Protein phosphatase, Mg2 /Mn2 dependent 1A

Overview
NameProtein phosphatase, Mg2 /Mn2 dependent 1A
Smed IDSMED30033069
Length (bp)1452
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase, Mg2 /Mn2 dependent 1A (SMED30033069) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase, Mg2 /Mn2 dependent 1A (SMED30033069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein phosphatase, Mg2 /Mn2 dependent 1A (SMED30033069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein phosphatase, Mg2 /Mn2 dependent 1A (SMED30033069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033069SMESG000063866.1 Contig4623GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033069SMESG000072821.1 Contig4623GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30033069SMESG000072821.1 dd_Smed_v4_908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033069SMESG000072821.1 dd_Smed_v4_908_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 398.282 bits (1022), Expect = 7.625e-136
Identity = 193/370 (52.16%), Postives = 259/370 (70.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  +SW++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 399.823 bits (1026), Expect = 2.499e-135
Identity = 193/371 (52.02%), Postives = 259/371 (69.81%), Query Frame = 3
Query:   57 FMGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
             MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  +SW++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:   73 IMGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 438          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Human
Match: PPM1B (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:HGNC Symbol;Acc:HGNC:9276])

HSP 1 Score: 382.874 bits (982), Expect = 7.241e-130
Identity = 185/371 (49.87%), Postives = 254/371 (68.46%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P   + W++F VYDGHAGS V+  CS  LL  I    +F+          + VE  K GIR GFL++D+ +    ++  G D+SGST + V ++PK++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  +ED+ I+LACDG+WDVMSNEEL E+V  R +   DL  +   V+D CL+KGSRDNMS+V++   NAP    E   KD +L++ +E +V+E +   G E   D+  ++  L + N+ +LPP GGL  KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRA-EEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Human
Match: PPM1B (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:HGNC Symbol;Acc:HGNC:9276])

HSP 1 Score: 382.874 bits (982), Expect = 9.078e-130
Identity = 185/371 (49.87%), Postives = 254/371 (68.46%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P   + W++F VYDGHAGS V+  CS  LL  I    +F+          + VE  K GIR GFL++D+ +    ++  G D+SGST + V ++PK++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  +ED+ I+LACDG+WDVMSNEEL E+V  R +   DL  +   V+D CL+KGSRDNMS+V++   NAP    E   KD +L++ +E +V+E +   G E   D+  ++  L + N+ +LPP GGL  KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRA-EEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Human
Match: AC013717.1 (novel protein, PPM1B-SLC3A1 readthrough)

HSP 1 Score: 382.874 bits (982), Expect = 1.008e-129
Identity = 185/371 (49.87%), Postives = 254/371 (68.46%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P   + W++F VYDGHAGS V+  CS  LL  I    +F+          + VE  K GIR GFL++D+ +    ++  G D+SGST + V ++PK++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  +ED+ I+LACDG+WDVMSNEEL E+V  R +   DL  +   V+D CL+KGSRDNMS+V++   NAP    E   KD +L++ +E +V+E +   G E   D+  ++  L + N+ +LPP GGL  KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRA-EEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 277.33 bits (708), Expect = 6.738e-89
Identity = 141/308 (45.78%), Postives = 205/308 (66.56%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTS--ILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKM-----ELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPT-EQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAP 959
            MGAFL+KPKT+K++    G  + YG+S+MQGWRI MED+H +  I+S  +P+K W++F V+DGHAG  ++   S +LL  ++++ EF++M     E +       ++L ++GI+ GFL  D+    S+++     KSG T +   VTP + I  N GDSR V+   N + F TEDHKP    ER RI  AGG+VMIQRINGSLAVSR+ GD++YK  D + P  +QLVSP+P++ + E+  + DQ +V+ACDG++DVM+NEEL EFV  R     DL ++ ++V+D CL KGSRDNM++V++    AP
Sbjct:    1 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDEISKTSNDIS----KSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAP 302          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 277.33 bits (708), Expect = 6.738e-89
Identity = 141/308 (45.78%), Postives = 205/308 (66.56%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTS--ILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKM-----ELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPT-EQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAP 959
            MGAFL+KPKT+K++    G  + YG+S+MQGWRI MED+H +  I+S  +P+K W++F V+DGHAG  ++   S +LL  ++++ EF++M     E +       ++L ++GI+ GFL  D+    S+++     KSG T +   VTP + I  N GDSR V+   N + F TEDHKP    ER RI  AGG+VMIQRINGSLAVSR+ GD++YK  D + P  +QLVSP+P++ + E+  + DQ +V+ACDG++DVM+NEEL EFV  R     DL ++ ++V+D CL KGSRDNM++V++    AP
Sbjct:    1 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDEISKTSNDIS----KSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAP 302          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 276.944 bits (707), Expect = 1.038e-87
Identity = 141/308 (45.78%), Postives = 205/308 (66.56%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTS--ILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKM-----ELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPT-EQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAP 959
            MGAFL+KPKT+K++    G  + YG+S+MQGWRI MED+H +  I+S  +P+K W++F V+DGHAG  ++   S +LL  ++++ EF++M     E +       ++L ++GI+ GFL  D+    S+++     KSG T +   VTP + I  N GDSR V+   N + F TEDHKP    ER RI  AGG+VMIQRINGSLAVSR+ GD++YK  D + P  +QLVSP+P++ + E+  + DQ +V+ACDG++DVM+NEEL EFV  R     DL ++ ++V+D CL KGSRDNM++V++    AP
Sbjct:   84 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDEISKTSNDIS----KSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAP 385          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 255.373 bits (651), Expect = 9.206e-81
Identity = 130/285 (45.61%), Postives = 189/285 (66.32%), Query Frame = 3
Query:  129 YGLSAMQGWRIDMEDAHTS--ILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKM-----ELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPT-EQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAP 959
            YG+S+MQGWRI MED+H +  I+S  +P+K W++F V+DGHAG  ++   S +LL  ++++ EF++M     E +       ++L ++GI+ GFL  D+    S+++     KSG T +   VTP + I  N GDSR V+   N + F TEDHKP    ER RI  AGG+VMIQRINGSLAVSR+ GD++YK  D + P  +QLVSP+P++ + E+  + DQ +V+ACDG++DVM+NEEL EFV  R     DL ++ ++V+D CL KGSRDNM++V++    AP
Sbjct:    6 YGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDEISKTSNDI----SKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAP 284          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 209.149 bits (531), Expect = 5.067e-63
Identity = 123/300 (41.00%), Postives = 171/300 (57.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSR------DNMSVVII 941
            MG  L +P T+K S S + +N   G S MQGWR+DMEDAHT +LSLP   K  A+F VYDGH GS VS+     L   ++   EF +      GN       K  I  GFLELD+ +    + ET +D SG+T + V +    V   N GDSR V          + DHKP +  E  RII AGG V   R+NG+LA+SR+LGDF +K  D+K   EQ+V+  P++ + +K+  + + IVLACDG+WDVM+N+E+ +FV  +    +D   I EE++  CL    +      DNM+VV++
Sbjct:    1 MGQTLSEPVTKKESASCANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPKC-AFFAVYDGHGGSKVSQYSGINLHKKVVAQKEFSE------GN------MKEAIEKGFLELDQQM--RVDEETKDDVSGTTAVVVLIKEGDVYCGNAGDSRAVSSVVGEARPLSFDHKPSHETEARRIIAAGGWVEFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDV-ITDKLTPDHEFIVLACDGIWDVMTNQEVVDFVREKLAEKRDPQSICEELLTRCLAPDCQMGGLGCDNMTVVLV 284          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Fly
Match: CG6036 (gene:FBgn0039421 transcript:FBtr0085027)

HSP 1 Score: 306.22 bits (783), Expect = 3.184e-100
Identity = 159/371 (42.86%), Postives = 236/371 (63.61%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSL--LMWLQSANLQDLPP-GGLTAKRFIIDPLFED 1160
            MG FLEKP+TEK +    G  L Y +S+MQGWR++MED+H++   L  PF +W+YF V+DGHAGS +S  C++ L+ +IL +  F K + +             GIR GFL+LD+ + + +  + G    GST I VFV+P  +   NCGDSR V+ R+     ST DHKP +P E++RI  AGG+VMI+RING+LAVSR+ GD+D+K   SK P +Q+VSP+P+I V  + ++ D+ IV+ACDG+WDVM++ E+ EF+  R     DL  I   V+D CL+KGSRDNM+++++    AP  D +    +  L++ I +  +E +  + +E+ D  +L  LM   + N+ +LPP GGL AK +II+  F +
Sbjct:    5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKHKYE------------AGIREGFLQLDEDMRKLYHDQQG----GSTAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNR-SEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLLLLPGAPKVDMDAVKAERSLDQTIVQITKEVI--EKHEIHDFETLIRLMKRMAINIPNLPPGGGLYAKYYIIEQAFHE 356          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085442)

HSP 1 Score: 302.368 bits (773), Expect = 7.158e-99
Identity = 163/369 (44.17%), Postives = 230/369 (62.33%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSG-STVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSA-NLQDLPP-GGLTAKRFIIDPLFE 1157
            MG FL+KPKT K +    G  L +G+S+MQGWR +MEDA+ +   L      W++F V+DGHAG  VSE C++ LL SI++T EF        G+ V      +GIR GFL +D+ + +  E     +K G +T +  FV    V  ANCGDSR VL R     F+T+DHKP+ P E++RI  AGG+VMI+R+NG+LAVSR+LGD+D+K V  KG  EQLVSP+PEI   +   D D+ +VLACDG+WDVMSNE++  F+  R +   +L  IA +V+D CL+KGSRDNMS++II+   AP    E    + +L + IE+  ++ +       D   LL  LQ+  +++ LPP GGL +K  +I+  F+
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG------GDHV------KGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEI-FCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIE-SSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFK 355          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085445)

