCNMIIEMARTYLDPAEIFKSEIEEAYEKVKKAIENCMLFRDTFEENRKTISKFFAEGTEVKPWEFASEIVFTRLDKFVERLRVVEDVFATAMEFGKLEKVEIAGIKGKMLSHQVVEIFEEFNELFAVFSNSTYDALEATNKEFVDDFNQFRERVADLDRRLASIVCQAFDDCASTESALKLL------DCLGSLLDRPLIHADFEHKYPILLRMFEKELDQAKVIYDQQMECAQAEGAAPINKNMPNVAGSLKWSSELKERITKPMQALKLSLNHGTLETAEAMIIFNKYDEMNKLLDSHDEKIYQSWTEGVGNIAQQNLDKPLIVRDPNTKL----IKVNFDPKLVSVLREVKYLEVASNETLEAIPESATAIFARNETFHKFCANLDLTVAWYNKVRETLLDVEFPLVESQLVAIDTQLEQAEKSLNWNSDGVWEYIEKTRDMVHDLEKRVQAAKD----NIEAMNQLMTKWSEAPLFERKEAKKEGLLNL-----EERETITNKRYAMITQSGEKIHKLLKNNL--------------ELFQADADTD--------MWRAYVDSIDDMVLDGFFNCIHCSLNYL---LEHTDLKHNAN--------ALFEAKLELHQPDMVFIPSLDFGVTAGFYDLVEGIVS---DI---------YKMASLVKRLAEHNESEHYEADVEDMLDLSEMRQDLMD------RVNGIMN----KANEYRSSFDSYSYLWLDDRNEFMRQFLLYNHVLTAEEIEAHTEEGVPESPPTLEQFKDQIDTYEKLYTEVDEVDGTNIFDTWFRVDA-----RPFKQALLNIIKRWSYMFKQHLIDHVTNSLNDLAGFIKVADVGLTQTVEEGDYNGLVAVMGHLMAVKDRQSATDEMFEPLKQTIELLKTYGQEMPEEVHTQLQELPEQWNNSKKIAVTVKQQVAPLQASEVAIIRRKCGQFDIKQHEFREDFRKTAPFA--FNSEDVYDRLDKSNREICAMEEEMNALSESAGLFEVNFPDYKQLRACRREVILLKQLWDMIFVVLTSIEEWKFTPWAEIDVENMEMECKRFVKEIRSLDKEMRAWDGFTGLDSTVKNMVTSLRAVGELQNPAIRERHWQQLMQATKVKFVMDDDT-TLADLLALNLHNFEDEVRGIVDKATKELGMEKVLKELDVTWSQMEFEHEEHVRTHIPLLK--SSEELIETLEDNQVVQLQNLMTSKYIGHFLEEVTSWQKKLSTADSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDVDFKELTNEGAKIPNVVECC-NRPGLFEKLENLQERLSLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPVEVARHLSKLFDNMARLKFKEDDAGNVTKDAVGMYSKEGEYVEFDSVCDCDGQVEIWLNRVMDRMRATVRKEQSESVVSYEEKPREQWLFD--FPAQVALCGTQIWWT--TEVGIAFGRLEEGYENAIKDYYKKQVSQLSTLINMLIGDLSKGDRQKIMTICTIDVHARDVVAKLIQQKVDSAQAFLWLSQLRHRWDDQQSHCFANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVIAVQVKSIQDAIRDKKERFIFQGEDIC-LVPTVGLFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARALARKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRDPDFEALVKKSVTDLKLQPEDSFILKIVQLEELLAVRHSVFVLGPAGTGKTQVIRSLNKTYMNQKRKPMMFDLNPKAVTADELFGFINPATREWKDGLFSTIMRDLSNIASDSPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERVPLTPSMRLLFEIGHLKTATPATVSRAGILFLNFADVGWNPYVSSWIDTREVQSEKANLQILFDKYVPVCLDLLRVRFKKITPIPDITMVTTLC-YLLECL-----LTPANTPPDCNKELYELYFVFAAVWAFGGAM-FQDQLVDYRTEFSKWWVTEFKTIKFPSA---GTVFDYYIDSETKKFVPWTDKVQKFELDP--EVP-LQAVLVHTAETTRVRFFMDLLMENRRPVMLVGGAGTGKTVLVNDYFQSLDPDVSMVGNVPFNYYTTSAMLQQVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPMVDTYGTVQPHTLIRQHLDYSHWFDRTKLT-LKDIRNTQYIACM-NPTAGSFTINPRLQRHFAVFAISFPGLDALKTIYLSILNGHMKV-HNFASAVSKFTEKVTDAALAMNQKVTSTFLPTAIKFHYVFNLRDLSNIFQGILFATHECIKTPVDFARLWMHECNRVYRDKLIDDKDMEVFDKIQIDMTKKFFEELDEE---AMYAKPNMFSHFSSG------------IGEPK-YLAVPDWEVLSKLLTEALENYNEV--NAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRK--------GYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDEVENIISGVRNEVKGAGLQD--TRENCWMFFIERVRRNLKVVLCFSPVGATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLEQLEA-EYKPPVAEFMSYVHTSVNEESQMYLANERRYNYTTPKSFLEQINLYRNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKVGVETEKVSKEKAIADDEEKKVQVIAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLA---------PANKIPKDRSWKAAKIMMGKVDAFLDQLINYDKENIHESNLKAVQPYLDNPEFEPDFIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKWLVFLASQNPKIPITEGLDPLSLLTDNATIATWNNENLPADRMSTENATILTNCERWPLMIDPQLQGVKWIKTREGN-DLRIVRLGQKGYLDTIERAVSNGECVLIENMGENVDPVLDALIGRNTIKKGRA--IKMGDKEVEYHADFRMILHTKLANPHYKPEMQAQTTLINFTVTREGLEDQLLADVVSKERPDLEETKASDRIFPLTQQQNAFTIKLKELEDSLLARLSAAGGNFLGDYALVENLEITKRTAAEIEVQVTEAKQTEIKINDAREAYRPAAARASLLYFILNDLNKINPMYQFSLKAFSVVFQKAIERAEPAEEVKARVVNLIDCITYSVFIYTTRGLFEKDKIIFTAQVAFQVLLMKKEIIPHELDFLLRFPAVMNVTS----PVDFLSNLSWGGIKALSNMEEFRNLDRDIEGSAKRWKKFAESECPEKEKFPQEWKNKTALQKLCMMRALRPDRMTYAVSNFVEEKLGHKYVEDAPTPFAMSFEESGPATPIFFILSPGVDPLKDVEAHGKKIGFTFDAKNFH--NVSLGQGQEIVAEQCLDLAAKEGHWVILQNVHLVKNWLPKLEKKLEAFSEGSNPDYRVYISAEPAGTPDAHIIPQGILETSIKITNEPPTGMMANLHKALNNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVDVLYNYL---EANAKVPWTDLRYLFGEIMYGGHITDDWDRRLCKTYLEEYMKPEMLEGELNLAPGFPLPPNSDFKGYHLYIDETLPPESPYLYGLHPNAEIGFLTTTSDNLFRTLLEMQPRDAGGGEGASQTREEKVKQVLDDIFEKLPEEFN---VPEMMARVEDRTPYTVVAFQECERMNMLTNEMKTSLKQLDLGLKGELTITSEMEDLSNALFLDDVPESWTRRAYPSMFGLAAWFVDLLLRIKELEQWTSDFCLPNVVWLSGFFNPQSFLTAIEQSMARKNE-WPLDKMALQVDVTKKNKEDFNSPPREGAYVHGLFMEGARWDTQTGMIADSKLKDLTPAMPVMFIRAIPVDK------QDTKNVYECPVYKT-RQRGPTYVWNFFLKTRENPSKWTLAGVALL 4468          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1933.69 bits (5008), Expect = 0.000e+0
Identity = 1249/3819 (32.70%), Postives = 2012/3819 (52.68%), Query Frame = 1
Query: 1753 IIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQI---DCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSD-PPLMRNLPPIAGKISWSRHLFKKIEGPMILFKET--RPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFL--SMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAE------DGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLE-IQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEI---NIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEK--VYDKILAIN--SQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSK--TDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDC---GEPH----KEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQ---AIDLLAGLVHG--MDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA-LPVPICKDDDTIFEYVVNDKGE-WEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTL--KVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXX-------DRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKP-KKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCG------SISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIIT--TTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAF-QWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNP---KFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHAN 13023
            I+K     ILD + + + +D+  F    + LE  +Q  + + FE    +++ + +L  F+ +   + ++     K  +V Q F++ L+ V+K +     D PPL    P  AG  SW+R L ++I+  M +  +    P+I    E   +   Y ++A+ L EF    +N W  T++     L    L+R    E+ G   L NFD ++L+L  E  Y   L L+ P   S +   +  ++     +  ++ +Y+ II  + P    + R  I  +D+   PGL  L+W S  I DY       +   R    KV  I+D    A   ++ ++  C       I I E L   +  + V +  E+  ++ K              M L ++ L+  + E      + YE  + D ++         V    L Y T++    + +  RL    +K  LQ  S   + D   +     L +  +VL    +   P L ++  +++     +    +  ++   +    K I+E   L  E +++ K                     K  + +   M+   S +Q+ LS + GY  +W+ +    ++ + +  P +S  +A I  ++++            +  V+    PLK  L+S C+ W+  +   L    +Q++  +       +K+LS P + LD++   ++ L +L+     IE    P+ + + +L KYE+   +     +D+L  G   L  Q     D +L+  + KFK  LI   + FK+ V     D+ S+GP +  I  +EA +++T Y  +   L  + T+   G  +F +E     D+Q + K+L  L++++ +     +  +++    + E+   +++T  Q L    NK  +  K  K W+  D ++  I+ F  T PL++ + ++AM  RHW +I+T     F+   D+F L  ++E  L    E+I +I  +A KE  IE  +  + + W   S     +K RG   LK   T E+   +ED+ + L  + ++RY   F+ ++ +W + L+   E++E  L VQ  W+YLE +F+G DI KQLP+E+  F +++ +W+ IMQR ++ PN ++       L + L  +  +LE  QKSL  YLE KR IFPRF+F+S+  LLEILGQ+ +   +Q HL   FDN KT+        +DK  A+   S E E V+    +  +G VE WL D+ +  R +L  +++   + +  S  K  ++   +P Q+ +   QM WT D  +AL+ SK   DKK +++  ++ + +LN+   +   +LTK++R K   L+TI VH RD+ + L+    N    FEWL Q R Y+ +D D C+V  T+  F Y  E+LG + RLVITPLTDRCY+TL+ AL +  GG+P GPAGTGKTET KD+G+ LG +V+V NCS+ +D++ +GR+Y GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+       +F+F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M VPD  +I  + L + GF    VL+KK +TLY L  +QLSKQ HYDFGLR + SVLR  G  KR NPD S+  I++  ++DMN++KL  +D  LF  ++ DLFP ++     Y  +  AI  +++           LK+IQL+ET+  RH  + +G +G+GK+    VL  AMT     GEP     +E  +NPKA++  +++G  D+ TN+WTDG+ S++ R+T   +K E  W++ D PVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY     L WQP + SWL       +V + +   F+    +   +        + T E N +       D LA   +G  M   E     LE   +F ++WS+ A ++ + R K+  F+   +   P       DT++EY V+ K + W  W  ++      N  +P Y  I++P VD  R DFL+  + +  + VLL G  GT KT + +    K +P+      +N S+ T+ N  Q  +ES V+KR    + P GG++M  F+DD NMP  + +G Q   E++R  ++    Y   K      + D+ ++A+M  PGGGR  I +RL+ +F++ N T P  + I +IF   G       + F+ DV+   + +  AT +++     KMLPTP + HY+FNLRD+S+I+QG+L  N D+ ++ + +  LW HEC RV +DR  +  D++ F   L  K+    +     +   +  P F +F++D                  +YE +  ++ +   +   M  YN       ++LV F+DA+ H+ +I RVI   +G+ LLVG+GGSG+QSLTRLAS+I  Y+ FQI +T     KH   Y      +DLK LY  +G   K   FLF D +  +E FLE +NN+LSSGE+ NL+  DE +E+   L  +  KE  +  P  E++  +++ RV   LH+VLC SPVG+ FRNR   +P  ++  TIDWF  WP DAL+ V+  +L   E+    E K  V          V +         +R  +VTP +YL  +SGY+ +  +K++E+G  A+++  GL K+ +    V  +S EL     ++   +K+  E L  +  +   A + ++ VQ          D+   +  N   D       L+ A PALQEA +ALE++  + +  +K  GRPP L+ ++M+ V+IL +               +PTW EA + +   NF+  L+N+ KD + D ++  +  Y    DF       VS     LC W +AM  +  I + V P K  L    ++LE     L  A+  L      ++ ++ +Y++   +K+ L   AE    K+  A  L+ GLAGER+RW  +    ++ I  LVGD LI  AF+SY GPF  ++R+ ++ ++W  ++   G+    + +    L    T+ EWNIQGLP+D  S +NG++VTR  R+PL+IDPQGQ   WI+N E    L++  L    +   LE+A+  G P+L+++V EE+DP+L  +L K+ +K G  + +K+GDKEV+    F+ Y+TTKL NP YTPE+  KT+I++F V  +GLE QLLG+V+  E+ ELE ++  L+  +A  K+K +ELED +L  L + +GSL++DE L+  L  +K T+++V ++L +   TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+ S+  SQ+SP    RI N+ EY TY V++YT RG +E  K  F+  +  KI   +G++  +E+  F++GG  LD       P  +W+ D +W N+ EL KLP F  I     +  + W  W+ S  PE   +P  ++N     +++L++RS  PDR    A  +I   +G +F E  + ++  + ++    TP+I  LS G DPT  + +LA+     CG      ++S+GQGQ   A +++   +++G W+ L NCHL L++M +  +++     E+ H  FR W+++  HP+FPI+ILQ+GIK T +PP G++A ++R Y L+T+ Q    +   ++K +LF + F H+ + ERRKF  +GWNI Y FN SDF  +   +  +LD+ +      W  + Y++  V YGG VTDD+D+RLL++Y    F+ +       K S    Y +P    L  YR  +  L  I +   F  H++