HSP 1 Score: 302.368 bits (773), Expect = 7.158e-99
Identity = 163/369 (44.17%), Postives = 230/369 (62.33%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSG-STVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSA-NLQDLPP-GGLTAKRFIIDPLFE 1157
            MG FL+KPKT K +    G  L +G+S+MQGWR +MEDA+ +   L      W++F V+DGHAG  VSE C++ LL SI++T EF        G+ V      +GIR GFL +D+ + +  E     +K G +T +  FV    V  ANCGDSR VL R     F+T+DHKP+ P E++RI  AGG+VMI+R+NG+LAVSR+LGD+D+K V  KG  EQLVSP+PEI   +   D D+ +VLACDG+WDVMSNE++  F+  R +   +L  IA +V+D CL+KGSRDNMS++II+   AP    E    + +L + IE+  ++ +       D   LL  LQ+  +++ LPP GGL +K  +I+  F+
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG------GDHV------KGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEI-FCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIE-SSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFK 355          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085446)

HSP 1 Score: 302.368 bits (773), Expect = 7.158e-99
Identity = 163/369 (44.17%), Postives = 230/369 (62.33%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSG-STVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSA-NLQDLPP-GGLTAKRFIIDPLFE 1157
            MG FL+KPKT K +    G  L +G+S+MQGWR +MEDA+ +   L      W++F V+DGHAG  VSE C++ LL SI++T EF        G+ V      +GIR GFL +D+ + +  E     +K G +T +  FV    V  ANCGDSR VL R     F+T+DHKP+ P E++RI  AGG+VMI+R+NG+LAVSR+LGD+D+K V  KG  EQLVSP+PEI   +   D D+ +VLACDG+WDVMSNE++  F+  R +   +L  IA +V+D CL+KGSRDNMS++II+   AP    E    + +L + IE+  ++ +       D   LL  LQ+  +++ LPP GGL +K  +I+  F+
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG------GDHV------KGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEI-FCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIE-SSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFK 355          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085443)

HSP 1 Score: 302.368 bits (773), Expect = 8.044e-99
Identity = 163/369 (44.17%), Postives = 230/369 (62.33%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSG-STVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSA-NLQDLPP-GGLTAKRFIIDPLFE 1157
            MG FL+KPKT K +    G  L +G+S+MQGWR +MEDA+ +   L      W++F V+DGHAG  VSE C++ LL SI++T EF        G+ V      +GIR GFL +D+ + +  E     +K G +T +  FV    V  ANCGDSR VL R     F+T+DHKP+ P E++RI  AGG+VMI+R+NG+LAVSR+LGD+D+K V  KG  EQLVSP+PEI   +   D D+ +VLACDG+WDVMSNE++  F+  R +   +L  IA +V+D CL+KGSRDNMS++II+   AP    E    + +L + IE+  ++ +       D   LL  LQ+  +++ LPP GGL +K  +I+  F+
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG------GDHV------KGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEI-FCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIE-SSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFK 355          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Zebrafish
Match: ppm1bb (protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-185])

HSP 1 Score: 388.652 bits (997), Expect = 2.819e-132
Identity = 190/372 (51.08%), Postives = 262/372 (70.43%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDF-GNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L++GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS+ LL  I+ +SE       DF   P  VE  K GIR+GFL++D+ +    ++  G D+SGST + V V+P+++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  + +V+DED+ +VLACDG+WDVMSNEEL +FV  R +   DL K+   V+D CL+KGSRDNMSVV++   NAP    E   K+ +L++ +E +V+E +   G E   D++ ++  L    + +LPP GGL +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLNFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITSSE-------DFRSGPDSVEGVKIGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYFINCGDSRAVLSRAGQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSNEELCDFVRSRLEVWDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDKFLEARVEELMEKSGEEGIPDLSHIMHNLHPETIPNLPPGGGLPSKRSVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Zebrafish
Match: ppm1bb (protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-185])

HSP 1 Score: 388.652 bits (997), Expect = 2.819e-132
Identity = 190/372 (51.08%), Postives = 262/372 (70.43%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDF-GNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L++GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS+ LL  I+ +SE       DF   P  VE  K GIR+GFL++D+ +    ++  G D+SGST + V V+P+++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  + +V+DED+ +VLACDG+WDVMSNEEL +FV  R +   DL K+   V+D CL+KGSRDNMSVV++   NAP    E   K+ +L++ +E +V+E +   G E   D++ ++  L    + +LPP GGL +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLNFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITSSE-------DFRSGPDSVEGVKIGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYFINCGDSRAVLSRAGQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSNEELCDFVRSRLEVWDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDKFLEARVEELMEKSGEEGIPDLSHIMHNLHPETIPNLPPGGGLPSKRSVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Zebrafish
Match: CR847495.1 (pep chromosome:GRCz11:CHR_ALT_CTG12_1_17:25477050:25482406:1 gene:ENSDARG00000115558.1 transcript:ENSDART00000185132.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847495.1)

HSP 1 Score: 383.259 bits (983), Expect = 1.347e-130
Identity = 185/356 (51.97%), Postives = 252/356 (70.79%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDF-GNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPPGG 1118
            MGAFL+KPKTEK +   +G  L++GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS+ LL  I+ +SE       DF   P  VE  K GIR+GFL++D+ +    ++  G D+SGST + V V+P+++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  + +V+DED+ +VLACDG+WDVMSNEEL +FV  R +   DL K+   V+D CL+KGSRDNMSVV++   NAP    E   K+ +L++ +E +V+E +   G E   D++ ++  L    + +LPPGG
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLNFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITSSE-------DFRSGPDSVEGVKIGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYFINCGDSRAVLSRAGQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSNEELCDFVRSRLEVWDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDKFLEARVEELMEKSGEEGIPDLSHIMHNLHPETIPNLPPGG 349          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 382.874 bits (982), Expect = 6.608e-130
Identity = 185/375 (49.33%), Postives = 257/375 (68.53%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPV---DVELAKRGIRNGFLELDKTIGQ-SHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G +L YGLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  C + LL  I +  +F+         P     V+  K GIR GFL++D  + Q S +   G D+SGST + V ++P+++ F NCGDSRG+L R   VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+   ED+ IVLACDG+WDVM+NEEL +FV  R +   DL ++  E++D CLYKGSRDNMSVV++   +AP    E   ++ +L++ +E +V+E +   G+E   D+  ++  L S ++ +LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGG--GPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESRVEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNKL 373          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 382.489 bits (981), Expect = 7.145e-130
Identity = 184/373 (49.33%), Postives = 256/373 (68.63%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDF-GNPVDVELAKRGIRNGFLELDKTIGQ-SHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G +L YGLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  C + LL  I +  +F+             V+  K GIR GFL++D  + Q S +   G D+SGST + V ++P+++ F NCGDSRG+L R   VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+   ED+ IVLACDG+WDVM+NEEL +FV  R +   DL ++  E++D CLYKGSRDNMSVV++   +AP    E   ++ +L++ +E +V+E +   G+E   D+  ++  L S ++ +LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESRVEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNKL 373          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 391.349 bits (1004), Expect = 3.987e-133
Identity = 191/371 (51.48%), Postives = 255/371 (68.73%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P     W++F VYDGHAGS V+  CS  LL  I +  +F+  E         VE  K GIR GFL++D+ +    ++  G D+SGST ++V ++P +V F NCGDSR VL RS  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  DED+ I+LACDG+WDVMSNEEL EFV +R +   DL K+   V+D CL+KGSRDNMS+V++   NAP    E   KD  L++ +E +V+E +   G E   D+  ++  L + N+  LPP GGL AKR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-DEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAAKRSVIEEVYNRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 385.185 bits (988), Expect = 6.891e-131
Identity = 185/355 (52.11%), Postives = 245/355 (69.01%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPPGG 1118
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P     W++F VYDGHAGS V+  CS  LL  I +  +F+  E         VE  K GIR GFL++D+ +    ++  G D+SGST ++V ++P +V F NCGDSR VL RS  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  DED+ I+LACDG+WDVMSNEEL EFV +R +   DL K+   V+D CL+KGSRDNMS+V++   NAP    E   KD  L++ +E +V+E +   G E   D+  ++  L + N+  LPPGG
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-DEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGG 354          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 384.8 bits (987), Expect = 1.006e-130
Identity = 186/359 (51.81%), Postives = 247/359 (68.80%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPPGGLTAK 1130
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P     W++F VYDGHAGS V+  CS  LL  I +  +F+  E         VE  K GIR GFL++D+ +    ++  G D+SGST ++V ++P +V F NCGDSR VL RS  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  DED+ I+LACDG+WDVMSNEEL EFV +R +   DL K+   V+D CL+KGSRDNMS+V++   NAP    E   KD  L++ +E +V+E +   G E   D+  ++  L + N+  LPPGG  A+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-DEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAE 358          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Xenopus
Match: ppm1a (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:548912])

HSP 1 Score: 384.8 bits (987), Expect = 1.674e-130
Identity = 184/371 (49.60%), Postives = 256/371 (69.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP    +W++F VYDGHAGS V++ C + LL  I +  +FK  +       + V   K GIR GFL++D+ +    E + G D+SGST + V  +P ++ F NCGDSRG+L RS  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL ++  E++D CLYKGSRDNMSV++I   +AP    E   ++ +L++ +E +V++ +   G E   D+  ++  L S N+ +LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAHGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPNGLDAWSFFAVYDGHAGSQVAKYCCEHLLDHITSNQDFKGTD-----GHLSVWSVKNGIRTGFLQIDEHMRVISEKKHGADRSGSTAVGVMTSPNHIYFINCGDSRGLLCRSKKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYEIERSEEDDQFIILACDGIWDVMGNEELCDFVWSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVILICFPSAPKVLPEAVKREAELDKYLEGRVEDIIKKQGEEGVPDLVHVMRTLASENIPNLPPGGELASKRSVIEAVYNRL 366          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 386.341 bits (991), Expect = 5.709e-130
Identity = 190/368 (51.63%), Postives = 251/368 (68.21%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLF 1154
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P     W++F VYDGHAGS V+  CS  LL  I +  +F+  E         VE  K GIR GFL++D+ +    ++  G D+SGST ++V ++P +V F NCGDSR VL RS  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  DED+ I+LACDG+WDVMSNEEL EFV +R +   DL K+   V+D CL+KGSRDNMS+V++   NAP    E   KD  L++ +E +V+E +   G E   D+  ++  L + N+  LPP GGL AK  +   LF
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-DEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAAKINLFFFLF 367          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Mouse
Match: Ppm1a (protein phosphatase 1A, magnesium dependent, alpha isoform [Source:MGI Symbol;Acc:MGI:99878])

HSP 1 Score: 392.119 bits (1006), Expect = 1.328e-133
Identity = 189/370 (51.08%), Postives = 258/370 (69.73%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  ++W++F VYDGHAGS V++ C + LL  I N  +F+       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   +AP    E   K+ +L++ +E +V+E +      + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFR----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPSAPKVSAEAVKKEAELDKYLESRVEEIIKKQVEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 385.956 bits (990), Expect = 5.411e-131
Identity = 186/371 (50.13%), Postives = 254/371 (68.46%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P    +W++F VYDGHAGS V+  CS  LL  I    +F+  +         VE  K GIR GFL++D+ +    ++  G D+SGST + V V+P ++ F NCGDSR VL R+  V FST+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  +ED+ +VLACDG+WDVMSNEEL EFV  R +   DL  +   V+D CL+KGSRDNMSVV++   NAP    E   +D +L++ +E +V+E +   G E   D+  ++  L + N+ +LPP GGL  KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-EEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 385.956 bits (990), Expect = 5.411e-131
Identity = 186/371 (50.13%), Postives = 254/371 (68.46%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P    +W++F VYDGHAGS V+  CS  LL  I    +F+  +         VE  K GIR GFL++D+ +    ++  G D+SGST + V V+P ++ F NCGDSR VL R+  V FST+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  +ED+ +VLACDG+WDVMSNEEL EFV  R +   DL  +   V+D CL+KGSRDNMSVV++   NAP    E   +D +L++ +E +V+E +   G E   D+  ++  L + N+ +LPP GGL  KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-EEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 385.571 bits (989), Expect = 6.439e-131
Identity = 186/371 (50.13%), Postives = 254/371 (68.46%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P    +W++F VYDGHAGS V+  CS  LL  I    +F+  +         VE  K GIR GFL++D+ +    ++  G D+SGST + V V+P ++ F NCGDSR VL R+  V FST+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  +ED+ +VLACDG+WDVMSNEEL EFV  R +   DL  +   V+D CL+KGSRDNMSVV++   NAP    E   +D +L++ +E +V+E +   G E   D+  ++  L + N+ +LPP GGL  KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-EEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 385.185 bits (988), Expect = 9.243e-131
Identity = 186/371 (50.13%), Postives = 254/371 (68.46%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L YGLS+MQGWR++MEDAHT+++ +P    +W++F VYDGHAGS V+  CS  LL  I    +F+  +         VE  K GIR GFL++D+ +    ++  G D+SGST + V V+P ++ F NCGDSR VL R+  V FST+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +  +ED+ +VLACDG+WDVMSNEEL EFV  R +   DL  +   V+D CL+KGSRDNMSVV++   NAP    E   +D +L++ +E +V+E +   G E   D+  ++  L + N+ +LPP GGL  KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA-EEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRL 370          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. UniProt/SwissProt
Match: sp|P20650|PPM1A_RAT (Protein phosphatase 1A OS=Rattus norvegicus OX=10116 GN=Ppm1a PE=1 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 2.220e-135
Identity = 192/370 (51.89%), Postives = 259/370 (70.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  ++W++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSAEAVKKEAELDKYLENRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. UniProt/SwissProt
Match: sp|P35813|PPM1A_HUMAN (Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 3.662e-135
Identity = 193/370 (52.16%), Postives = 259/370 (70.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  +SW++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. UniProt/SwissProt
Match: sp|P35814|PPM1A_RABIT (Protein phosphatase 1A OS=Oryctolagus cuniculus OX=9986 GN=PPM1A PE=2 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 1.458e-134
Identity = 192/370 (51.89%), Postives = 259/370 (70.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  ++W++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEILKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. UniProt/SwissProt
Match: sp|O62829|PPM1A_BOVIN (Protein phosphatase 1A OS=Bos taurus OX=9913 GN=PPM1A PE=2 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.447e-133
Identity = 191/370 (51.62%), Postives = 259/370 (70.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  ++W++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  V+F T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVYFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEEELDKYLESRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. UniProt/SwissProt
Match: sp|P49443|PPM1A_MOUSE (Protein phosphatase 1A OS=Mus musculus OX=10090 GN=Ppm1a PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 9.289e-133
Identity = 189/370 (51.08%), Postives = 258/370 (69.73%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  ++W++F VYDGHAGS V++ C + LL  I N  +F+       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   +AP    E   K+ +L++ +E +V+E +      + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFR----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPSAPKVSAEAVKKEAELDKYLESRVEEIIKKQVEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. TrEMBL
Match: A0A267G927 (PPM-type phosphatase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005651g1 PE=3 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 5.555e-134
Identity = 196/368 (53.26%), Postives = 268/368 (72.83%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQ-SANLQDLPP-GGLTAKRFIIDPLFE 1157
            MGAFL+KPK +K + S  G  L+YGLS+MQGWRI+MEDAH ++  LP     W++F V+DGHAG+ +S  C+Q+LL +I+ T +FKK++ D      DV+   RGIR+GFL LD  + +  EVE G+DKSGST + V ++P ++ FANCGDSRG+L+R   V  +T DHKP+NP+E++RI  AGG+VMIQR+NGSLAVSRSLGD+DYK V  +GPTEQLVSP+PEI   E  +D+DQ IVLACDG+WDVM+NEEL  FV+ R +    LS + ++V+D CL+KGSRDNMSV+II+   A + D    ++D  L+ LIE KV E +N + +++D+  LL  LQ S N +DLPP GGL AK+ +++ L++
Sbjct:    1 MGAFLDKPKIDKQNDSGEGNGLTYGLSSMQGWRIEMEDAHCAVTGLPGNLAKWSFFAVFDGHAGARISAHCAQQLLNAIVETDDFKKLDPDAVPPFEDVQ---RGIRDGFLNLDSKMRKIPEVELGQDKSGSTAVCVLISPHHIYFANCGDSRGILVRDGKVALATMDHKPINPVEKERIQNAGGSVMIQRVNGSLAVSRSLGDYDYKNVCGRGPTEQLVSPEPEI-FSESRDDKDQFIVLACDGIWDVMTNEELCSFVLDRARVRNSLSAVCDDVVDTCLHKGSRDNMSVIIIAFDKAHSVDEAAVARDKALDRLIETKVTEKMN-ENSKIDLMELLCQLQASINAEDLPPGGGLAAKKALVESLYQ 363          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. TrEMBL
Match: A0A267H0E2 (PPM-type phosphatase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005523g1 PE=3 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 5.752e-134
Identity = 201/378 (53.17%), Postives = 265/378 (70.11%), Query Frame = 3
Query:   21 YLIIKIIFTYL--IFMGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQD--LPPGGLTAKRFII 1142
            YL  K+   Y+  I MGAFL+KPKT+K + S +G  L YGLS+MQGWRI+MEDAH ++  LP     W++F V+DGHAG+ +S  C+++LL +I+ T +F+  ELD    P  ++  KRGI +GFL LD  + Q  EVE GEDKSGST + V ++P ++ FANCGDSRGVL+R  +V  +T DHKP+NP ERDRI KAGG+VMIQR+NGSLAVSRSLGDF+YK V ++GPTEQLVSP+PEI  I++    DQ +VLACDG+WDVMSNEEL  FV+HR +   +LS +  EV+D CL+KGSRDNMSV+II+  NA   D E    D +LNE I + V++ +    N +D+  L   ++   LQD  +PPGG  A +  I
Sbjct:    1 YLSKKVKKKYITTIIMGAFLDKPKTDKVNESGTGNGLVYGLSSMQGWRIEMEDAHCAVTGLPGNLSKWSFFAVFDGHAGARISAYCAEQLLNAIVETDDFR--ELDPEAAP-PLDDVKRGITDGFLNLDSRMRQIPEVEIGEDKSGSTAVCVLISPSHIFFANCGDSRGVLVRGGSVALATTDHKPINPGERDRIQKAGGSVMIQRVNGSLAVSRSLGDFEYKNVSNRGPTEQLVSPEPEIFAIDRDQAADQFVVLACDGIWDVMSNEELCNFVLHRTRVSDNLSHVCNEVVDTCLHKGSRDNMSVIIIAFDNAAKVDPEAVEADKQLNEKIVKTVKDKMEASPN-LDLMQLFSHVKE-KLQDETMPPGGGLASKIPI 373          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. TrEMBL
Match: A0A2K5E2P4 (Protein phosphatase, Mg2+/Mn2+ dependent 1A OS=Aotus nancymaae OX=37293 GN=PPM1A PE=3 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 6.607e-133
Identity = 193/370 (52.16%), Postives = 259/370 (70.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  +SW++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSS----GAP-SVENVKNGIRTGFLEIDEHVRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. TrEMBL
Match: A0A384CYN8 (protein phosphatase 1A isoform X2 OS=Ursus maritimus OX=29073 GN=PPM1A PE=3 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 6.665e-133
Identity = 194/378 (51.32%), Postives = 261/378 (69.05%), Query Frame = 3
Query:   36 IIFTYLIFMGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            I   Y   MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  ++W++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    3 IDLEYQDIMGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPRVSPEAVKKEAELDKYLESRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 375          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. TrEMBL
Match: G9KI29 (Protein phosphatase 1A, magnesium-dependent, alpha isoform (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 6.696e-133
Identity = 193/376 (51.33%), Postives = 260/376 (69.15%), Query Frame = 3
Query:   42 FTYLIFMGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM-DINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
              Y   MGAFL+KPK EK +    G  L YGLS+MQGWR++MEDAHT+++ LP+  ++W++F VYDGHAGS V++ C + LL  I N  +FK       G P  VE  K GIR GFLE+D+ +    E + G D+SGST + V ++P++  F NCGDSRG+L R+  VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+  ++DQ I+LACDG+WDVM NEEL +FV  R +   DL K+  EV+D CLYKGSRDNMSV++I   NAP    E   K+ +L++ +E +V+E +   G  + D+  ++  L S N+  LPPGG L +KR +I+ ++  L
Sbjct:    1 LEYQDIMGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFK----GSAGAP-SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLESRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL 371          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 390.578 bits (1002), Expect = 3.673e-133
Identity = 191/372 (51.34%), Postives = 261/372 (70.16%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFG-NPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L +GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS+ LL  I+  SE       DF   P  VE  K GIR+GFL++D+ +    ++  G D+SGST + V ++P+++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +V DED+ +VLACDG+WDVMSNEEL EFV  R +  +DL K+   V+D CL+KGSRDNMSVV++   NAP    E   K+ +L++ IE +V+E +   G E   D+  ++  L + ++ +LPP GGL +KR +++ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNSE-------DFQPGPDSVEGVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFVRSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDKFIESRVEEIMEKSGEEGIPDLAYIMRTLSAESISNLPPGGGLASKRSVVEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 390.193 bits (1001), Expect = 6.071e-133
Identity = 191/372 (51.34%), Postives = 261/372 (70.16%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFG-NPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L +GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS+ LL  I+  SE       DF   P  VE  K GIR+GFL++D+ +    ++  G D+SGST + V ++P+++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +V DED+ +VLACDG+WDVMSNEEL EFV  R +  +DL K+   V+D CL+KGSRDNMSVV++   NAP    E   K+ +L++ IE +V+E +   G E   D+  ++  L + ++ +LPP GGL +KR +++ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNSE-------DFQPGPDSVEGVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFVRSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDKFIESRVEEIMEKSGEEGIPDLAYIMRTLSAESISNLPPGGGLASKRSVVEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 391.734 bits (1005), Expect = 3.331e-132
Identity = 191/372 (51.34%), Postives = 261/372 (70.16%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDF-GNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +   +G  L +GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS+ LL  I+  SE       DF   P  VE  K GIR+GFL++D+ +    ++  G D+SGST + V ++P+++ F NCGDSR VL R+  V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+  I +V DED+ +VLACDG+WDVMSNEEL EFV  R +  +DL K+   V+D CL+KGSRDNMSVV++   NAP    E   K+ +L++ IE +V+E +   G E   D+  ++  L + ++ +LPP GGL +KR +++ ++  L
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNSE-------DFQPGPDSVEGVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFVRSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDKFIESRVEEIMEKSGEEGIPDLAYIMRTLSAESISNLPPGGGLASKRSVVEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Cavefish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:103025067])