Sbjct:  263 ILKAVKKTILDVKATTWHDDFNRFRAGVKDLEVMVQNLIASAFETVTTVEEGVEILDIFQHLSTREAIRRTIDKKTVEVYQLFNEELNLVKKEFNTKTVDLPPLY---PKYAGSASWARMLKRRIDKSMNVLSKAFFLPQIGSGDE---IRTQYQQLAQALDEFVRKTFNEWTATVDKDCGRLLEIPLMRR-SAERAGTLDL-NFDKVLLKLFNEIHYWEKLMLETPHYVSEVYQKKEDLRILRENVLLVVRDYNRIIAVLSPEERGLFRERIRSLDKKIHPGLTKLSWASKGISDYF------IGECRNNCSKVQGIVDDYKNA---NLVISKNC-------IKISEMLLVKIDSKRVYDNLEFEEEQKK-------------HMGLVQTRLQVAHVEIVGTMKNTYEVFKNDGQE---------VQAHWLRY-TEKMDRMVEEAFRLN---VKWSLQELSRAINGD--GKSIPNPLLRVKVVLEGDKVEFSPTLTKLASMMDNIASTLTTCLQIFKRLPDLLTRKKSIKEPVHLVIERDEETK---------------------KIQTSIKAGMSANASHLQSYLSTWDGYREIWEIQKDAFIRRYQRLNPPVSSFDADIARYTEIANNFQKEETVLNIDFVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDAL-SGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKD-KNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLK--QTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPG-LLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVF-EGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEH-LQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGVRMSNGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLRELEGQFPA-----KDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFY-KIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQ-TVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIF---GTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPIFGNFMKD----------------DTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVT-----KH---YRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTP--ESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIEL-GDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHD-------LDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQS--------------EPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAE----NCGMSNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYE---ETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVPKDGPLSTYRVSVILLMYIQASPLFARHSS 3936          

HSP 2 Score: 90.1225 bits (222), Expect = 2.691e-17
Identity = 53/175 (30.29%), Postives = 95/175 (54.29%), Query Frame = 1
Query:  934 AVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHF--MYEG 1452
            A  + E +++LE  +  W +QI++VLS S+     A++ GP  E+ +W+SR +  + + EQ+    V  +   L  +KS  +  + +L   I D +++A+ N+K+L TL      L++  P D+   +P +++ IRM+   S++Y S ER+T +  KV    +    HF  MY G
Sbjct:   61 ASKNKEFVQRLEAAMIHWTRQIKEVLS-SQDTFETAENSGPLEEIEFWRSRCADLSGISEQLDKPGVKRIQATLELSKSSYVTPFLKLSKLIQDGSSQAQSNLKFLSTLKGPCEELAQAQPKDVPAMLPRILHTIRMVWMNSEHYRSRERLTGILRKVCEGQM----HFARMYNG 230          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4583.48 bits (11887), Expect = 0.000e+0
Identity = 2286/3482 (65.65%), Postives = 2804/3482 (80.53%), Query Frame = 1
Query: 3535 MQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITH----KKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE--VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            + T P+LS+  +QI Y+ D+E +I+S P    VGA+  ++  LK  L  E   W   Y    N K  QE++ IL + D   K+L+RP+KDLDD+R  MAA+ ++R+ +I IE+ I PIEE+Y ML+KY+        E+V++L   + KL  ++  VQ  L  +QPKFK EL   +   +E   +F  DYD  GPM  G+ P++ SDRL ++Q +FD L+ KYTTY  G +LFG+ VT +P + +IR EL LLQKLY LYNNV++TVN YYDI W+ INI+ IN +LLDFQ +CRKLP+ALKEWQA+ DL++TID+F+E CPLLE M+  AMM RHW+RI  VTGH  +V+S+NF LRN+MEA  L  KEEIEDICISAVKE+DIE KLK V  +W  ++F+F+ FK+RGELLL+GD+T E+++ +EDSLM LG+L+SNRYN PFK +IQ+WVQ L+ T++IIE+W++VQNLWIYLEAVFVGGDIAKQLP+EAK F +IDKSW KIM RAHE+PNVVQ C+GD T+ QLLPHLLEQL+ CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN K+V F EK+YD+ILA++S+E E ++LD PI A+GNVE+WL  LLK S++SLH VIR A++ I +  F+L +F  SF +QVGLLGIQMIWTRDSEEALT +  D+ IM  TNQ FL++LN LI +TT++L  +ERTK+ETLITIHVHQRDIFDDL  L I+ P DFEWLKQ RFYF ED+D+  ++ITDV F YQNEFLGCT+RLVITPLTDRCYITL+QALGM +GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI++VLTCKK+R   F+FTDGD VDM+PEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDR IIIRVKLASCGF+ N  L+ KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IV RVL+DMNLSKL+DEDE LFLSLIEDLFP ++++ + YP++ AAIDK+I++  LINH PW+LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LM+AMT+CG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDN+TLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+L W PIL  WL      +A    +   F   FSE YR+  Q+L  KM  LE   I Q I++L GL+   +   E+   HLE+L +F++MWS GALLELEDR K++ +       +++LP      ++T+F+Y V  +G W HW+ RV EY+YP D  P+Y SILVPNVDN RTDFLI+TISKQ KAVLLIGEQGTAKTVI+K +  KY+PE Q+ K LNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KM+I IDDINMPV+NEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT IVD+Q +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF ++G G+FC +RGF  +VQ T+  LV  TR+LWQ TKIKMLPTPAKFHY+FNLRDLSRIWQGML  N++VINS   L++LWKHEC RVI DRFT   D +WF++TL    E++ G E   V     E YFVDFL+D PEATGEE EE++ + PK+YEPIES+E L DRL  ++ QYN+++RG  +D+VFF+DAM HL+K+SR+IRT  G+ALLVGVGGSGKQSLTRLASFI+GY+ FQITLT          YN +NLMEDLK LYR +G  GKGI+F++TDNEIK+ESFLE++NN+LSSGE++NLFAR+EMDEIL +LV VMK+E+PRRPP+NENL +Y+MSRV   LHVVLCFSPVGEKFRNR+L+FP LISGCT+DWF RWPKDAL+ VS++FLS F+I  +P+VK  VV  MG FQD VAE C++YF R+RR THVTPKSYLSFI GYK +Y++KR E+      MNTGL+KL EA+ESV  LSKEL VKEKEL++A +KA  VL +V VKA A++ VK +VQ VKD+A+A+V++I+ DKAIAEEKLEAA+PAL+EAE AL+TIKP  IATV+ L RPP LIM+ MDCVL+L ++R++ V  + E      +W E++ LM+  +FL+ L  FPKDTIN+E V+L++PYFN+ ++N+  A+  S +VAGL SWTKAMASFF+INKEVLPLKANLAVQ+++L  A  +L  AQ  LDAKQ EL++V+AEY +AM EK  L +DA+ CRRKM  A  LI GLAGE+ERWTE SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FR++L   W+ EL    IPF +++    +L D +T+SEWN+QGLPNDELS+ NG+IVT+A R+PLLIDPQ QGK+WI+NKE  +ELQ+T+LNHKYFRNHLE++LSLGRPLLIEDVGEE+DP LDNVLEKNFIK+GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPE+ A+TSIIDFTVTI+GLEDQLLG VILTEK+E+E ERT L+E+V  NKRK KELEDNLLYRLTST+GSLV+DESLI VL  TK+TAE+V QKL I  DT+I+IN+AREEYRPVATRGSILYFLI EMSMVN MYQTSL QFLGLFD S+A S KS  TS+RI +IIEY+T++V+ Y ARG YE  KF FT+LLT+KI M+   + H+EF   IKGGA+LDL     KP +WI D++WLNLVELSKL  F +I +Q++ ++K WK+WFD +APEE  +P+ Y +L+ F++LLLIR WCPDRT+  A+KYI + MG ++ EGVI ++E   EE +  TP+ICFLSMGSDPTD+I  L KK  ++   +SMGQGQEVHARKLL  +M  G W LLQNCHLGLNFMDE ++ +  TE I++SFR W+TTE H  FPI +LQ+ IKFT +PP G++AGL+RTY  + QD LD++N  QWKPML+CVAFLH+TVQERRKFGP+GWNIPYEFNQ+DF +TVQF+QNHLDDMD K+ VSW TV YMIGE+QYGGRVTDDYDKRLLNT++K WF+  MF   F+FYKGY IP   S+D+Y A+I  LP  D+PE FGLH NADI +++  A  +L TI++IQPKDS  G GETRE+ V R+ADDML++LP DY PFEVK +LQKMG LKP+NIFL+QE+DRMQ+VI +VRSTL+DLKLAIDGTIIMSENL+DALD ++DARIP+ WMK SW S+TLGFWFT+LL+RN QF +WL++GRP CFWMTGFFNPQGFLTAM+QEI R +KGWALD +VL N+VTK+MK+D+ + P++GVYV+GLYL+GA W+  + +L E  PKVL+  +PV+ +YA   NN V D      R Y CP+YKKP RTD+N I  + LKT + P+HW+LRGVALLCD+K
Sbjct:  657 LTTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFTASLKTSLTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEA--EVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTR--------LYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEV------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVK-RLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMK-SWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA--ENNVVKDP-----RLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 4113          

HSP 2 Score: 397.127 bits (1019), Expect = 1.069e-109
Identity = 220/610 (36.07%), Postives = 365/610 (59.84%), Query Frame = 1
Query:  655 FQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMY-EGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMK 2478
            F MLD +   L  ++E+ +S++  P L+     WG + + +    K  E+  + + F + L+ A++ +  +++  N  D+ L      P +           +K  +L++       Q+LSES Q+R+  DD+GP AEL+YWK RMSRF+ LLEQ+K+  V  ++ +L  AKS+ +  W E+D RIT A+NEAK+NVKY+Y+L+ F+ PL KC+PV     IPSLINAIR IH++S+YYN SE++T+LF+ VTNQM+++CK ++   G   IWD  R+E+ ++I     LN+  +       ++L++   E+QF+FSE YIF KF+AF  R++KI  + NI+ +YS+LQ  KIEG+++I  R+K I   +K K+Y  LDH  + F+ D++ F    +    Q++ F++   E      + L++L +FE++    L    K+  +L  + + ++ V  +++K K DPP  R+LPP+AG+I W+R L ++I  PM  F++ +P +L   EA  ++KN+N+M ++LLE+E ++++NW   + + +LGL ++LL+R      +  +  VNFD  +L  I E   +  +NL IP  A+ L   E  +K     M+
Sbjct:    5 FNMLDTTEVGLFKSMEQLLSEVFIPSLKKTNHGWGELDSPEAQAIK-EEYISLFESFASVLVGAEECIKEKVR--NCLDQGL----RYPIFLFYP------FKKTHDLVYH------QILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIESWIEIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDPV---RKIPSLINAIRTIHNVSRYYNDSEKITTLFLLVTNQMVSSCKAYITNNGCDSIWDQPRQEIIRKIKAAIHLNQVLK------PRELEQAPLERQFDFSEAYIFWKFDAFQSRMEKILKMFNIISTYSVLQDSKIEGLETIATRFKPILMSMKNKSYSFLDHSATNFETDFEQFC---KRTSEQLEKFMNDTIENIQDTQRALDVLHQFERLGIPDLGTDTKYQDILLKYGQDIEWVSDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQQ-QPGVLSTQEAKNIIKNFNRMTEILLEYEKLHHHNWMTKVTDARLGLEATLLVR----LGETGELFVNFDPELLIQIMETNCMARMNLKIPPFAAVLQQKEYTLKKNNSQMQ 578          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4543.41 bits (11783), Expect = 0.000e+0