HSP 1 Score: 380.178 bits (975), Expect = 9.157e-129
Identity = 184/377 (48.81%), Postives = 256/377 (67.90%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPV-----DVELAKRGIRNGFLELDKTIGQ-SHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L +GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  C + LL  I +  +F+        +        VE  K GIR GFL++D  + Q S +   G D+SGST + V ++P++V F NCGDSRG+L R   VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+ + ED+ IVLACDG+WDVM+NEEL +FV  R +   DL ++  E++D CLYKGSRDNMSVV++    AP    +   ++ +L++ +E +V+E +   G+E   D+  ++  L S ++ +LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNGLRFGLSSMQGWRVEMEDAHTAVIGLPNGLDPWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFRGGGGGGGVDGGTDEEPSVESVKCGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHVYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYAIERSDTEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFSGAPKVSPDAVKREAELDKYLEGRVEEILKKHGDEGVPDLVHVMRMLASESIPNLPPGGELASKRSVIEAVYNKL 377          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Cavefish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:103025067])

HSP 1 Score: 380.178 bits (975), Expect = 9.196e-129
Identity = 184/377 (48.81%), Postives = 256/377 (67.90%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPV-----DVELAKRGIRNGFLELDKTIGQ-SHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE--MDINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK +    G  L +GLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  C + LL  I +  +F+        +        VE  K GIR GFL++D  + Q S +   G D+SGST + V ++P++V F NCGDSRG+L R   VHF T+DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK V  KGPTEQLVSP+PE+  IE+ + ED+ IVLACDG+WDVM+NEEL +FV  R +   DL ++  E++D CLYKGSRDNMSVV++    AP    +   ++ +L++ +E +V+E +   G+E   D+  ++  L S ++ +LPPGG L +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNGLRFGLSSMQGWRVEMEDAHTAVIGLPNGLDPWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFRGGGGGGGVDGGTDEEPSVESVKCGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHVYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYAIERSDTEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFSGAPKVSPDAVKREAELDKYLEGRVEEILKKHGDEGVPDLVHVMRMLASESIPNLPPGGELASKRSVIEAVYNKL 377          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Sea Lamprey
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 389.808 bits (1000), Expect = 1.090e-132
Identity = 187/371 (50.40%), Postives = 262/371 (70.62%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEM--DINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK +    G  L Y LS+MQGWR++MEDAHT+++ +P   K+W++F VYDGHAGS V+  CS+ LL  I+    F+       G     E  ++GI+ GFL++D+ +    +++ G D+SGST ++V ++PK++ F NCGDSR VL R+ +VHF TEDHKP NP E++R I+ GG+VMIQR+NGSLAVSR+LGDFDYK VD KGPTEQLVSP+PE+  IE+ +D D+ +VLACDG+WDVMSNEELG+FV  R     DL KI  +V+D CLYKGSRDNMS+V++   NAP    E  +++ +L++ +E KV+E +     E+  D+ S++  +   N+ +LPP GGL +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHTTHGGGNGLRYALSSMQGWRVEMEDAHTAVVGIPRGLKTWSFFAVYDGHAGSRVATFCSEHLLEHIITNEHFECKA----GTEPSSEAVEKGIQAGFLQIDEHMRTISDIKNGLDRSGSTAVAVMLSPKHLYFINCGDSRAVLYRNGSVHFCTEDHKPCNPAEKER-IQNGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVRAIER-SDGDEFVVLACDGIWDVMSNEELGQFVHSRLLLTDDLEKICNQVLDTCLYKGSRDNMSIVLVCFPNAPKVTVEAVAREEELDKFLETKVEEVLEKHTGEVAPDLASVIRAVSVENIPNLPPGGGLASKRVLIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003550.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 1.878e-44
Identity = 102/316 (32.28%), Postives = 161/316 (50.95%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVEL----------AKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVL-IRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRV-KDLSKIAEEVIDNCLYKG-------SRDNMSVVIISTK 950
            MG +L  P+ EK S       L YG + MQGWR  MED+H + L L       ++FGVYDGH G+ V++     L+  +     F+    +     + + L          +K+   +G     +  G S E+  G   +G T +S  +TP  +   N GDSR VL ++ + +  S EDHKP N +E+ RI +AGG V   R+ G L +SRS+GD +YK   S    +Q+++  PE+   EK+ +E   ++LACDG+WD +S++E   FV    ++  + LS + E++ D  +            DNM+ V++  K
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLG---HGVSFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYEQALKDIYIHLDEMLLTPYGKSKKNNDSGSSLFGR--GGSEEIAMG---TGCTAVSAIITPTDIYVGNSGDSRVVLAVKYHGIEMS-EDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRR-EKITNETAFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQFK 306          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003549.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.762 bits (395), Expect = 2.885e-44
Identity = 101/327 (30.89%), Postives = 162/327 (49.54%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTI---------------------GQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVL-IRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRV-KDLSKIAEEVIDNCLYKG-------SRDNMSVVIISTK 950
            MG +L  P+ EK S       L YG + MQGWR  MED+H + L L       ++FGVYDGH G+ V++     L+  +     F+    +            + +++ ++ LD+ +                     G S E+  G   +G T +S  +TP  +   N GDSR VL ++ + +  S EDHKP N +E+ RI +AGG V   R+ G L +SRS+GD +YK   S    +Q+++  PE+   EK+ +E   ++LACDG+WD +S++E   FV    ++  + LS + E++ D  +            DNM+ V++  K
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLG---HGVSFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYE------------QALKDIYIHLDEMLLTPYGKSYKKNNDSGSSLFGRGGSEEIAMG---TGCTAVSAIITPTDIYVGNSGDSRVVLAVKYHGIEMS-EDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRR-EKITNETAFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQFK 307          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 92.4337 bits (228), Expect = 6.418e-21
Identity = 79/301 (26.25%), Postives = 133/301 (44.19%), Query Frame = 3
Query:   84 KTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKS------WAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVM---IQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFV-IHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNA 956
            + E  + S   ++    L A++  R  MED H     L A F S       AYF ++DGH G   +   +  L  S+     F++       +P++       +R  F + D+        E    + GST +   +    +  A  GDS+ +L+R  +       HKP    E+ RI   GG V+     R+NG+L+VSR++GD ++K           VS D +         ED L+ LACDG +D +  +E    V  H  +   D + +A  ++ +    GS DN++V+++  ++A
Sbjct:   66 QKEPPALSRQRRSFQISLHAIKNTRRKMEDRHVIFQDLNALFTSEEEEDDQAYFAIFDGHGGVDAAIYAATHLHVSLAREGSFRR-------DPLE------ALRRAFCQTDQRFVLKARQENW--RCGSTGVVTLIRGNELHVAWLGDSQVILVRKGSPVELMSPHKPDREDEKKRIEALGGCVIWFGAWRVNGTLSVSRAIGDMEHKP---------YVSCDADCATFPLDGSEDYLL-LACDGFYDTVQPDEAARIVGEHLRENDGDPAMLAHRLVASARDAGSSDNITVLVVFLRDA 341          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Sea Lamprey
Match: si:ch211-149b19.3 (si:ch211-149b19.3 [Source:ZFIN;Acc:ZDB-GENE-110411-37])

HSP 1 Score: 90.5077 bits (223), Expect = 1.505e-20
Identity = 77/282 (27.30%), Postives = 131/282 (46.45%), Query Frame = 3
Query:  120 NLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGED--KSGSTV-ISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQ-----RINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVII 941
            NL+   SA Q  R     A+   LS+ A   +  YF VYDGH G+  +E C   +   I N  E ++          D+++    +R  FL++++    +      E     G+T  +++      ++  + GDSR +L R       TEDH P    E++RI K GG +         +NG LA++RS+GD   K V         V+ +P+   I   + +D  +VL  DG+  +M+++E+   V     +  + S+ A+ V +  +  GS DN +VV++
Sbjct:   21 NLARVGSASQTGR---RSANEDRLSVGAVDGTMLYFAVYDGHGGAYAAEFCGAHMKRCIRNLVEQEE----------DLQVV---LRRAFLQVNEEFTLAARAPGNEALLPCGTTATVALLRDGVELVVGSVGDSRAILCRRGLSRKLTEDHTPERRDEKERIQKCGGFIAWTSLGQPHVNGRLAMTRSIGDIALKAVG--------VTAEPDTRRIMLKHGDDSFLVLTTDGINVIMNSQEICNIV----SQCNEPSEAAQLVGEQAMQYGSEDNTTVVVV 274          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Yeast
Match: PTC3 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p (see also Ptc2p) to limit maximal kinase activity induced by osmotic stress; dephosphorylates T169 phosphorylated Cdc28p (see also Ptc2p); role in DNA damage checkpoint inactivation; PTC3 has a paralog, PTC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000152])

HSP 1 Score: 175.252 bits (443), Expect = 8.841e-50
Identity = 105/304 (34.54%), Postives = 162/304 (53.29%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPF--KSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHR-CQRVKDLSKIAEEVIDNCLYKGSR------DNMSVVIIS 944
            MG  L  P  +K  HS +    ++GL AMQGWR+ MEDAH    +L A    +  A++G++DGH GSSV+E C  K++  +     FK   L+            + + + FL  D  + +  +++       +TVI V    K +I AN GDSR VL         + DHKP    E+ RI+ A G V + R+NG+LA+SR++GDF++K     GP EQ+V+  P+I       DED+ ++LACDG+WD ++++E  + V +   Q    LS I+  ++D C    +       DNMS+ I++
Sbjct:    1 MGQILSNPIIDKEHHSGTDCLTAFGLCAMQGWRMSMEDAHIVEPNLLAESDEEHLAFYGIFDGHGGSSVAEFCGSKMISILKKQESFKSGMLE------------QCLIDTFLATDVELLKDEKLKDDHSGCTATVILVSQLKKLLICANSGDSRTVLSTGGNSKAMSFDHKPTLLSEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNTKLGPHEQVVTCVPDIICHNLNYDEDEFVILACDGIWDCLTSQECVDLVHYGISQGNMTLSDISSRIVDVCCSPTTEGSGIGCDNMSISIVA 292          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Yeast
Match: PTC2 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; inactivates the DNA damage checkpoint; PTC2 has a paralog, PTC3, that arose from the whole genome duplication [Source:SGD;Acc:S000000891])

HSP 1 Score: 174.096 bits (440), Expect = 2.039e-49
Identity = 103/307 (33.55%), Postives = 163/307 (53.09%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKS----WAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPK--YVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSR------DNMSVVIIS 944
            MG  L  P  +K SHS +    ++GL AMQGWR+ MED+H  IL      KS     A++G++DGH G+ V+E C  K++  +     F +  L             R + + F+  D  + Q   ++  ED SG T  S+ V+     ++  N GDSR VL         + DHKP    E+ RI+ A G V + R+NG+LA+SR++GDF++K     GP EQ+V+  P+I       D D+ ++LACDG+WD +++++  + V    +  K L++I+  +ID C    +       DNMS+V+++
Sbjct:    1 MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSH--ILEPNVLTKSDKDHIAFYGIFDGHGGAKVAEYCGNKIVEILQEQKSFHEGNL------------PRALIDTFINTDVKLLQDPVMK--EDHSGCTATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCLTSQDCVDLVHLGLREGKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVA 291          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Yeast
Match: PTC1 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p, inactivating osmosensing MAPK cascade; involved in Fus3p activation during pheromone response; deletion affects precursor tRNA splicing, mitochondrial inheritance, and sporulation [Source:SGD;Acc:S000002164])

HSP 1 Score: 113.62 bits (283), Expect = 6.071e-29
Identity = 84/271 (31.00%), Postives = 139/271 (51.29%), Query Frame = 3
Query:  153 WRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSI---LNTSEFKKME--LDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLS---KIAEEVIDNCLYKGSRDNMSVVII 941
            +R  MED HT + +  +    W YF V+DGHAG   S+ C + L   I   +   E + +   L+D    +D E+  + + N        + +    ++  D S    + +    + +  AN GDSR VL R+      T DHK  + +E  R+ +AGG +M  R+NG LAV+RSLGD   K  DS      LV   P  T +E +  ED+ ++LACDG+WDV+ +++        C+ +KD++   + A+ ++   L  G+ DN++V+++
Sbjct:   31 FRRTMEDVHTYVKNFASRL-DWGYFAVFDGHAGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCVLRWELPDSVSDDS----MDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGD---KFFDS------LVVGSPFTTSVE-ITSEDKFLILACDGLWDVIDDQD-------ACELIKDITEPNEAAKVLVRYALENGTTDNVTVMVV 279          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Yeast
Match: PTC4 (Cytoplasmic type 2C protein phosphatase (PP2C); identified as a high-copy number suppressor of cnb1 mpk1 synthetic lethality; overexpression decreases high-osmolarity induced Hog1p phosphorylation and kinase activity [Source:SGD;Acc:S000000329])

HSP 1 Score: 100.138 bits (248), Expect = 1.753e-23
Identity = 92/370 (24.86%), Postives = 154/370 (41.62%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQN--LSYGL--------SAMQGWRIDMEDAH-------TSILSLPAPF------KSWAYFGVYDGHAGSSVSEICSQ----------------------KLLPSILNTSEFKKMELDD---FGNPVDV--ELAKRGIRNGFLELDKTIGQSHEVETGEDKSGST-VISVFVTPKYVIFANCGDSRGVLI-RSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKK------------------VDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSR------DNMSVVII 941
            MG  L  P TEK+      +N   S G+         +MQG+R+  EDAH          +    PF       S   F V+DGH G   S+  S                       K +        +     +D   F    +    L  +  ++ F+  D+ + +           GST V++  +  + +  ANCGDSR +L  +SN +   + DHKP +  E  RI   GGTV + R+ G LA+SR+  DF +K+                       P E  V+ +P++ + +    +D+ +VLACDG+WD+ +N++L  F+ +       L  I  +++D+ + + +       DNM+ +I+
Sbjct:    1 MGQLLSHPLTEKTIEYNEYKNNQASTGIVPRFYNCVGSMQGYRLTQEDAHLIRNENSVVYVRFFNPFIDKYETLSLNVFAVFDGHGGDDCSKFLSGGRHHRDGNGSSNGNGEPNAGLIKWIAYSFENHHYTSTTNNDSSKFKRSFNTLEGLVSQIFKDAFILQDEELYR----HFANSSCGSTAVVACIINEESLYVANCGDSRCILSSKSNGIKTMSFDHKPQHIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVTYPHRRTKLTNITQNLTYGTPPQEAQVTVEPDVLMHKIDYSKDEFLVLACDGIWDIYNNKQLIHFIKYHLVSGTKLDTIITKLLDHGIAQANSNTGVGFDNMTAIIV 366          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 63.5438 bits (153), Expect = 4.268e-11
Identity = 54/218 (24.77%), Postives = 110/218 (50.46%), Query Frame = 3
Query:  324 ELDDFGNPVDVELAKRGIRNGFLELDKTI-GQSHEVETGEDK---------SGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFS-TEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIIS 944
            +L+ +G+  D  + K  +R  FL+L+K I G  + V+ G D          SG+    +++  K +  AN GD   +L ++N  + + T+ H P    E +RI  +GG V   +++G + VSR++G FD             +   P+I+V+  +   D+++++A   +W+ M  + + +  I R +   D  + A E+ D+ +  G  +N++++ ++
Sbjct: 1420 QLERYGDETDDNI-KTALRFSFLQLNKEINGMLNSVDNGADVANLSYADLLSGACSTVIYIRGKKLFAANLGDCMAILSKNNGDYQTLTKQHLPTKREEYERIRISGGYVNNGKLDGVVDVSRAVGFFDLLP---------HIHASPDISVV-TLTKADEMLIVATHKLWEYMDVDTVCD--IAR-ENSTDPLRAAAELKDHAMAYGCTENITILCLA 1623          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Nematostella
Match: EDO36040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS2])