Identity = 2450/4578 (53.52%), Postives = 3154/4578 (68.89%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKK--LFIATGSSEPLKGLCFLFIRS-TDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL-KMNLTESELKNLNAEDGYECLQPDP---KKPRCLECQPCV---YYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIM-----NTFK--SQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIE-EAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMD-IKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITH----KKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE--VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQIT-EQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVP-MAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFE--VKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKL-SWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +D RH +I  T+A    L+   VEDA+L   +    E+FF  +    LMFY+QD              GP    KK  +F+  G +  L G+C  FIR+ T K +TS NI  DI+F MLD +   L  ++E+ +S++  P L+     WG + + +    K  E+  + + F + L+ A++ +      E  D  D  A ++ P+    A N++  ++KLE  +  WI+QIE +LSES Q+R+  DD+GP AEL+YWK RMSRF+ LLEQ+K+  V  ++ +L  AKS+ +    E+D RIT A+NEAK+NVKY+Y+L+ F+ PL KC+PV +++ +PSLINAIR IH++S+YYN SE+            ITT  H+      + W                                            E YIF KF+AF  R++KI  + NI+ +YS+LQ  KIEG+++I  R+K I   +K K+Y  LDH  + F+ D++ F  +   L  Q++ F++   E      + L++L +FE++    L    K+  +L  + + ++ V  +++K K DPP  R+LPP+AG+I W+R L ++I  PM                                       N+F+ + + +LGL ++LL+R      +  +  VNFD  +L  I E   +  +NL IP  A+ L   E  +K     M+                           +DE   PGL  LTWTS+ I  Y+   +++L    LL+ +V+D+++ RI+ +L +M++  LC LPED P+T EE +  T +  ++ ++ L  +S LVE A N++I++L   + +E  L +           P P   K+ + ++ +  +      +L++F  RN + L+K TR TL+ +++                    A+F+ D+VL IP+I+  P L+++Q  LN+ V+ ++ +S+ + QW+   L   ++ E   ++ E ++        S  +   + + H+ +A ++S  S I      N +K  S+ + +L   S  S+       T  K+F QT P+LS+  +QI Y+ D+E +I+S P    VGA+  ++      L  E   W   Y    N K  QE++ IL + D   K+L+RP+KDLDD+R  MAA+ ++R+ +I IE+ I PIE E+Y ML+KY+        E+V++L   + KL  ++  VQ  L  +QPKFK EL   +   +E   +F  DYD                             + YTTY  G +LFG+ VT +P + +IR EL LLQKLY LYNNV++TVN YYDI W+ INI+ IN +LLDFQ  CRKLP+ALKEWQA+ DL++TID+F+E CPLLE M+  AMM RHW+RI                                EDICISAVKE+DIE KLK V  +W  ++F+F+ FK+RGELLL+GD+T E+++ +EDSLM LG+L+SN YN PFK +IQ+WVQ L+ T++IIE+W++VQNLWIYLEAVFVGGDIAKQLP+EAK F +IDKSW KIM RAHE+PNVVQ C+GD T+ QLLPHLLEQL+ CQKSLT YLEKKRL+FPRFFFVSDPALLEILGQASDSHTIQAHLL+VFDN K+V F EK YD+ILA++S+E E ++LD PI A+GNVE+WL  LLK S++SLH VIR A++ I +  F+L +F  SF +QVGLLGIQMIWTRDSEEALT +  D+ IM  TNQ FL++LN LI +TT++L  +ERTK+ETLITIHVHQRDIFDDL  L I+ P DFEWLKQ RFYF ED+D+  ++ITDV F YQNEFLGCT+RLVITPLTD                            T KDMGRCLGK+VVVFNCSDQMD+RGLGRI+K LAQSGSWGCFDEFNRIELPVLSVAAQQI++VLTCKK+R   F+FTDGD VDM+PEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDR IIIRVKLASCGF+ N  L+ KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IV RVL+DMNLSKL+DEDE LFLSLIEDLFP ++++ + YP++ AAIDK+I++  LINH PW+LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LM+AMT CG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T K KK EHIW++LDGPVDAIWIENLNSVLDDN+TLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+L W PIL  WL      +A    +   F   FSE YR+  Q+L  KM  LE   I Q I++L GL+   +   E+   HLE+L +F++MWS GALLELEDR K++ +       +++LP      ++T+F+Y V  +  W HW+ RV EY+YP D  P+Y SILVPNVDN RTDFLI+TISKQ KAVLLIGEQGTAKTVI+K +  KY+PE Q+ K LNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KM+I IDDINMPV+NEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT IVD+Q +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF ++G G+FC +RGF  +VQ T+  LV  TR+LWQ TKIKMLPTPAKFHY+FNLRDLSRIWQGML  N++VINS   L++LWKHEC RVI DRFT   D +WF++TL    E++ G E   V     E YFVDFL+D      EE EE++ + PK+YEPIES+E L DRL  ++ QYN+++RG  +D+VFF+DAM HL+K+SR+IRT  G+ALLVGVGGSGKQSLTRLASFI+GY+ FQITLT          YN +NLMEDLK LYR +G  GKGI+F++TDNEIK+ESFLE++NN+LSSGE++NLFAR+EMDEIL +LV VMK+E+PRRPP+NENL +Y+MSRV   LHVVLCFSPVGEKFRNR+L+FP LISGCT+DWF RWPKDAL+  S++FLS F+I  +P+VK  VV  MG FQD VAE C++YF                                      MNTGL+KL EA+ESV  LSKEL VKEKEL++A +KA  VL +V VKA A++ VK +VQ VKD+A+A+V++I+ DKAIAEEKLEAA+PAL+EAE AL+TIKP  IATV+ L RPP LIM+ MDCVL+L ++R++ V  + E      +W E++ LM+  +FL+ L  FPKDTIN+E V+L++PYFN+ ++N+  A+  S +VAGL SWTKAMASFF+INKEVLPLKANLAVQ+++L  A  +L  AQ  LDAKQ EL++V+AEY +AM EK  L +DA+ CRRKM  A  LI GLAGE+ERWTE SK F  Q K+LV DVL+ TAFLSY GPFNQ+FR++L   W+ EL    IPF +++    +L D +T+SEWN+Q             I +   +Y                  +NH               LE++LSLGRPLLIEDVGEE+DP LDNVLEKNFIK+GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPE+ A+TSIIDFTVTI+GLEDQLLG VILTEK+                                    SLV+DESLI VL  TK+TAE+V QKL I  DT+I+IN+AREEYRP ATRGSILYFLI EMSMVN MYQTSL QFLGLFD S+A S KS  TS+RI +IIEY+T++V+ Y ARG YE  KF FT+LLT+KI M+   + H+EF   IK GA+LDL     KP +WI D++WLNLVELSKL  F +I  +Q++ ++K WK+WFD +APEE  +P+ Y +L+ F++LLLIR WCPDRT+   A+KYI + MG ++ EGVI ++E   EE +  TP+ICFLSMGSDPTD+I  L KK  ++   +SMGQGQEVHARKLL  +M  G W LLQNCHLGLNFMDE ++ +  TE I++SFR W+TTE H  FPI +LQ+ IKFT +PP G++AGL+RTY  + QD LD++N  QWKPML+CVAFLH+TVQERRKFGP+GWNIPYEFNQ+DF +TVQF+QNHLDDMD K+ VSW TV YMIGE+QYGGRVTDDYDKRLLNT++K WF+  MF   F+FYKGY IP   S+D+Y A+I  LP  D+PE FGLH NADI +++  A  +L TI++IQPKDS  G GETRE+ V R+ADDML++LP DY PFE  V+E+LQKMG LKP+NIFL+QE+DRMQ+VI +VRSTL+DLKLAIDGTIIMSENL+DALD ++DARIP+ WMK  SW S+TLGFWFT+LL+RN QF +WL++GRP CFWMTGFFNPQGFLTAM+QEI R +KGWALD +VL N+VTK+MK+D+ + P++GVYV+GLYL+GA W+  + +L E  PKVL+  +PV+ +YA    N V D      R Y CP+YKKP RTD+N I  + LKT + P+HW+LRGVALLCD+K
Sbjct:   14 LDGRHDYILNTLALCLGLEKDDVEDAILEGVQIEHMEQFFVADGLSHLMFYHQDN-------------GPTGGGKKKKVFLTDGKTVELTGMCVFFIRTNTAKPVTSENIHRDISFNMLDTTEVGLFKSMEQLLSEVFIPSLKKTNHGWGELDSPEAQAIK-EEYISLFESFASVLVGAEECIK-----EKCDTFDTQA-LKTPADYTAAANNNTEVKKLEACMKGWIQQIELILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIE---EIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDPVAIVKAVPSLINAIRTIHNVSRYYNDSEK------------ITTLLHY------QQW--------------------------------------------EAYIFWKFDAFQSRMEKILKMFNIISTYSVLQDSKIEGLETIATRFKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSELHRQLEKFMNDTIENIQDTQRALDVLHQFERLGIPDLGTDTKYQDILLKYGQDIEWVSDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPM---------------------------------------NFFQQVTDARLGLEATLLVR----LGETGELFVNFDPELLIQIMETNCMARMNLKIPPFAAVLQQKEYTLKKNNSQMQ---------------------------VDEAIQPGLTYLTWTSLNIDKYLRDTKKAL-DLELLMNRVNDLVEYRIDTILQEMSMVTLCVLPEDNPVTCEELVHTTRELCKKQAQNLHYKSMLVEKAANELINMLMDEHQSEGHLISKTTLPQSGSTGPSPSLVKRKKKMDLKDVMEEEAQKLLSHFNHRNLDALLKMTRNTLEMLRKHFSQ----------------AVFRVDVVLSIPDIVINPALEKVQEALNQIVECVVSVSKGVGQWSKDRLSLGKMDERCMISLEQDN--------SESAAEDVATTHRSLAGSISSASVIQAFPFRNYYKNVSENKEVLKLVSILSSS-----ITSTKKFNQTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFT------LTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEQESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYD-----------------------------KVYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQT-CRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRI-------------------------------TEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSN-YNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEK-YDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDE---------------------------TIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT-CGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKK-EHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEA--EVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE-HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDP-PEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLT---------LYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYF--------------------------------------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQ-------------ITSLNHKY-----------------FRNH---------------LEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKR------------------------------------SLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLA-SSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIK-GASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYG-INQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA---ENNVKDP-----RLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 4159          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3604.68 bits (9346), Expect = 0.000e+0
Identity = 1796/2689 (66.79%), Postives = 2185/2689 (81.26%), Query Frame = 1
Query: 5923 TPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITH----KKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSK-LMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSE--VVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAK---ANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            T L   CYITL+QALGM +GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI++VLTCKK+R   F+FTDGD VDM+PEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDR IIIRVKLASCGF+ N  L+ KF+TLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA KR NP D+E  IV RVL+DMNLSKL+DEDE LFLSLIEDLFP ++++ + YP++ AAIDK+I++  LINH PW+LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LM+AMT+CG+PH+EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWR+T K KKGEHIW++LDGPVDAIWIENLNSVLDDN+TLTLANGDRIPMAPN K++FE HNIDNASPATVSRNGMV+MSSS+L W PIL  WL      +A    +   F   FSE YR+  Q+L  KM  LE   I Q I++L GL+  + ++     HLE+L +F++MWS GALLELEDR K++ +       +++LP      ++T+F+Y V  +G W HW+ RV EY+YP D  P+Y SILVPNVDN RTDFLI+TISKQ KAVLLIGEQGTAKTVI+K +  KY+PE Q+ K LNFSSATTP MFQRT+ESYVDKRMGTT+GPP G+KM+I IDDINMPV+NEWGDQ+TNEIVRQ+ME  G Y+LEKPG+FT IVD+Q +AAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF ++G G+FC +RGF  +VQ T+  LV  TR+LWQ TKIKMLPTPAKFHY+FNLRDLSRIWQGML  N    N   + L++LWKHEC RVI DRFT   D +WF++TL    E++ G E   V     E YFVDFL+D PEATGEE EE++ + PK+YEPIES+E L DRL  ++ QYN+++RG  +D+VFF+DAM HL+K+SR+IRT  G+ALLVGVGGSGKQSLTRLASFI+GY+ FQITLT         S  +  L+  LK LYR +G  GKGI+F++TDNEIK+ESFLE++NN+LSSGE++NLFAR+EMDEIL +LV VMK+E+PRRPP+NENL +Y+MSRV   LHVVLCFSPVGEKFRNR+L+FP LISGCT+DWF RWPKDAL+ VS++FLS F+I  +P+VK  VV  MG FQD VAE C++YF R+RR THVTPKSYLSFI GYK +Y++KR E+  LA RMNTGL+KL EA+ESV  LSKEL VKEKEL++A +KA  VL +V VKA A++ VK +VQ VKD+A+A+V++I+ DKAIAEEKLEAA+PAL+EAE AL+TIKP  IATV+ L RPP LIM+ MDCVL+L ++R++ V  + E      +W E++ LM+  +FL+ L  FPKDTIN+E V+L++PYFN+ ++N+  A+  S +VAGL SWTKAMASFF+INKEVLPLKANLAVQ+++L  A  +L  AQ  LDAKQ EL++V+AEY +AM EK  L +DA+ CRRKM  A  LI GLAGE+ERWTE SK F  Q K+LVGDVL+ TAFLSY GPFNQ+FR++L   W+ EL    IPF +++    +L D +T+SEWN+QGLPNDELS+ NG+IVT+A R+PLLIDPQ QGK+WI+NKE  +ELQ+T+LNHKYFRNHLE++LSLGRPLLIEDVGEE+DP LDNVLEKNFIK+GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPE+ A+TSIIDFTVTI+GLEDQLLG VILTEK+E+E ERT L+E+V  NKRK KELEDNLLYRLTST+GSLV+DESLI VL  TK+TAE+V QKL I  DT+I+IN+AREEYRPVATRGSILYFLI EMSMVN MYQTSL QFLGLFD S+A S KS  TS+RI +IIEY+T++V+ Y ARG YE  KF FT+LLT+KI M+   + H+EF   IKGGA+LDL     KP +WI D++WLNLVELSKL  F +I +QV  ++K WK+WFD +APEE  +P+ Y +L+ F++LLLIR WCPDRT+  A+KYI + MG ++ EGVI ++E   EE +  TP+ICFLSMGSDPTD+I  L KK  ++   +SMGQGQEVHARKLL  +M  G W LLQNCHLGLNFMDE ++ +  TE I++SFR W+TTE H  FPI +LQ+ IKFT +PP G++AGL+RTY  + QD LD++N  QWKPML+CVAFLH+TVQERRKFGP+GWNIPYEFNQ+DF +TVQF+QNHLDDMD K+ VSW TV YMIGE+QYGGRVTDDYDKRLLNT++K WF+  MF   F+FYKGY IP   S+D+Y A+I  LP  D+PE FGLH NADI +++  A  +L TI++IQPKDS  G GETRE+ V R+ADDML++LP DY PFEVK +LQKMG LKP+NIFL+QE+DRMQ+VI +VRSTL+DLKLAIDGTIIMSENL+DALD ++DARIP+ WMK SW S+TLGFWFT+LL+RN QF +WL++GRP CFWMTGFFNPQGFLTAM+QEI R +KGWALD +VL N+VTK+MK+D+ + P++GVYV+GLYL+GA W+  + +L E  PKVL+  +PV+ +YA   NN  ++K K    + R Y CP+YKKP RTD+N I  + LKT + P+HW+LRGVALLCD+K
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEA--EVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIP-LKVRLKLNQHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTR--------SGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVK-RLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA--ENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 2687          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1636.31 bits (4236), Expect = 0.000e+0
Identity = 1098/3253 (33.75%), Postives = 1708/3253 (52.51%), Query Frame = 1
Query: 4474 IDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNF--LLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPIN---AQGNVEIWLGDLLKMSRKSLHSVI---RSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRL---KLIQLFETQRVRHGMMTLGPSGAGKTKCINVL---MRAMTDCGEPHKE----MRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLIL----ETTDAVSNTILNTFKLIFSEAY-------RYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITH-----KKALPVP--------ICKDDDTIFEYV--VNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKG-YCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTL-------------KVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLK-LLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQ-RFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIK-PQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPK--PTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNME-DFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDV--QQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKK--NLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIIT--TTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQ--------WKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEM---FNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDML-QRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWES-ATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRT--------DLNYIFPLNLKTNEAPDHWILRGVALLCDI 13956
            I  F +  P++  + +  +  RHWE++  + G      + NF   LR L++  L    EE E I ++A KE  +E  ++T+T  W   SF     K  G  +    A  +I  +++D ++    ++ + +  PF+ ++++W ++L    E I+ WL +Q  W+YLE +F   DI +Q+P+E + F  +D++W++IM    +   V+Q       L + L      LE   K L  YLEKKRL FP +                                                 S E E V+L + I+   A G VE WL  L      S+  +I   R+   T  +   K       +P QV L   Q+ WT +  +AL      K   Q  NQ     LNE++ +    L K  RT    L+TI VH RD+  DL+  K++   DFEWL Q R+Y+  D  +  V I + D  Y  E+LG + RLVITPLTDRCY TL  A  ++LGGAP GPAGTGKTETTKD+ + L    VVFNCSD +DY  +G+ +KGLA SG+W CFDEFNRIEL VLSV AQQ+  +      +   F F +G ++ ++P   + +TMNPGYAGR ELP+NLK+ FRTVAMMVP+ A+I  + L S GFL    LS K    Y+LC EQLS Q HYD+G+R + +VL   G  K + P+++E  +++R ++D+N  K +  D  LF  +  DLFP + +    Y     A +   E  K+ N  P ++   KLIQ +E   VRH M+ +G S AGKTK ++VL   +  M + G   +E      +NPK+IT  Q+FG+ D+ +++WTDG+ +  +R     +  +  W++ DGP+D +WIE++N+VLDDNK L L +G+ I M+    +IFE +++  ASPATVSR GM+YM  S L W+P++ SW+  L    ++ D  S  IL+ F  +   +        R V  T +   V   C   +  +D    +  G D + I+T  +      S++WS+G   + + R K  +FI        K  P+P           +   +++Y     +KG W HW   + E +   +   +   I+VP +D  R  +L++    Q   +L +G  GT K+V VK       + +  +   +NFS+ T+ N  Q  + S +DKR    FGPP G++  +F+DD+NMP   ++G Q   E++RQ ++  G Y L+     + +VD+Q IAAM  PGGGRN +  R  R  +I +    S+ ++  IF  +   +   +  F P+     N +VTA  ++++K    +LPTPAK HY FNLRD SR+ QG L++    +     L+ L+ HE  RV  DR  +  D+ W  + +             +V G+ + G ++         F D++                   ++Y  + S E  ++ +   + +YN+ +   +++LV F   + HL +ISRV++   G+ALLVGVGGSG+QS+TRLA+ ++    FQ  ++ N        Y ++   +DLK +L R +G  G+   FL TD +IKDE+FLE ++++L++GE+ NLFA DE  EI++ +  + +        S   L  ++++R  + LHVV+ FSP+G+ FR R  +FP LI+ CTIDWFQ WP++AL  V+N FL + E+  +   ++ V+     F    + N ++ FQ    R  ++TP SYL  I+ ++++  +KRE I     R   GL +L  A   V ++ KEL   + +LE A+    +++  +EV++   +     V V ++ A    N     K+  E  L  A PAL+ A  AL+T+K P  I+ VK +  PP  +  +M  V ++   + D +  DP     K    W  + KL+   NFL  L  + KD I   V+  +   F    DF+ +   N S    GLC W  AM  +  + K V P KA LA  Q  L      L+  +  L   +  L  +Q  + +  +EK  LE   E+C RK+  A+ LIGGL+GE+  W++A+         L GDVLI    ++Y GPF   FR    + W     +  IP +DD +    L +   I  WNI GLPND  S+ NG+IV R  R PL+IDPQGQ   W++N EK++ L V  L    +   LE+ +  G PLL+E+VGEE+DP+L+ +L K   K G    +K+G++ ++    F+ YVTT+L NP Y PEV  K S+++F +T +GLEDQLLG+V+  E  ELE ERT L+ + A NKR+ KE+ED++L  L S++G+++EDES I++L   K  + ++  +Q++ I   TE+KI  +RE YR VA   SIL+F I +++ ++ MYQ SL  F+ L+  S+    KS +  +R+  + ++ TY ++    R  +E DK  F+ LL   +  +  +I+H +    + GG  L      P P  W+QD +W  +   S+LP FQ + E   KN + +K  +DS  P    +P  + + L   +K+++ R   PD  VP   K++   +G +F +    +L +   + +   P++  LS G+DP   ++  + KK    +  SIS+GQGQ   A K++  +MQ G W+ LQNCHL +++M    +I    +    H+ FR W+T+   PKFP+ ILQ G+K T + P G+R  L ++Y  LT D +   N F         W+ +LF + F H  VQER+KFGP+GWNIPY FN+SD   +++ +Q  +++ D    V ++ + Y+ GE  YGGRVTDD+D+RLL T   +++  ++   F    S    Y  P   S ++Y  FI+ LP+   PE FGLH N DI  +      +  +++  Q   + GG     ++ +Y +A+++L Q+LP  ++   V  K   +   + +N  L QE++R   + S +  +L +L  A+ G ++M   L+    N+   ++P  W K S+ S   LG + TD L R +    W   G+P  FW++GFF  Q FLT + Q   R ++   +D +    +V    K +    P +GVYV+GL+LDGA W+ +   L E  P++L+  +P++ V       P        +  Y CP+YK   R           N++  + L T + P HWI RGVA+L  +
Sbjct:  567 IQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDL---TPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFT--ALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQAT-SLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFPMY-------------------------------------------------SSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSRAYEKTARNQWVK------EWPGQVVLCTSQIFWTLEVHKALG---LKKYYQQLQNQ-----LNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLIE-KVSDETDFEWLAQLRYYWMNDNVR--VHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDF-EGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAE---ECCKIHNVQPTKVFTDKLIQTYEMMIVRHFML-VGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRS-LILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILD--EPVKTGPDDESIRT-WIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTI-ENINLGEINTKGQEIIVPTIDTVRYTYLMDLCISQG-PLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDH-GHYDLKDTSKIS-LVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSI-VAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNP-----------DLEGDERLYTEVPSIETFAEVVKSCLEEYNQ-MHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKN--------YGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEM--SENERQEVITICKTFH--TSANQLSDFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRI-PDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEK-IWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIV-RNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVE-SIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKEP-ELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQ-DIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARK-EIEHSDLMFLLTGGIGLQNTVANPDP-SWLQDKSWDEICRASELPGFQGL-EAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSY--LT-DPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYD---KVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYE-ESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQ-IPIDLLTFDFEVLPIDKSET--PPEDGVYVNGLFLDGARWD-KEGVLTEQHPRILFDSMPIIWV------KPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQL 3680          
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 948.732 bits (2451), Expect = 0.000e+0
Identity = 734/2505 (29.30%), Postives = 1227/2505 (48.98%), Query Frame = 1
Query: 2341 VNFDTMILELIQEAKYIRSLNLDIPEIA-SRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVR-IEAVLDDMAVTAL--CDLPEDEPITIEEFLSMTEQTVEEASEYLAKES-KLVEIAVNDIIDI-LKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISD--HKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKE-------EPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTF--DEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQ-SKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYI--RQAIDLLAGLVHGMDI-KEIKTSHLEKLIVF---SMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDD-------------TIFEYVVNDKGE-WEHWTARVPEYLYPNDHIPEY-ISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDV-INSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKK----AVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVN 9723