HSP 1 Score: 354.369 bits (908), Expect = 1.202e-119
Identity = 175/360 (48.61%), Postives = 246/360 (68.33%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGN--EMDINSLLMWLQSANLQDLPPGGLTAKR 1133
            MGAFL+KP+TEK + +  G  L YGL+AMQGWR++MEDAHT+++ L    K W++F V+DGHAG +VS+ CS  L  ++L    F+    +   +P D++  + G+R+ FLELD T+ +  +  +GEDKSGST I++ VTPKY IFANCGDSRG+L  +  V ++T DHKP NP E+ RI  AGG+VMIQR+NG+LAVSR+LGDF+YK   S   T+QLVSP+P+I   +  +D+D+ IVLACDGVWDVM+N+E+G FV  R Q   DL +++ E++D CL KGSRDNMSV+IIS   +P    E    + K+   +E K++  +  + N  E+D++  +  L    +Q LPPGG  A +
Sbjct:    1 MGAFLDKPRTEKETKTGEGNGLRYGLAAMQGWRVEMEDAHTAVIGLSDHLKDWSFFAVFDGHAGENVSKYCSSNLHETLLKHQSFEAAIKESSDSP-DLDQLRSGLRDAFLELDSTMQKLPKWSSGEDKSGSTAIALLVTPKYYIFANCGDSRGILSHNGEVIYNTVDHKPGNPDEKTRIENAGGSVMIQRVNGALAVSRALGDFEYKLDSSLHATKQLVSPEPDI-FFQSRSDQDEFIVLACDGVWDVMTNDEVGAFVRSRLQITDDLQRVSCELLDTCLTKGSRDNMSVIIISLPGSPKVTDEAIKNEQKVEAELEAKLEALLEEETNLAEVDVSYAMQSLSQEEIQGLPPGGGLASK 358          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Nematostella
Match: EDO40449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S778])

HSP 1 Score: 194.512 bits (493), Expect = 3.389e-58
Identity = 118/322 (36.65%), Postives = 183/322 (56.83%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSR------DNMSVVIISTKNAPNF----DRELASKDVK 995
            MG  L +P T K + S S ++     S MQGWRI+MEDAHT ILSL    K+ A+ GVYDGH G+ V++   Q L   I +   + K      GN ++       ++ GFL  D  + +  +++  ++ +G+T + V +    +  AN GDSR +  +   V   + DHKP N  E  RII AGG V   R+NG+LA+SR+LGDF +KK D K P EQ+V+  P++ +++ +  + + +VLACDG+WDV+SN+E+ +F+  R  +  +L +I EE++  CL    +      DNM+V+I++  N   +    DR L   D +
Sbjct:    1 MGQTLSEPVTTKETSSCSNKSYKLASSCMQGWRINMEDAHTEILSLKED-KNTAFLGVYDGHGGARVAQYVGQNLQKKIASQPAWAK------GNVIEA------LKKGFLSCDTDMLKDEQMK--DEVAGTTAVVVVIKNNKLYCANVGDSRAIACKKGLVEQLSFDHKPSNEEETRRIIAAGGWVEFNRVNGNLALSRALGDFCFKKNDKKPPEEQIVTAMPDV-IVKDLTPDHEFLVLACDGIWDVLSNQEVVDFIRSRLAQRMELEQICEELLTRCLAPDCQMGGLGCDNMTVIILTFLNGGTYEELCDRCLQPSDAR 306          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Nematostella
Match: EDO31490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXS4])

HSP 1 Score: 167.162 bits (422), Expect = 1.176e-47
Identity = 122/351 (34.76%), Postives = 173/351 (49.29%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEV-ETGEDK---------------------------------------------SGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQ-RINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKD-LSKIAEEVIDNCLYKGSR------DNMSVVIISTK 950
            MGA+L KPKTE +S +ES   +SYG SAMQGWR+ MEDAHT +L      +  + F VYDGH G  V+E  S K LP +L      K      GN       K+ + + FL++D++I     V E G D+                                             SG+T I   V    +  AN GDSR VL R+      + DHKP +  E +RI KAGG V  + R+NG L +SR+LGD  YK     G  EQ ++  P+I     + + D+ +V+ACDG+W+V +++E+ +FV    +  ++ LS I E++ D CL   +       DNM+ VI+S K
Sbjct:    1 MGAYLSKPKTEMNSVTESNSKMSYGASAMQGWRVSMEDAHTCLLDFD---EDTSLFAVYDGHGGQEVAEYVS-KHLPDVLRGDIGYKE-----GN------TKQALIDTFLKVDESIVSEEGVDEKGVDEEGASEEPQDGEEEEEEEEESEEEEEEEEDEDGEGVLVKSDEAGYDSGTTAIVALVKDNNLTVANVGDSRCVLCRNGIALDMSIDHKPEDEKELNRIHKAGGKVTCEGRVNGGLNLSRALGDHSYKGQSELGAHEQQITAMPDIRQT-TLTEADEFMVIACDGIWNVKNSQEVVDFVKQEMKNGEENLSSICEKLFDACLAPDTSGDGAGCDNMTCVIVSFK 335          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Nematostella
Match: EDO44137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ9])

HSP 1 Score: 113.62 bits (283), Expect = 2.026e-28
Identity = 80/301 (26.58%), Postives = 135/301 (44.85%), Query Frame = 3
Query:   75 EKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHT------SILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKK---MELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVM---IQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVII 941
            +K K E  +  +S       + A++  R  MED H       S+  LP    ++AYF V+DGH G   +   +  L   +       K   + L +     D     R I  G                   +SG T +S+ +T + +  A  GDS+ +L +        + HKP    E+DRI   GG V+     R+NGSL+VSR++GD ++K           +S +P++     ++ E + ++LACDG+WD +  E+  + V        D   +A+ ++D    +GS DN+SV+++
Sbjct:   23 QKWKEEPPTFYKSSYTYETSVYAIKNTRRKMEDKHVIMPHFNSLFGLPKDSPNYAYFAVFDGHGGIDAATFAATHLHCFLAQNEHLIKDPGLALHETFQNTDCSFGARAISEGL------------------RSGCTAVSILITNEALYLAWLGDSQAILCKDGEFIELMQPHKPERQDEKDRIEGLGGCVVWFGAWRVNGSLSVSRAIGDAEHKP---------FISGEPDVAEY-ALDGEQEFVILACDGLWDTVKPEQAIKLVKEHIASGNDRCDVAKVLVDEAKQEGSSDNISVLVV 295          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Nematostella
Match: EDO46288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH7])

HSP 1 Score: 98.9821 bits (245), Expect = 1.934e-23
Identity = 84/280 (30.00%), Postives = 131/280 (46.79%), Query Frame = 3
Query:  126 SYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQ--SHEVETGEDKSGSTVISVFVTPKY-VIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVM-----IQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVII 941
            S G +++QG +   ED    +L L   F    YF V+DGH G S +E    KL   +       + +L++             +   F E D  + +   H V   E  SG+T   V +     +  A+ GDSR VL R+      T DH P    E+ RI+   G +      + R+NG LA++RSLGDFD K      P   + +PD ++  ++  ++ D  IVL  DG+ DV+S+ ELG F++  C    D  + A  +    +  GS DN++ V++
Sbjct:    6 SVGFNSLQGKKSVNED-RFKLLELDPDFY---YFAVFDGHGGVSSAEFAHDKLHEIVRRLHRDGENDLEEI------------LVQAFEECDTELKRHLEHLVSEKELSSGTTATVVLLRDGTDLAIASTGDSRAVLCRNGETSCITRDHHPSLEEEQQRILSCNGRIESTSSDLLRVNGRLAMTRSLGDFDLK------PYGVIATPDTKLLKVD--HNADAFIVLITDGISDVISSYELG-FLVRMC---TDPEQAAHSLTCCAMQYGSDDNVTAVVV 257          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Medaka
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:101155070])