            VNF   + E++ E +Y+  L   +PE+A S  +  E+ +      +  ++  Y+ I++ +      M+ P I    +    G        + I D++ + ++++ +F  ++ ++  + + R IE+ L  +    L  C +P+             E  + E  ++L +E  K V +   +  DI L + +TE  + + N+            K   +E     YY    Y+ +R   +L K   L++ T    L   +              ALF+ + +L  P I  +P   EI ++L + V+  ++ ++   +W                        + P P  V   ++L++     DV ++ SQ+S    T    ++ LL     + T WK        +  T+++ F +  P  +  + +++YF ++  E+           +     PL   L +   S  +     LN    +E+  + + F  L +++ +     +D++S +  +S++R+  + +E+ +  I+E Y M+  Y+        E V ++   +S L  +++ V   L +++  F    +E ++AFK+++  F   +++ GP   G    E  + +  ++ +  ++  K    +   +L  L++ +YP+I  I+K L+ L ++Y +Y    +    +    W   +I  +   +  F     +L K ++       L   + +F  +  LL  + + A+   HW ++   TG  F+++   F L  L    L     +I++I  SA+KE  IE   K    +   Q         +  + L G A   I+  +++ +M L  +  +R+  PF   IQ+W + LT  +E IE WL VQ+ W+ LE +F G DI  QLP+EAK+   I K + +IM+     PN+ +CC         L  L   LE  QK+L  +L+ KR  FPRFF +SD  LL +LG   D   IQ H++ ++DN +++    D      + A+ S E E ++  +P+  +  VE W+  +L+  +       R++ +   ++ +   ++  S+   + L   ++ WT + E A+   +K DK  ++   ++    ++EL+    +   + +R K   ++   VH RDI D+ V   I    DFEW  Q RFY+ ++ D   V   +    Y  E++G   RL ITPLT R Y+TL+QAL M LGGA AGPAG GKTET KD+ + LG F VV +C++ MD   LG+I  GLA+ G WGCFDEFNRI   VLSV + QI  +          F F +G  + +D   GI++TMNP Y  R ELPE++K+ FR V ++ PD   I  + L S GFLQ   L+KK   LYK    QLSKQ HYDFGL +  SVL+  G  KR++ + SE  ++MR LRD+NL KLV ED  +FL LI D+FP +  S   +P     +++ ++++          K++Q++E    +   M +G +  GK+  IN L +A T  G   K   +NPKA +  +++G  D  T DWTDGIFS L+R  ++    +  +++ DG VD+ W+EN+NSVLDDNK LTLANGDRI +  +  ++FEV ++ +ASPATVSR  +V++    L + P  + W+          N +   F+       +YV   +    VTL    I  R  +++++ L   +D+  E K S  E L  +   ++  SLGA L    RLK  + +   K+L      DD+             T++++  ++  E W  W++ VPEY+    H P    + ++P VD TRT +++  + K  + VLL+GE GT+KT I++      + +  I  ++NFSS TT    QR LE+ ++KR   T+GPP G+K+ +F DDINMP ++++G Q    ++R +++  G+Y  ++   F TI D+  IAAM   GGGRN++  R    FS+FN   P+  S+  I+  +  G+    R FK  +Q     +   T KL+      + PTP+KFHY F+ R+LSRI+ G+ +   D    +  + + +W++EC+R   DR T++ DK      +K   EE   ++  A L     F D+               E    ++YE I  Y+ +S  + Q                  F+DA+ HL ++ R++R+ +GHALL+G  GS  Q+LT+LA+F +  E F+I L           YN  N   DLK LY   G   +   FLFTD  I +E FLE +NNML S  +  LFA DE + I++++ S   +E      S E++ +Y++ +    LH+VLC S  G+  + R   FP L+S   IDW+  W   AL AV+        ++  P + K    AV++ + +    + +       + +R  + T KS+L FIS Y  +  +K E +      +   L +L EA E ++
Sbjct:  510 VNFAPQLKEIMSETRYLVLLGYSVPELAQSVALQEEHFL--YVSDLNHLVSSYNSIMEGLSQTHAIMVAPQIKAAQKEIDFGC-----KRINIADFISRGQKAVSNFETVLNQI--LKNERDIESKLQSIQTANLLKCPVPDKS----------NELPIREFCDHLERERVKTVALLSRNYKDIGLTIIMTEHMIMDTNS-----------GKASLME----TYYT---YWEKRVFNSLEKMV-LSIQTFNLLLMGDT--------------ALFQINAILSAPKIELQPKSSEISMLLLQCVKNCIESTKQFPRWMR------------------GTCIECP-PQKVVGEDELVTFTFFTDVWQS-SQISENAFTVSQNIKNLLFSVDQFFTHWKRYKLLLKMKVATEIERFAKKNPSCAMYDNKLQYFENLNQEVKQEVLCKTEHIIHVNMMPLVSSLRNIAESRISTLCSFLNKPAKEELFILRDKFMQLQEKMHQRPDTFEDLKSILGTISDIRDMSLDVEIRVADIKERYRMMAMYD------ELELVANIGQIWSNLFAESRQVDQSLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVG-NDLEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWKRTKFNMQPQLKVN-----QERVFLLG-AVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPG-RLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMK-------RTSRLITKEAVYHYVDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQF-EGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQT-LGLCTKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWM---------KNRLNRLFE-------KYVPSCID---VTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSSAEVLECYFLEALYCSLGATLVESGRLKFDKLV---KSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYI----HNPAMKFADILPTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH---TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLADPILFGDY-----------RAAREECEQRVYEDIGDYD-VSKAIFQ-----------------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRR--------GYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGA--GSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQC------VLENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHVLQCKC-LEGSLNRLREAREQID 2840          

HSP 2 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 443/1333 (33.23%), Postives = 722/1333 (54.16%), Query Frame = 1
Query: 10003 LGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHEL-QVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKL--PYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGY-DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRG---VSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNP--KFSFYK----GYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWES-ATLGFWFTDLLDRNEQFHSW-LYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLN---YIFPLNLKTNEAPDHWILRGVAL 13944
              +PP  +  + +C+L+L  K+             +  W  A K+MS + FL SL+    D+I++  +  ++   N++  ++   +++S   +G+  + ++  S++ I KEV P K  +   + +   +  EL   +  L+  QKE   ++ +Y  A  EK+   D+A+   R++T A  L+ GL  ERE WT+  +   +Q + L+GD LI  AFLSY G FN DFRN ++   W  ++   GIP +      + LT+   IS W  +GLP DE SVQNG++ T+  R+PL IDPQ Q  +WI+NKEK++ L QV++LN   F   LE ++  G P L++DV E+IDP + NVLE+N + S     + +GDKEV+    F+L++ T L NP Y+P VF K  +I+++ T++GLEDQLL V     ++  + +   L+EE++ENK   K L D+LL  L ++ G+++++  LI+ L  TK  A +  +KL + +   ++  + RE YRPVA RG++L+F + +M++VN MYQ SL  +L LF+ S+  S   P   +R+ NII  LTY V  Y     +   K  F++ +T+KI    G +  +E    IK  +  D   V+ KP +WI D  W ++ +L++L    F  +   + +N   WK+W+D  APE+A  P  Y ++L  F+KLLL+R    DR       Y+  TMG       + N   + E     +P++  +S GSDPT ++ + A+K   K   I++GQGQE    KLL  ++  G W++LQNCHL + ++ +  + +    N + +FR W+TT     FPI ILQ   K   +PP  I+  ++ TY+ ++Q  L       +  +++ +AF H  VQER K+G  GW++P  FN SDF+++++ +  +L     ++G   + W+++ Y+IGEV YGGR  D +D+R+L  Y   +F   +F+P   F F++    GY IP       Y   I+K+PLI +PE  GL +  +I Y T    +M T +  +QP ++  G G   +  +  +A D+ ++LPE ++   V E+L     L P ++ L QE+ R  K++  ++ ++V+L  A+ G + MS+   D      +  +P+ W +L+ E+  +L  W + L  R EQ+ +W + EG P   W++G   P+ +L A+ Q   R  KGW LD      +VT++  ED  +   +  Y+ GL+L+GA W+  +  L    PKVL   LP++ V       PV   +         PVY    R + +    +F  +L T     HW+L GV L
Sbjct: 2875 FAKPPKQVQVVCECILVLRGKK-------------ELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIKFLKNLQT-SVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSERE-WTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSG-DGTKVQ-KPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMG-NCVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCH-EQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGRKHVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQP-ETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGT--DLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRK-KGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVI------PVQKNSLRLRNTLRTPVYTTSLRRNASGAGLVFEADLFTTMHTSHWVLSGVCL 4171          

HSP 3 Score: 90.1225 bits (222), Expect = 6.948e-17
Identity = 79/372 (21.24%), Postives = 173/372 (46.51%), Query Frame = 1
Query:  937 VNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDM-IEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFD-----------NDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQ---IDCLKLDCQDKHAKVLQNFSKTLD 2007
            + S + +E LE  +  W  QI  VL E  Q  ++ +  GP  EL+ W+ R +    L EQ+K   V  ++ +L  A +   + +      +T+   E+  N +YL T+++ F  L +     + +E IP+L+  ++ +   S++YNS+ERM  L  ++  Q+   C++   E   +     ++E+  ++   K++ E+++  + + + ++++     ++EF    +F   +        I+N+  +LE    + + +++G+       K IN++I +    +L  ++  F+              +DF V  + +E +    +D +F  ++      ++L +F+Q    D + L    K   VL  + K ++
Sbjct:  152 ITSPDMVENLEQCVMIWQTQITIVLQE--QQSKQPEGPGPLPELTLWERRATVLGALTEQLKQPAVEKILKVLGMANAGIAQTFEGTIIELTNYHLESNSNSRYLKTMERHFLNLQRGAHFSLHLETIPTLMERLQTMWLSSRHYNSNERMVPLMERIAWQL---CENVAQEIHVQTLFEKQKEVKSQVFLAKQVLEKWKLSYFENRAEIEKLGRSSRWEFDREKLFKMSDYMASVCQDIHNVFQVLEELYNIFSPELKGM-------KGINEVISRVDGLVLPFQRVSFNPFRISNKKTWKTIMEDFSVTVKDIEEEAAHIIDMFFTNTLSSAHAFDILMRFKQNRSRDAISLHLLGKFEDVLTQYCKEVN 511          
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000039073.1 (SMESG000039073.1)

HSP 1 Score: 9222.82 bits (23931), Expect = 0.000e+0
Identity = 4613/4622 (99.81%), Postives = 4613/4622 (99.81%), Query Frame = 1
Query:   94 MDENSTDLTDIAPPLVSKEPNESNMAHVDNKTKPIQTNVRAQVVTKSVPKKIITGESXXXXXXXXXXXXXXXXXXVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            MDENSTDLTDIAPPLVSKEPNESNMAHVDNKTKPIQTNVRAQVVTKSVPKKIITGESRKEQQKLLKQRKDERRLLVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKELNLLQKLYQLYNNVLDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQSFSFSSFKSRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTLSQLLPHLLEQLELCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPEATGEENEETELEAPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLT         SYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNELSKELAVKEKELEVARKKAGEVLAQVEVKASAAQKVKEQVQVVKDRAEALVNNISRDKAIAEEKLEAAKPALQEAEEALETIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK
Sbjct:    1 MDENSTDLTDIAPPLVSKEPNESNMAHVDNKTKPIQTNVRAQVVTKSVPKKIITGESRKEQQKLLKQRKDERRLLVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEEWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPDPKKPRCLECQPCVYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKELNLLQKLYQLYNNVLDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQSFSFSSFKSRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTLSQLLPHLLEQLELCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPEATGEENEETELEAPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTR--------SYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNELSKELAVKEKELEVARKKAGEVLAQVEVKASAAQKVKEQVQVVKDRAEALVNNISRDKAIAEEKLEAAKPALQEAEEALETIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 4614          
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 5415.89 bits (14048), Expect = 0.000e+0
Identity = 2739/4648 (58.93%), Postives = 3499/4648 (75.28%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVE----DYSRTDSTSIGPVSAHK-KLFIATGSSEPLKGLCFLFIRSTDKA-LTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMY-EGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPD---PKKPRCLECQPC------------------------VYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKL----------------------------------PGPGSV----------------------KSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK---EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICK----DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKT--NEAPDHWILRGVALLCDIK 13959