HSP 1 Score: 387.497 bits (994), Expect = 8.907e-132
Identity = 186/371 (50.13%), Postives = 259/371 (69.81%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNG--DGNEMDINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK ++S  G  L +GLS+MQGWR++MEDAHT+++SLP+P + W++F VYDGHAGS V++ C + LL  I ++  F+    +   + VD    K GIR+GFL  D+ I    E +   D+SGST + V ++P ++ F NCGDSRG+L RS  V F TEDHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK VD KGPTEQLVSP+PE+  IE+   +D+ I+LACDG+WDVM NEE+  FV  R +   DL ++  E++D CLYKGSRDNMSVV+I    AP   +E   ++++L++ +E +V+E +    D    D+ +++  L S  + +LPPGG L +KR +I+ +F  L
Sbjct:    1 MGAFLDKPKMEKHNNSGEGNELRFGLSSMQGWRVEMEDAHTAVVSLPSPLQCWSFFAVYDGHAGSQVAKYCCEHLLEHITSSQGFQSALKEKSESTVDK--VKDGIRSGFLMFDEHIRNLSEKKHSNDRSGSTAVGVMISPSHLYFINCGDSRGILSRSGLVKFFTEDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVYAIERSEKDDEFIILACDGIWDVMGNEEVCSFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLICFPGAPKVSQEAVMREMELDKFLEARVEEILKTEWDKGTPDLVNVMRMLTSETIPNLPPGGELASKRSLIEAVFNRL 369          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Medaka
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:101155070])

HSP 1 Score: 387.111 bits (993), Expect = 1.129e-131
Identity = 186/371 (50.13%), Postives = 259/371 (69.81%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNG--DGNEMDINSLLMWLQSANLQDLPPGG-LTAKRFIIDPLFEDL 1163
            MGAFL+KPK EK ++S  G  L +GLS+MQGWR++MEDAHT+++SLP+P + W++F VYDGHAGS V++ C + LL  I ++  F+    +   + VD    K GIR+GFL  D+ I    E +   D+SGST + V ++P ++ F NCGDSRG+L RS  V F TEDHKP NP+E++RI  AGG+VMIQR+NGSLAVSR+LGDFDYK VD KGPTEQLVSP+PE+  IE+   +D+ I+LACDG+WDVM NEE+  FV  R +   DL ++  E++D CLYKGSRDNMSVV+I    AP   +E   ++++L++ +E +V+E +    D    D+ +++  L S  + +LPPGG L +KR +I+ +F  L
Sbjct:    1 MGAFLDKPKMEKHNNSGEGNELRFGLSSMQGWRVEMEDAHTAVVSLPSPLQCWSFFAVYDGHAGSQVAKYCCEHLLEHITSSQGFQSALKEKSESTVDK--VKDGIRSGFLMFDEHIRNLSEKKHSNDRSGSTAVGVMISPSHLYFINCGDSRGILSRSGLVKFFTEDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVYAIERSEKDDEFIILACDGIWDVMGNEEVCSFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLICFPGAPKVSQEAVMREMELDKFLEARVEEILKTEWDKGTPDLVNVMRMLTSETIPNLPPGGELASKRSLIEAVFNRL 369          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Medaka
Match: ENSORLT00000039194.1 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 386.341 bits (991), Expect = 2.329e-131
Identity = 191/372 (51.34%), Postives = 255/372 (68.55%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNT-SEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVN--GDGNEMDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK S    G  L YGLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS  LL  IL+  +EF +        P  VE  K GIR+GFL +D+ +    ++  G D+SGST + V ++P ++ F NCGDSR VL R   V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+ V+E+  + D+ +VLACDG+WDVMSNEEL EFV  R     DL K+   V+D CL+KGSRDNMSVV++    AP    E   K+ +L++ +E +V+E +   G+    D+ S+L  + S N+ +LPP GGL +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHSAHGEGNGLHYGLSSMQGWRVEMEDAHTAVVGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQ-------GPSSVEGVKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGKVGFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFVRSRLLVCDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPGAPKISEEAVKKEEELDKYLETRVEELLGTCGETGAPDLVSVLRSIASENIPNLPPGGGLASKRSVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Medaka
Match: ENSORLT00000012921.2 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 387.882 bits (995), Expect = 1.161e-130
Identity = 191/372 (51.34%), Postives = 255/372 (68.55%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNT-SEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVN--GDGNEMDINSLLMWLQSANLQDLPP-GGLTAKRFIIDPLFEDL 1163
            MGAFL+KPKTEK S    G  L YGLS+MQGWR++MEDAHT+++ LP     W++F VYDGHAGS V+  CS  LL  IL+  +EF +        P  VE  K GIR+GFL +D+ +    ++  G D+SGST + V ++P ++ F NCGDSR VL R   V FST+DHKP NP E++RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+ V+E+  + D+ +VLACDG+WDVMSNEEL EFV  R     DL K+   V+D CL+KGSRDNMSVV++    AP    E   K+ +L++ +E +V+E +   G+    D+ S+L  + S N+ +LPP GGL +KR +I+ ++  L
Sbjct:    1 MGAFLDKPKTEKHSAHGEGNGLHYGLSSMQGWRVEMEDAHTAVVGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQ-------GPSSVEGVKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGKVGFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFVRSRLLVCDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPGAPKISEEAVKKEEELDKYLETRVEELLGTCGETGAPDLVSVLRSIASENIPNLPPGGGLASKRSVIEAVYNRL 365          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Medaka
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:101157967])

HSP 1 Score: 362.844 bits (930), Expect = 6.980e-122
Identity = 177/350 (50.57%), Postives = 234/350 (66.86%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAP-FKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGN------------------PVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNE 1052
            MGAFL+KPKTEK +    G  + YGLS+MQGWR++MEDAHT++L L  P    W++F VYDGHAGS V+  CS+ LL  I+ +S      L D G                   P  VE  K GIR GFL +D+ +    ++  G D+SGST + + ++P +  F NCGDSR VL R++ V FST DHKP NP ER+RI  AGG+VMIQR+NGSLAVSR+LGD+DYK VD KGPTEQLVSP+PE+ V+ +  ++DQ ++LACDG+WDVMSNE+L EFV  R +   DL K+  EV+D CL+KGSRDNMS+V++   N P    E   KD +LN+ +E +V+E ++  G+E
Sbjct:    1 MGAFLDKPKTEKHNSHGEGNGVRYGLSSMQGWRVEMEDAHTAVLGLQTPGMTDWSFFAVYDGHAGSKVANYCSKHLLEHIITSS------LGDGGTQGSEAGSESSGGEIPAPCPPAVEAVKAGIRTGFLRIDEHMRSFTDLRNGMDRSGSTAVGILLSPDHFFFINCGDSRAVLYRNSQVCFSTLDHKPCNPRERERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFVMVRAPEQDQFVILACDGIWDVMSNEDLCEFVKSRLEVCDDLEKVCNEVVDTCLHKGSRDNMSIVLVCLPNGPKVSEEAVKKDAELNKYLETRVEEMLSRPGDE 344          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Planmine SMEST
Match: SMESG000072821.1 (SMESG000072821.1)

HSP 1 Score: 826.239 bits (2133), Expect = 0.000e+0
Identity = 412/412 (100.00%), Postives = 412/412 (100.00%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFEDLCRDKQKPQNNSSESNHXXXXXXXXXXXXXENTYLWQRNHEAAAD 1295
            MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFEDLCRDKQKPQNNSSESNHTLSVLSLLTGSGTENTYLWQRNHEAAAD
Sbjct:    1 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFEDLCRDKQKPQNNSSESNHTLSVLSLLTGSGTENTYLWQRNHEAAAD 412          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 410.609 bits (1054), Expect = 3.907e-141
Identity = 192/376 (51.06%), Postives = 274/376 (72.87%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFEDLCRDKQKPQ 1187
            MGAFL+KPKT+K + S  G  L +GL++MQGWRI+MEDAH +I  L      W++F V+DGHAG+ VSEIC+ +LL +I+ T EFK +   D      V+  + GIR GFL LD+ I +  E E  +DKSGST + V V+PK++ FANCGDSR +LIR   V F+T DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR++GDF+YK VD KGPTEQLVSP+PE+TV+++ N+ D+L+VLACDG+WDVM+N+++ +F+ HR +   DL KI  E ID CLYKGSRDNMS+V+++ +NAP  D   ASKD +L++L++  +++Y+     + D+N+++  +Q+  L + PPGG+ +KR +ID ++ +L +    P+
Sbjct:    1 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNI---DPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGIKDYL-AKTEDADLNAVVNHIQNLKLLNFPPGGIHSKRHLIDKIYNELSKRDDCPR 372          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Planmine SMEST
Match: SMESG000027796.1 (SMESG000027796.1)

HSP 1 Score: 321.242 bits (822), Expect = 3.585e-106
Identity = 163/366 (44.54%), Postives = 237/366 (64.75%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFE 1157
            MG++  KP TEK + S    ++ Y  S+MQG R  MED     L+LP PF+ WAYF ++DGH G  VSE+CS +LL  IL T EFK + L +    +D      GI+  F+ LD  I    E        G+TV +VF+TP Y+IF NCGDSR VLIR + + FS+ DHKP NP+E++RI+KAGG + + R+NG+++VSR+LGD  YKK  +    EQL+S +P++ +I + ++ DQ+IVLACDGVWDV SN EL + ++ R +   DL KI++E+ID  LYKGS+DN+S +I++  NAP  + E    D  L+E I  K  EY+  + ++  +  L+ ++++  L++LPPGG+ +K+ II  LFE
Sbjct:    1 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSIELLNIILETEEFKNINLLN----LDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMEYLYSESSDSSLVDLIEYMKNIALENLPPGGIVSKQSIIVNLFE 354          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 310.842 bits (795), Expect = 2.912e-103
Identity = 143/278 (51.44%), Postives = 208/278 (74.82%), Query Frame = 3
Query:  354 VELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFEDLCRDKQKPQ 1187
            V+  + GIR GFL LD+ I +  E E  +DKSGST + V V+PK++ FANCGDSR +LIR   V F+T DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR++GDF+YK VD KGPTEQLVSP+PE+TV+++ N+ D+L+VLACDG+WDVM+N+++ +F+ HR +   DL KI  E ID CLYKGSRDNMS+V+++ +NAP  D   ASKD +L++L++  +++Y+     + D+N+++  +Q+  L + PPGG+ +KR +ID ++ +L +    P+
Sbjct:    5 VQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGIKDYL-AKTEDADLNAVVNHIQNLKLLNFPPGGIHSKRHLIDKIYNELSKRDDCPR 281          
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Planmine SMEST
Match: SMESG000007683.1 (SMESG000007683.1)