            +D RH ++ + +AD  DL+ T+VE+++L   +    ++FFS + +  L F++Q+  +E    D  R   T I      K K+FI  G   PLKG C +F+RS+    +  N IA D+ F +++ S G +L  LE ++S++M P  +NL+  WG +  KD  + +       L+ F+  L  A+++++ ++ L+   + DL  +I +P   +  VN++E + K+E  +  W+KQIEQVL+ES+QIRREAD++GP AEL YWK RM++FN LL+Q+K  +V   I IL  AKS++L+ W E+D RITDAANEAKDNVK+LYTL++   PL + NP  MI++IP LI+++RMIHSISQYYN+SE+MTSLFVK+TNQMIT+CK ++  +    +W L  EEL KR+  C  LN+ Y+ CF +TK +L     E+QFE SE YIFGKF+ FC+RL  I  +  I+++YS+L    IEG++S+ V++  I   IKKK Y+ LD R++EF  D+ DF+ Q + L   I  F+D  F+      + +  L++FE+++   L  ++K+ K+L ++ + ++ V K Y + K DPP+ R++P IAGKI+W+R LF++I+ PM +F+     +LK PEA  ++KNYNK+A+ L+ FE+IY+  W + I +   GL SSL+IR+P+ ++      VNFD  IL L +E   +  L L+IP  A  L   +N +K+ +  +  ++    ++ +S+P     +M   + ++     PGL    WTSMK+  Y++ V   L    LL+ +  D+   RI+ VL++M+   LC+LP D P+T++EF++ T++   +A++ L  +S+ VE +VN++I++L     + E+     ED     +      K P  +   P                           + +L +F  RN E ++K  R TL+++++R+ ++    + D   +      F+ +  L IPNI+  PN++E+Q  +N+    I+ +S+ I QW+      KQ+      + E ++D+++                                  PG  ++                      K+  K ++++K+VAK  S LS  +N+ + +V+T +  FS YS LW +   T ++EF++  P +SE +  IK +  +E +I++    Y  G +  ++E LK GL+SE  +W+  Y +  N K   EM+ I    + L KRLSR +KDLDD+R  M AL E+RE+EI+I+MTI PIEE+Y ML +YE+      +ERVD+L Y + KL ++   VQD+L+ IQP+F+  LIE V+ FK++   F  DYD+ GPM  G+ PREASDRL I+Q ++D L R++ TYSGGEELFGL VTDY  ++ I+KELNLLQKLY LYN+V+++VN YYDI W +++I+ I+ +L +FQN+CRKLPK LK+W A++DLRKTIDDFN   PLLE M++ AM PRHW+R+  +T H F+V+SD F LRN++EAPLL  KEEIEDICISAVKEKDIEAKLK V  +WSA    F +FK+RGELLL+GD T EI+S+MEDSLM L +LLSNRYN PFK  IQ+ V KL+ ++EIIE W+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  NV+QCC+GD+TLSQLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLSVFDN KTV F EK Y+ ILA  S E EA++L++P+ A+ NVEIWL  LL M+++SLH VIR+A+ +IND++F + EF   +P+QVGLLGIQ++WTRDS EAL  +K+D+KIMQ TN++FL +LN LI  TT +L K+ERTKFETLITIHVHQ+DIFD LV  K+ +P DF+WLKQ+RFYF ED D+CIVSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERK QF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDR IIIRVKLASCGF+ N VL++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E   VMRVLRDMNLSKLVD+DE LF+SLI DLFP +++    YP++ AAI++QI++A +I+H PW LKLIQLFETQRVRHGMMTLGPSGAGKT CI+VLM+A+TDCGEPH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT K KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+ KIIFEVHNIDNASPATVSRNGMVYMSSS LDW P+L+ WLL   + +     +L  F   F + YRY  Q L  KM TLE   +RQA DLL GL+   D K   +I   H E+L +FS+MWS+GALLE+EDR KL+ +I     + + + K     +DT+F+Y+V++ GEW HW ++V EY+YP D  PEY SILVPNVDN RTDFL+NT++ Q KAVLLIGEQGTAKTV++  Y    NPE  +FKSLNFSSAT P MFQRT+ES+VDKRMG+T+GPP GRKMT+FIDDINMPVINEWGDQI NEIVRQ++E+ G Y+LEKPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF I+G G++C ERGF  +V+  V NL+  TR+LW  TK KMLPTPAKFHYVFNLRDLSRIWQGM+    DVI +   L+ LWKHEC RVI+DRFT   D  WF K L     E+ G   V  LQ E YFVDFL+DA EATGEE ++T+ + PK+YEPI S++QL DRL  +   YNE++RG  +D+VFF DAMTHL+KISR+IRT +G+ALLVGVGGSGKQ+LT+LAS+I+GY+ FQITLT         SYN+SNL+EDLK LYRT+GQ GKGITFLFTD EIKDE FLE++NN+LSSG ++NLFARDEMDEI QEL+ +MKKEYPRRPP+N+NLQEY++SR  + LHVVLCFSP+GEKFRNR+L+FPGLISGCT+DWFQRWPKDALIAV+ ++LS+FEIV  P VKK ++ +MG+  D VAENC++YFQRFRR THVTPKSYLSF++GYK +Y +K +    LA RM++GL+KL+EA ESV EL + LA KEKEL +A ++A EVL  V V+ +AA +VK +VQVVKD+A+++V  I RDK IAE KLEAA+PAL+EAE+AL TIKP  IATV+KLGRPPHLIMRIMDCVLI F++RLD++  DPER  PKP+W E++KLMS + FL +L+NFPKDTIN+E V+L+ PY  MED+ +  A+ V G+VAGL SWT+AM SFF INKEVLPLK NL  QQ + E +M++LN AQ +LD KQKEL  VQA Y++A+ +KQ L DDAE CRRKMT A  LI GLAGE+ RWT  S  F  QI +LVGDVL  TAFLSYCGPFNQ+FRNIL  SW+ EL T  IPF+  +  I MLTD   + EW++QGLPNDELSVQNG+IVT+A RYPLLIDPQGQGK WI+N+E   ELQVT+LNHKYFR HLED+LSLGRPLLIED+GEE+DPALDNVLEKNFIK GSTFKVKVGDKEVDVMKGF+LY+TTKLPNPSYTPE+FA+TSIIDFTVT+KGLEDQLLG+VI TEKQELEA+R +LME+V  NK+K KELEDNLL+RLTST+GSLV+DE LI+VL+ TK T+ +V QKLII  DTEIKINSAREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLGLFD SM+ SQKSP+T KRI NIIE +TYEV++Y  RG YESDK TFT+L+ +K+ M++G+IK EEF  FIKGGA+LD+N V+PKPK WI D+TWLNLVELS L  F  + +QV++N+K W+ WFD +APEE  IPDGY+ NL+TF++LLL+R WCPDRT+  AKKYI++++G +FAEG I + +++ EE    TPM+  LSMGSDPT  IE LAKK  ++C +ISMGQGQE+H+R+L++  +  G W+LLQNCHL L++M+E ++ +  TE IH+ FR WVTTE HPKFPI+ LQ+ IKFT +PP GI+AG++RTY    QD LDI+N  QW+PM++ VA+LHT VQERRKFGP+GWNIPYE+N +D  +++QFVQNHLDDMD+K+G+SWKT+CYM+GE+QYGGRVTDDYDKRLLNT+ + WF+ +MFNPKF F+K + IP+   L+EY   I++LP  DSPE FGLH+NADI Y++  A  +L  I+NIQPKD+  G GETRESVVYR+ DDML +LP DY  FEV E+LQ MG L+P+NIFL+QEVDRMQKVI+ VR+TL+DLKLAIDGTIIM+E+L+DALD+++DARIPS W K+SWES+TLGFWFT+L++RN QF +WL++GRP CFWMTGFFN QGFLTAMRQE+TR HKGWALD VVL NDVTK M++++N  PSEGVYV+GLYL+GAGW+ R++KL E   KVL+ PLPV+ + A+ ++          +  Y+CPVYKKPRRTDL +I  + L+    +  DHW LR VALLCDIK
Sbjct:   44 LDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLE-KDEDSRR--AMMNSLENFVLVLSNARESINERVALKVCTEIDL-KRIRLPIDCMNIVNNTEQLMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKE----LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRI-AAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTTLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE--RPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFTAHEDISWFNKVLLRIVNEDLGEVHVGSLQDERYFVDFLRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTR--------SYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4671          
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 5409.34 bits (14031), Expect = 0.000e+0
Identity = 2735/4651 (58.80%), Postives = 3503/4651 (75.32%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVE----DYSRTDSTSIGPVSAHK-KLFIATGSSEPLKGLCFLFIRSTDKA-LTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMY-EGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDILKMNLTESELKNLNAEDGYECLQPD---PKKPRCLECQPC------------------------VYYAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKL----------------------------------PGPGSV----------------------KSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK---EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICK----DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQ---TEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKT--NEAPDHWILRGVALLCDIK 13959
            +D RH ++ + +AD  DL+ T+VE+++L   +    ++FFS + +  L F++Q+  +E    D  R   T I      K K+FI  G   PLKG C +F+RS+    +  N IA D+ F +++ S G +L  LE ++S++M P  +NL+  WG +  KD  + +       L+ F+  L  A+++++ ++ L+   + DL  +I +P   +  VN++E + K+E  +  W+KQIEQVL+ES+QIRREAD++GP AEL YWK RM++FN LL+Q+K  +V   I IL  AKS++L+ W E+D RITDAANEAKDNVK+LYTL++   PL + NP  MI++IP LI+++RMIHSISQYYN+SE+MTSLFVK+TNQMIT+CK ++  +    +W L  EEL KR+  C  LN+ Y+ CF +TK +L     E+QFE SE YIFGKF+ FC+RL  I  +  I+++YS+L    IEG++S+ V++  I   IKKK Y+ LD R++EF  D+ DF+ Q + L   I  F+D  F+      + +  L++FE+++   L  ++K+ K+L ++ + ++ V K Y + K DPP+ R++P IAGKI+W+R LF++I+ PM +F+     +LK PEA  ++KNYNK+A+ L+ FE+IY+  W + I +   GL SSL+IR+P+ ++      VNFD  IL L +E   +  L L+IP  A  L   +N +K+ +  +  ++    ++ +S+P     +M   + ++     PGL    WTSMK+  Y++ V   L    LL+ +  D+   RI+ VL++M+   LC+LP D P+T++EF++ T++   +A++ L  +S+ VE +VN++I++L     + E+     ED     +      K P  +   P                           + +L +F  RN E ++K  R TL+++++R+ ++    + D   +      F+ +  L IPNI+  PN++E+Q  +N+    I+ +S+ I QW+      KQ+      + E ++D+++                                  PG  ++                      K+  K ++++K+VAK  S LS  +N+ + +V+T +  FS YS LW +   T ++EF++  P +SE +  IK +  +E +I++    Y  G +  ++E LK GL+SE  +W+  Y +  N K   EM+ I    + L KRLSR +KDLDD+R  M AL E+RE+EI+I+MTI PIEE+Y ML +YE+      +ERVD+L Y + KL ++   VQD+L+ IQP+F+  LIE V+ FK++   F  DYD+ GPM  G+ PREASDRL I+Q ++D L R++ TYSGGEELFGL VTDY  ++ I+KELNLLQKLY LYN+V+++VN YYDI W +++I+ I+ +L +FQN+CRKLPK LK+W A++DLRKTIDDFN   PLLE M++ AM PRHW+R+  +T H F+V+SD F LRN++EAPLL  KEEIEDICISAVKEKDIEAKLK V  +WSA    F +FK+RGELLL+GD T EI+S+MEDSLM L +LLSNRYN PFK  IQ+ V KL+ ++EIIE W+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  NV+QCC+GD+TLSQLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLSVFDN KTV F EK Y+ ILA  S E EA++L++P+ A+ NVEIWL  LL M+++SLH VIR+A+ +IND++F + EF   +P+QVGLLGIQ++WTRDS EAL  +K+D+KIMQ TN++FL +LN LI  TT +L K+ERTKFETLITIHVHQ+DIFD LV  K+ +P DF+WLKQ+RFYF ED D+CIVSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERK QF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDR IIIRVKLASCGF+ N VL++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E   VMRVLRDMNLSKLVD+DE LF+SLI DLFP +++    YP++ AAI++QI++A +I+H PW LKLIQLFETQRVRHGMMTLGPSGAGKT CI+VLM+A+TDCGEPH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT K KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+ KIIFEVHNIDNASPATVSRNGMVYMSSS LDW P+L+ WLL   + +     +L  F   F + YRY  Q L  KM TLE   +RQA DLL GL+   D K   +I   H E+L +FS+MWS+GALLE+EDR KL+ +I     + + + K     +DT+F+Y+V++ GEW HW ++V EY+YP D  PEY SILVPNVDN RTDFL+NT++ Q KAVLLIGEQGTAKTV++  Y    NPE  +FKSLNFSSAT P MFQRT+ES+VDKRMG+T+GPP GRKMT+FIDDINMPVINEWGDQI NEIVRQ++E+ G Y+LEKPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF I+G G++C ERGF  +V+  V NL+  TR+LW  TK KMLPTPAKFHYVFNLRDLSRIWQGM+    DVI +   L+ LWKHEC RVI+DRF +  D  WF KTLK    E+   ++V+  Q   T+ +F+DF++DA EATGEE ++T+ + PK+YEPI S++QL DRL  +   YNE++RG  +D+VFF DAMTHL+KISR+IRT +G+ALLVGVGGSGKQ+LT+LAS+I+GY+ FQITLT         SYN+SNL+EDLK LYRT+GQ GKGITFLFTD EIKDE FLE++NN+LSSG ++NLFARDEMDEI QEL+ +MKKEYPRRPP+N+NLQEY++SR  + LHVVLCFSP+GEKFRNR+L+FPGLISGCT+DWFQRWPKDALIAV+ ++LS+FEIV  P VKK ++ +MG+  D VAENC++YFQRFRR THVTPKSYLSF++GYK +Y +K +    LA RM++GL+KL+EA ESV EL + LA KEKEL +A ++A EVL  V V+ +AA +VK +VQVVKD+A+++V  I RDK IAE KLEAA+PAL+EAE+AL TIKP  IATV+KLGRPPHLIMRIMDCVLI F++RLD++  DPER  PKP+W E++KLMS + FL +L+NFPKDTIN+E V+L+ PY  MED+ +  A+ V G+VAGL SWT+AM SFF INKEVLPLK NL  QQ + E +M++LN AQ +LD KQKEL  VQA Y++A+ +KQ L DDAE CRRKMT A  LI GLAGE+ RWT  S  F  QI +LVGDVL  TAFLSYCGPFNQ+FRNIL  SW+ EL T  IPF+  +  I MLTD   + EW++QGLPNDELSVQNG+IVT+A RYPLLIDPQGQGK WI+N+E   ELQVT+LNHKYFR HLED+LSLGRPLLIED+GEE+DPALDNVLEKNFIK GSTFKVKVGDKEVDVMKGF+LY+TTKLPNPSYTPE+FA+TSIIDFTVT+KGLEDQLLG+VI TEKQELEA+R +LME+V  NK+K KELEDNLL+RLTST+GSLV+DE LI+VL+ TK T+ +V QKLII  DTEIKINSAREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLGLFD SM+ SQKSP+T KRI NIIE +TYEV++Y  RG YESDK TFT+L+ +K+ M++G+IK EEF  FIKGGA+LD+N V+PKPK WI D+TWLNLVELS L  F  + +QV++N+K W+ WFD +APEE  IPDGY+ NL+TF++LLL+R WCPDRT+  AKKYI++++G +FAEG I + +++ EE    TPM+  LSMGSDPT  IE LAKK  ++C +ISMGQGQE+H+R+L++  +  G W+LLQNCHL L++M+E ++ +  TE IH+ FR WVTTE HPKFPI+ LQ+ IKFT +PP GI+AG++RTY    QD LDI+N  QW+PM++ VA+LHT VQERRKFGP+GWNIPYE+N +D  +++QFVQNHLDDMD+K+G+SWKT+CYM+GE+QYGGRVTDDYDKRLLNT+ + WF+ +MFNPKF F+K + IP+   L+EY   I++LP  DSPE FGLH+NADI Y++  A  +L  I+NIQPKD+  G GETRESVVYR+ DDML +LP DY  FEV E+LQ MG L+P+NIFL+QEVDRMQKVI+ VR+TL+DLKLAIDGTIIM+E+L+DALD+++DARIPS W K+SWES+TLGFWFT+L++RN QF +WL++GRP CFWMTGFFN QGFLTAMRQE+TR HKGWALD VVL NDVTK M++++N  PSEGVYV+GLYL+GAGW+ R++KL E   KVL+ PLPV+ + A+ ++          +  Y+CPVYKKPRRTDL +I  + L+    +  DHW LR VALLCDIK
Sbjct:   44 LDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLE-KDEDSRR--AMMNSLENFVLVLSNARESINERVALKVCTEIDL-KRIRLPIDCMNIVNNTEQLMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKE----LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRI-AAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTTLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE--RPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTR--------SYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4674          
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4045.35 bits (10490), Expect = 0.000e+0
Identity = 2051/3520 (58.27%), Postives = 2602/3520 (73.92%), Query Frame = 1
Query: 3427 SGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA--LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKR-----GVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKAN-ERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +G +   KS  QTL      YS LW   P  ++ EF + KP + E  ++ K    ++ ++ +  P Y +G +   +   K   ++    +K  Y      +    +++I    D + + LS+ + +LDD+   M  L+ +R+ +IK++  I   E A   + K++I +     ++V+++   Y++++       DH+L IQ  +K  L+  +   K ++  F+ DY+ RGPM  G+ P EA D+  +++ +FD L RK  +Y+ GE LFGL  + YP   +I KEL LLQ+LY LYN V  TV+ YY+I W  +++D I   L +FQNKC++LPKALK+W AY DL+KTIDDFNE  PLLE M++ AM PRHW+R+  +T + F                                   D+  K     +DW+ Q    +SFK+RGELLLKGD   E++SL+EDSLM L +L+SNRYNAPFK  I EWVQKLT ++E++ENW+ VQNLW+YLEAVFVGGDIAKQLPQEAKRF  IDKS+ K+M+RA +  NVVQCC  D +L +LLP L EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASD H+IQAHLLS+FDNTK V FD++ YD I++  S ENE +++  P+  +G+VE WLG LLK+++ SLH+VI++A+  I D    L EF  + PSQVGLLGIQ++WTR++ +AL +++ D KIMQ TN+ FL +LN LI  TT++LTK  RTK+ETLITIHVHQRDIFDDL  L + +  DFEW KQ+RFYF ED D+C++SITDVDF YQNEFLGCT+RLVITPLTDRCYIT++QAL MSLG APAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI+++L CKKE K QFIF+DGD V+M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLA+CGF++N +L++KF+ LYKLCEEQL+KQVHYDFGLRNILSVLR+LG+ +R  P+DSE   VMRVLRDMNLSKLVD+DE LFLSLI DLFP + +    YP++ +++ KQ++  K+INH PW LK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLM+A+TDCG+PH+EMRMNPKAI A +MFG+LDVATNDWTDGIFSTLWRRT K+KKGEH WLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM PN KIIFEVHNIDNASPATVSRNGMV+MSSS L+W PIL+ WLL    ++     +   F+  F +  +++   L+ KMV LE   IRQA D+L G++     + +   HLE+L  F++MWSLGA LEL +R K++EFI +  +  L +P  + D T+FEY VN +G+W+HW   + EY+YP+D  PEY  ILVPNVDN RT+FL++ I+KQ K+VLLIGE GTAKTV++  Y GK N E ++ KS NFSSATTP +FQRT+ES+V+KR+GTTFGPP G+KM++FIDDINMP+INEWGDQI NEIVRQ MEM G YSLE+PG+FT IVD+Q ++AMIHPGGGRNDIP+RLKR F+IFNCTLPSN SIDK   +L       +   +  V+ ++N L T                  KFHYVFNLRDLSRIWQG++  NSDVI +   L++LWKHECMRVI+DRF    D+ WF K ++    EE  +++   ++   YFVDFL+DAPE TGEE E+ +   PKIYEPI   + L  RL  +M  YNE++RG  +DLVFF DAM HLVK+SR+IRT  G+ALLVGVGGSGKQSLTRLA+ I+GY                 SYNVSNL+EDLK LYR++GQ GKG TF+FTDN+IKDE FLE++NN+LSSG ++ LF +DE+DE+   LV VMKKE+P+RPP+NENL EY+ SRV K LHVVLCFSPVG+KFR R+L FPGLISGC  DWFQ+WPKDAL+AV+ ++L  FE+V     K  +++++    D VA  C  YF ++RR+THVTPKSYLSF+  Y++VY++K++ I  LA RM++GL+KL+EA +S+ ELS ELA KEKELEVA K+A +VL  V  + +AAQ VK++VQ VKDR   +V +I+ DKAIAE KLEAAKPAL EAEEAL TIKP  I+TV+KL +PPHLIMRIMDCVL+LF++ +D V  DPERPC KP+W E++KLM+ S FL +LLNF +D+IN+E+VDLM PY NMED+NL +AK V G+VAGL  WT+AM  F+ +N+EVLPLK NLA Q+ KL  A  +L  A+ +L  K++ L IV+A+Y  AM  KQ L DDAEACRR+M  AK LI GL+GE+ RWTE SK+F  Q K+L                   DFR  L  +W  E+V   IP T  +  I +LTD  TISEWN+QGLPNDELS+QNG+IVT A RYPLLIDPQGQGK WI+N+E   ELQ+T+LNHKYFR HLEDALSLGRP+LIED+ EE+DPALD VLEKNFIK G+  KVKVGDKEVDVMKGF LY+TTKLPNP YTPE++AKTS+IDFTVTIKGLEDQLLG VI TEK+ELE  R +L+E +  NKR+ +ELED+LL RL +T+GSLV+D+ L++VL  TK T+++V  +L    +TE +IN+AREEYRPVATRGS+LYFL  EMS VN+MYQ  LKQFL LFD+SM  S KSPIT +RI+ IIEY+T++++++  RG Y+ D+ T T++L +KI ++S  I+ EEF + IKGG+ LDL  V PKP KWI DLTWLNL  LS L  F  I EQV + +K WK W+D + PE   IP GY+ NL+TF++LL++RSWCPDRT+P AKKYI  ++G  FAE V+ N+E++  + D  + +I  LSMGSD T  IE+LAKKK++ C ++SMGQGQE+H+RKL+S  MQEG W+LLQNCHL L++++E    I   EN+HE +R W+TTE H KF IN+LQ+ IKFT +PP GI+A L RTY  +TQD LD    F WK MLF +AFLH TVQERRKFGP+GWNIPYE+NQSDF +++QF+QNHLD ++ K+     G+ WK V YMI E+QYGGRVTDDYDK+                              K L     F  +LP  D+PE FGLH NADI Y T    Q+L TI++IQPKD+  G GETRESVV R   DMLQ+LP +Y P++V+EKLQKMG+L P+NIFL+QEVDRM KVI +VR+TL DL+LAI GTIIM+ENL+DALDN++DA+IP  W+K+SW+SATLGFWF++L+DRN QF SWL +GRPV FWMTGFFN QGFLTAMRQE+TR+H GWALD+VVL++ VTK + +++   P EGVYV+GL+++GA W+ R+++L EP PK LY  LPV++++A+      A K K +  + Y  P+YKKPRRTDL Y+  + L  ++ PDHW++RGVALLCDIK
Sbjct: 1173 NGELKEIKSLTQTL----QCYSNLWLSNPIEEIAEFKKNKPSMYEFQSKFKELDSVQEQLENEVPFYIIGPLYIDTTEFKLAALANLKQFKQVYVTGCTERFVGRIEAIQTQLDEIERNLSKNITNLDDIAFIMDTLAYIRQIDIKMDYDIMTAEYASQTMSKFDIPYPKSTGDQVEAVRCNYNRMKENEFQAIDHILAIQGSYKEGLLNNINQLKIDIEDFINDYNERGPMKPGLPPVEALDKQILFKNRFDNLLRKLESYAKGEILFGLPTSSYPSFLQIGKELELLQRLYGLYNEVNKTVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSF-----------------------------------DMMLKTFACQHDWANQDLKLASFKNRGELLLKGDRVSEVISLLEDSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSE--REKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQ---ESLPDKHLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDSTMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDKSLVLLVWDIIVRK---EVSVKKSLNTLRT------------------KFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDLAESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGY----------------SSYNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKK------------------------------KCLHRNSIFT-RLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQ----EATKNKIDTSKLYTTPIYKKPRRTDLTYVASVELVCSKTPDHWVMRGVALLCDIK 4557          

HSP 2 Score: 395.201 bits (1014), Expect = 3.619e-109
Identity = 251/860 (29.19%), Postives = 441/860 (51.28%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFY-YQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGR--LLDALERHISKIMFPVLQNLE-EWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYE-GVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPED-EPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL 2880
            +D RH ++ + + +   +    +ED +    +  A + F +PN + KL  Y  ++ + +  ++         +    L    GS    KG          + +T  N+  DI    L   GG   LL +    I+K+  P ++  E E G +     H+ K   +   +  F N+L TA   ++ ++ L  +    ++  +E  +    A N  ET+ K E L  +W+KQI++ ++E E +R E+  +GP  EL +WK +M+RFN L+ Q+K K V +V+ IL  A S++L KW +LD ++T A  E+K+N K+L  ++K+  PL   N   MIE +P L+ ++ MI+  S YY +   MT LFVK+TNQMI TCK F+ +     +WD   E   KR+  C  LN  Y+ C+ K +K+++ ++  + F+FSE  IFG F  F  RL K+  +   +++YS+L+   +EG D+I+ RY  I   I  K YD L+ R   FD DY++F  Q E L   +   + ++F +S  +   L +  K E+I   +LD   ++ ++ ++F      ++ ++ +++ +PPL R++P  AG+I+W+R+L+  +E  M LF  T PE+  + E  ++V  YN   ++L+ +E+  Y+ W + I +   G+ SS+ I   D+     + ++N D  +L L++E   +  L   +  +   +    + +K     ++    E+  I+  VP     ++ P   +I      G+    W  + + +Y+E + + +  F LL+ +  DI D RI  +L  +A T L   PE+ EP  I +FL +T +   + S+ +   S  +  A ND +DIL
Sbjct:   33 LDERHHYLIKFMEEFFKIKHDIIEDYICDSNQLEAVQSFLAPNETDKLFVYRIKNSLYKRITKKSGNKFMKKTDDDILCFHIGSLPFTKGGIIFVKTDVTQPITERNMTTDIFLIKL---GGEKSLLGSYVESIAKVFLPFIEGQETELGELE----HSGK-KNYVNFIQDFNNSLETASICVEEKVILNMEGSTVIVTGVEGLAN---AANDPETLSKAEELASKWMKQIQKEITEIELLRVESGIIGPHEELKFWKKQMTRFNCLVNQLKQKPVINVLLILKIAHSKALDKWIQLDQKVTRAFIESKENTKFLNVIEKYCVPLYHRNIEKMIEIVPKLLQSLSMIYVYSTYYRTFTNMTQLFVKITNQMIFTCKSFITDKNKHTLWDDEPETFVKRMEICINLNHVYQKCYQKVRKEMKYENENRYFDFSEVQIFGNFNLFESRLIKLIAILKSMKNYSILKDVVLEGKDAIMNRYDRITQSITTKKYDFLNQRNLAFDKDYEEFQNQIEDLHSALIGVITSYFHRSKGVAAGLRMQSKIEKISIPELDHFARYVELFKSFRSENLTIKNIFIEHQDNPPLDRDMPYFAGRIAWARNLYLHLEENMNLFVLTCPEVFTIAEGRRIVHTYNTTTEMLVHYEITVYHTWKRLITSKLNGMKSSIFILTNDEPY--GECILNIDPDVLGLLREISCLDRLGCALTSVPREIYAKNDFLKRRSEKIRYFCQEHKRIMAKVPAEYEKLLLPITTKIYREIGKGMTLYDWCCLGVEEYIEGLLKLIYEFELLLNRAFDIRDFRINNILTSIAETELFAQPENGEPWEINKFLEITVEKCLKGSQSMHYFSLSIYEASNDYVDIL 879          
BLAST of Dynein heavy chain axonemal-like vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4043.43 bits (10485), Expect = 0.000e+0
Identity = 2051/3520 (58.27%), Postives = 2601/3520 (73.89%), Query Frame = 1
Query: 3427 SGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKEXXXXXXXXXXXXXXXDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQXXXXXXXXXRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTXXXXXXXXXXXXXXCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLXXXXXXXXXXXXXXXXXDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKA--LPVPICKDDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPXXXXXXXXXXXXXXPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTSNSDGKHNGSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNXXXXXXXXXXXXXXXXRKKAGEVLXXXXXXXXXXXXXXXXXXXXXDRAEALVNNISRDXXXXXXXXXXXXXXXXXXXXXXXTIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKR-----GVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKAN-ERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 13959
            +G +   KS  QTL      YS LW   P  ++ EF + KP + E  ++ K    ++ ++ +  P Y +G +   +   K   ++    +K  Y      +    +++I    D + + LS+ + +LDD+   M  L+ +R+ +IK++  I   E A   + K++I +     ++V+++   Y++++       DH+L IQ  +K  L+  +   K ++  F+ DY+ RGPM  G+ P EA D+  +++ +FD L RK  +Y+ GE LFGL  + YP   +I KEL LLQ+LY LYN V  TV+ YY+I W  +++D I   L +FQNKC++LPKALK+W AY DL+KTIDDFNE  PLLE M++ AM PRHW+R+  +T + F    D F                                      +DW+ Q    +SFK+RGELLLKGD   E++SL+EDSLM L +L+SNRYNAPFK  I EWVQKLT ++E++ENW+ VQNLW+YLEAVFVGGDIAKQLPQEAKRF  IDKS+ K+M+RA +  NVVQCC  D +L +LLP L EQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASD H+IQAHLLS+FDNTK V FD++ YD I++  S ENE +++  P+  +G+VE WLG LLK+++ SLH+VI++A+  I D    L EF  + PSQVGLLGIQ++WTR++ +AL +++ D KIMQ TN+ FL +LN LI  TT++LTK  RTK+ETLITIHVHQRDIFDDL  L + +  DFEW KQ+RFYF ED D+C++SITDVDF YQNEFLGCT+RLVITPLTDRCYIT++QAL MSLG APAGPAGTGKTETTKDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGLAQSGSWGCFDEFNRIELPVLSVAAQQI+++L CKKE K QFIF+DGD V+M+PEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDR IIIRVKLA+CGF++N +L++KF+ LYKLCEEQL+KQVHYDFGLRNILSVLR+LG+ +R  P+DSE   VMRVLRDMNLSKLVD+DE LFLSLI DLFP + +    YP++ +++ KQ++  K+INH PW LK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLM+A+TDCG+PH+EMRMNPKAI A +MFG+LDVATNDWTDGIFSTLWRRT K+KKGEH WLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM PN KIIFEVHNIDNASPATVSRNGMV+MSSS L+W PIL+ WLL    ++     +   F+  F +  +++   L+ KMV LE   IRQA D+L G++     + +   HLE+L  F++MWSLGA LEL +R K++EFI +  +  L +P  + D T+FEY VN +G+W+HW   + EY+YP+D  PEY  ILVPNVDN RT+FL++ I+KQ K+VLLIGE GTAKTV++  Y GK N E ++ KS NFSSATTP +FQRT+ES+V+KR+GTTFGPP G+KM++FIDDINMP+INEWGDQI NEIVRQ MEM G YSLE+PG+FT IVD+Q ++AMIHPGGGRNDIP+RLKR F+IFNCTLPSN SIDK   +L       +   +  V+ ++N L T                  KFHYVFNLRDLSRIWQG++  NSDVI +   L++LWKHECMRVI+DRF    D+ WF K ++    EE  +++   ++   YFVDFL+DAPE TGEE E+ +   PKIYEPI   + L  RL  +M  YNE++RG  +DLVFF DAM HLVK+SR+IRT  G+ALLVGVGGSGKQSLTRLA+ I+GY                 SYNVSNL+EDLK LYR++GQ GKG TF+FTDN+IKDE FLE++NN+LSSG ++ LF +DE+DE+   LV VMKKE+P+RPP+NENL EY+ SRV K LHVVLCFSPVG+KFR R+L FPGLISGC  DWFQ+WPKDAL+AV+ ++L  FE+V     K  +++++    D VA  C  YF ++RR+THVTPKSYLSF+  Y++VY++K++ I  LA RM++GL+KL+EA +S+ ELS ELA KEKELEVA K+A +VL  V  + +AAQ VK++VQ VKDR   +V +I+ DKAIAE KLEAAKPAL EAEEAL TIKP  I+TV+KL +PPHLIMRIMDCVL+LF++ +D V  DPERPC KP+W E++KLM+ S FL +LLNF +D+IN+E+VDLM PY NMED+NL +AK V G+VAGL  WT+AM  F+ +N+EVLPLK NLA Q+ KL  A  +L  A+ +L  K++ L IV+A+Y  AM  KQ L DDAEACRR+M  AK LI GL+GE+ RWTE SK+F  Q K+L                   DFR  L  +W  E+V   IP T  +  I +LTD  TISEWN+QGLPNDELS+QNG+IVT A RYPLLIDPQGQGK WI+N+E   ELQ+T+LNHKYFR HLEDALSLGRP+LIED+ EE+DPALD VLEKNFIK G+  KVKVGDKEVDVMKGF LY+TTKLPNP YTPE++AKTS+IDFTVTIKGLEDQLLG VI TEK+ELE  R +L+E +  NKR+ +ELED+LL RL +T+GSLV+D+ L++VL  TK T+++V  +L    +TE +IN+AREEYRPVATRGS+LYFL  EMS VN+MYQ  LKQFL LFD+SM  S KSPIT +RI+ IIEY+T++++++  RG Y+ D+ T T++L +KI ++S  I+ EEF + IKGG+ LDL  V PKP KWI DLTWLNL  LS L  F  I EQV + +K WK W+D + PE   IP GY+ NL+TF++LL++RSWCPDRT+P AKKYI  ++G  FAE V+ N+E++  + D  + +I  LSMGSD T  IE+LAKKK++ C ++SMGQGQE+H+RKL+S  MQEG W+LLQNCHL L++++E    I   EN+HE +R W+TTE H KF IN+LQ+ IKFT +PP GI+A L RTY  +TQD LD    F WK MLF +AFLH TVQERRKFGP+GWNIPYE+NQSDF +++QF+QNHLD ++ K+     G+ WK V YMI E+QYGGRVTDDYDK+                              K L     F  +LP  D+PE FGLH NADI Y T    Q+L TI++IQPKD+  G GETRESVV R   DMLQ+LP +Y P++V+EKLQKMG+L P+NIFL+QEVDRM KVI +VR+TL DL+LAI GTIIM+ENL+DALDN++DA+IP  W+K+SW+SATLGFWF++L+DRN QF SWL +GRPV FWMTGFFN QGFLTAMRQE+TR+H GWALD+VVL++ VTK + +++   P EGVYV+GL+++GA W+ R+++L EP PK LY  LPV++++A+      A K K +  + Y  P+YKKPRRTDL Y+  + L  ++ PDHW++RGVALLCDIK
Sbjct: 1173 NGELKEIKSLTQTL----QCYSNLWLSNPIEEIAEFKKNKPSMYEFQSKFKELDSVQEQLENEVPFYIIGPLYIDTTEFKLAALANLKQFKQVYVTGCTERFVGRIEAIQTQLDEIERNLSKNITNLDDIAFIMDTLAYIRQIDIKMDYDIMTAEYASQTMSKFDIPYPKSTGDQVEAVRCNYNRMKENEFQAIDHILAIQGSYKEGLLNNINQLKIDIEDFINDYNERGPMKPGLPPVEALDKQILFKNRFDNLLRKLESYAKGEILFGLPTSSYPSFLQIGKELELLQRLYGLYNEVNKTVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSF----DTF-----------------------------------ACQHDWANQDLKLASFKNRGELLLKGDRVSEVISLLEDSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSE--REKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQ---ESLPDKHLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDSTMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDKSLVLLVWDIIVRK---EVSVKKSLNTLRT------------------KFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDLAESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGY----------------SSYNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKK------------------------------KCLHRNSIFT-RLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQ----EATKNKIDTSKLYTTPIYKKPRRTDLTYVASVELVCSKTPDHWVMRGVALLCDIK 4553          

HSP 2 Score: 395.201 bits (1014), Expect = 2.982e-109
Identity = 251/860 (29.19%), Postives = 441/860 (51.28%), Query Frame = 1
Query:  319 VDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFY-YQDVMVEDYSRTDSTSIGPVSAHKKLFIATGSSEPLKGLCFLFIRSTDKALTSNNIAADITFQMLDASGGR--LLDALERHISKIMFPVLQNLE-EWGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYE-GVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPED-EPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL 2880
            +D RH ++ + + +   +    +ED +    +  A + F +PN + KL  Y  ++ + +  ++         +    L    GS    KG          + +T  N+  DI    L   GG   LL +    I+K+  P ++  E E G +     H+ K   +   +  F N+L TA   ++ ++ L  +    ++  +E  +    A N  ET+ K E L  +W+KQI++ ++E E +R E+  +GP  EL +WK +M+RFN L+ Q+K K V +V+ IL  A S++L KW +LD ++T A  E+K+N K+L  ++K+  PL   N   MIE +P L+ ++ MI+  S YY +   MT LFVK+TNQMI TCK F+ +     +WD   E   KR+  C  LN  Y+ C+ K +K+++ ++  + F+FSE  IFG F  F  RL K+  +   +++YS+L+   +EG D+I+ RY  I   I  K YD L+ R   FD DY++F  Q E L   +   + ++F +S  +   L +  K E+I   +LD   ++ ++ ++F      ++ ++ +++ +PPL R++P  AG+I+W+R+L+  +E  M LF  T PE+  + E  ++V  YN   ++L+ +E+  Y+ W + I +   G+ SS+ I   D+     + ++N D  +L L++E   +  L   +  +   +    + +K     ++    E+  I+  VP     ++ P   +I      G+    W  + + +Y+E + + +  F LL+ +  DI D RI  +L  +A T L   PE+ EP  I +FL +T +   + S+ +   S  +  A ND +DIL
Sbjct:   33 LDERHHYLIKFMEEFFKIKHDIIEDYICDSNQLEAVQSFLAPNETDKLFVYRIKNSLYKRITKKSGNKFMKKTDDDILCFHIGSLPFTKGGIIFVKTDVTQPITERNMTTDIFLIKL---GGEKSLLGSYVESIAKVFLPFIEGQETELGELE----HSGK-KNYVNFIQDFNNSLETASICVEEKVILNMEGSTVIVTGVEGLAN---AANDPETLSKAEELASKWMKQIQKEITEIELLRVESGIIGPHEELKFWKKQMTRFNCLVNQLKQKPVINVLLILKIAHSKALDKWIQLDQKVTRAFIESKENTKFLNVIEKYCVPLYHRNIEKMIEIVPKLLQSLSMIYVYSTYYRTFTNMTQLFVKITNQMIFTCKSFITDKNKHTLWDDEPETFVKRMEICINLNHVYQKCYQKVRKEMKYENENRYFDFSEVQIFGNFNLFESRLIKLIAILKSMKNYSILKDVVLEGKDAIMNRYDRITQSITTKKYDFLNQRNLAFDKDYEEFQNQIEDLHSALIGVITSYFHRSKGVAAGLRMQSKIEKISIPELDHFARYVELFKSFRSENLTIKNIFIEHQDNPPLDRDMPYFAGRIAWARNLYLHLEENMNLFVLTCPEVFTIAEGRRIVHTYNTTTEMLVHYEITVYHTWKRLITSKLNGMKSSIFILTNDEPY--GECILNIDPDVLGLLREISCLDRLGCALTSVPREIYAKNDFLKRRSEKIRYFCQEHKRIMAKVPAEYEKLLLPITTKIYREIGKGMTLYDWCCLGVEEYIEGLLKLIYEFELLLNRAFDIRDFRINNILTSIAETELFAQPENGEPWEINKFLEITVEKCLKGSQSMHYFSLSIYEASNDYVDIL 879          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH50.000e+060.62dynein axonemal heavy chain 5 [Source:HGNC Symbol;... [more]
DNAH80.000e+058.88dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+059.36dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+058.14dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH21.283e-1933.92dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-10.000e+026.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-36.819e-12832.23Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-33.537e-1922.70Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94920.000e+052.31gene:FBgn0037726 transcript:FBtr0309029[more]
CG94920.000e+052.00gene:FBgn0037726 transcript:FBtr0344344[more]
CG94920.000e+052.09gene:FBgn0037726 transcript:FBtr0309028[more]
CG94920.000e+051.79gene:FBgn0037726 transcript:FBtr0309027[more]
kl-30.000e+048.94gene:FBgn0267432 transcript:FBtr0346771[more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah5l0.000e+061.83dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah50.000e+059.83dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah5l0.000e+068.10dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah23.949e-3233.88dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah27.075e-2233.91dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021690.10.000e+060.77dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
nifk1.246e-8668.44nucleolar protein interacting with the FHA domain ... [more]
nifk5.826e-11068.53nucleolar protein interacting with the FHA domain ... [more]
nifk8.201e-10267.95nucleolar protein interacting with the FHA domain ... [more]
nifk2.051e-15867.82nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah50.000e+060.36dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah80.000e+058.85dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+058.85dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+058.85dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah26.000e-2134.14dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain axonemal-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5