HSP 1 Score: 266.159 bits (679), Expect = 1.070e-86
Identity = 125/224 (55.80%), Postives = 163/224 (72.77%), Query Frame = 3
Query:   60 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDP 731
            MGA L KPK +K +     +NL  GLS+MQGWR++MED+H++I+++  PF  W+YFGVYDGH G S +  CS+ LL  IL T EF+ M+ DD GNP ++ + + GIR GFL+ D+ +     V +G D+SGST   VF+TP+Y +F NCGDSRG+LIR+  V+FSTEDHKP N  E++RI KAGG V+ +RING LAVSRSLGDF YKKV +K P EQ+VS DP
Sbjct:    1 MGALLAKPKVDKFTIGYKNENLIIGLSSMQGWRVEMEDSHSAIINMEYPFSRWSYFGVYDGHNGGSTALNCSKFLLQMILQTPEFQTMKFDDIGNPKNIGILRNGIRRGFLQFDEFLRSLPNVFSGIDRSGSTATCVFITPRYYVFINCGDSRGILIRNKGVYFSTEDHKPKNVDEKNRIEKAGGLVIGERINGCLAVSRSLGDFAYKKVVNKPPIEQMVSSDP 224          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPM1A7.625e-13652.16protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
PPM1A2.499e-13552.02protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
PPM1B7.241e-13049.87protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
PPM1B9.078e-13049.87protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
AC013717.11.008e-12949.87novel protein, PPM1B-SLC3A1 readthrough[more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm-1.A6.738e-8945.78Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A6.738e-8945.78Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A1.038e-8745.78Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A9.206e-8145.61Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-25.067e-6341.00Probable protein phosphatase 2C T23F11.1 [Source:... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG60363.184e-10042.86gene:FBgn0039421 transcript:FBtr0085027[more]
alph7.158e-9944.17gene:FBgn0086361 transcript:FBtr0085442[more]
alph7.158e-9944.17gene:FBgn0086361 transcript:FBtr0085445[more]
alph7.158e-9944.17gene:FBgn0086361 transcript:FBtr0085446[more]
alph8.044e-9944.17gene:FBgn0086361 transcript:FBtr0085443[more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1bb2.819e-13251.08protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Sou... [more]
ppm1bb2.819e-13251.08protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Sou... [more]
CR847495.11.347e-13051.97pep chromosome:GRCz11:CHR_ALT_CTG12_1_17:25477050:... [more]
ppm1aa6.608e-13049.33protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1aa7.145e-13049.33protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1b3.987e-13351.48protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b6.891e-13152.11protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b1.006e-13051.81protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1a1.674e-13049.60protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1b5.709e-13051.63protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppm1a1.328e-13351.08protein phosphatase 1A, magnesium dependent, alpha... [more]
Ppm1b5.411e-13150.13protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b5.411e-13150.13protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b6.439e-13150.13protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b9.243e-13150.13protein phosphatase 1B, magnesium dependent, beta ... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20650|PPM1A_RAT2.220e-13551.89Protein phosphatase 1A OS=Rattus norvegicus OX=101... [more]
sp|P35813|PPM1A_HUMAN3.662e-13552.16Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=... [more]
sp|P35814|PPM1A_RABIT1.458e-13451.89Protein phosphatase 1A OS=Oryctolagus cuniculus OX... [more]
sp|O62829|PPM1A_BOVIN1.447e-13351.62Protein phosphatase 1A OS=Bos taurus OX=9913 GN=PP... [more]
sp|P49443|PPM1A_MOUSE9.289e-13351.08Protein phosphatase 1A OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G9275.555e-13453.26PPM-type phosphatase domain-containing protein OS=... [more]
A0A267H0E25.752e-13453.17PPM-type phosphatase domain-containing protein (Fr... [more]
A0A2K5E2P46.607e-13352.16Protein phosphatase, Mg2+/Mn2+ dependent 1A OS=Aot... [more]
A0A384CYN86.665e-13351.32protein phosphatase 1A isoform X2 OS=Ursus maritim... [more]
G9KI296.696e-13351.33Protein phosphatase 1A, magnesium-dependent, alpha... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1bb3.673e-13351.34protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1bb6.071e-13351.34protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1bb3.331e-13251.34protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1aa9.157e-12948.81protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1aa9.196e-12948.81protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1aa1.090e-13250.40protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ENSPMAT00000003550.11.878e-4432.28pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ENSPMAT00000003549.12.885e-4430.89pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ppm1e6.418e-2126.25protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
si:ch211-149b19.31.505e-2027.30si:ch211-149b19.3 [Source:ZFIN;Acc:ZDB-GENE-110411... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PTC38.841e-5034.54Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC22.039e-4933.55Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC16.071e-2931.00Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC41.753e-2324.86Cytoplasmic type 2C protein phosphatase (PP2C); id... [more]
CYR14.268e-1124.77Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360401.202e-11948.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404493.389e-5836.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314901.176e-4734.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441372.026e-2826.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462881.934e-2330.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1aa8.907e-13250.13protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1aa1.129e-13150.13protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ENSORLT00000039194.12.329e-13151.34protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000012921.21.161e-13051.34protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ppm1ba6.980e-12250.57protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of Protein phosphatase, Mg2 /Mn2 dependent 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072821.10.000e+0100.00SMESG000072821.1[more]
SMESG000032910.13.907e-14151.06SMESG000032910.1[more]
SMESG000027796.13.585e-10644.54SMESG000027796.1[more]
SMESG000032910.12.912e-10351.44SMESG000032910.1[more]
SMESG000007683.11.070e-8655.80SMESG000007683.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033069 ID=SMED30033069|Name=Protein phosphatase, Mg2 /Mn2  dependent 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=1452bp
GGAATGACTAATATTTAAATTACTTAATAATAAAAATAATTTTTACTTAC
TTGATTTTTATGGGAGCCTTTTTAGAAAAACCGAAAACTGAAAAATCCAG
TCACTCAGAAAGTGGCCAAAATCTTAGTTATGGTCTTTCAGCAATGCAGG
GATGGCGAATTGACATGGAGGATGCTCATACATCAATTCTCTCTCTTCCA
GCTCCATTTAAGTCATGGGCATATTTTGGTGTGTATGATGGCCATGCTGG
AAGTTCAGTATCGGAGATTTGTTCTCAAAAACTATTACCGTCGATTCTTA
ATACTTCAGAATTTAAAAAAATGGAATTAGATGACTTTGGAAATCCAGTT
GATGTTGAACTGGCAAAAAGAGGAATCAGAAATGGATTTCTAGAATTGGA
CAAAACTATTGGACAGTCACATGAAGTGGAAACTGGTGAAGACAAATCCG
GATCAACTGTTATTTCAGTTTTCGTTACACCGAAATATGTTATATTTGCA
AATTGCGGAGACTCGAGAGGTGTCCTTATCCGCAGCAACACTGTTCATTT
TTCCACAGAAGATCACAAACCGATGAATCCCATAGAACGCGACCGTATTA
TCAAAGCTGGTGGCACTGTGATGATTCAACGCATTAATGGCTCACTTGCA
GTTTCACGGTCTCTGGGAGATTTTGATTACAAGAAAGTTGACTCTAAAGG
ACCTACTGAACAATTAGTTTCTCCAGACCCAGAGATAACTGTCATAGAGA
AAGTCAATGATGAAGATCAACTAATAGTTCTGGCGTGTGATGGCGTGTGG
GATGTGATGAGCAACGAGGAGTTGGGTGAATTTGTCATTCATAGATGCCA
GAGAGTTAAAGATCTCAGCAAAATTGCAGAAGAGGTCATTGATAACTGTT
TATACAAAGGCAGTCGAGATAACATGAGCGTTGTAATTATATCTACGAAA
AATGCTCCAAATTTCGACAGAGAACTTGCTAGCAAAGATGTGAAACTCAA
CGAGTTGATTGAACGAAAAGTTCAGGAATACGTCAATGGAGATGGCAATG
AAATGGACATCAACAGCCTGTTGATGTGGCTACAGAGCGCTAATCTGCAA
GATTTACCTCCAGGAGGTCTGACTGCCAAACGCTTCATTATCGACCCGCT
ATTCGAAGACCTCTGTAGAGATAAACAGAAACCTCAAAACAATTCATCAG
AGTCAAATCACACTTTATCCGTCCTTTCTCTGCTAACGGGTTCAGGGACC
GAGAACACATATTTGTGGCAAAGGAACCATGAAGCAGCGGCAGACAAAAC
CGAATCAAGTAGTAGCAAATCTAAAACAACATAATTGCTGGCTGAATAGC
TGATCAGTCGTTATTAGTCATTATTATGACCTTCATTCAATGTTGTTAAT
AGCACTCTCGGCGTGCTACTGCATTGTTTATTATTAATTATACTTTATTA
AT
back to top

protein sequence of SMED30033069-orf-1

>SMED30033069-orf-1 ID=SMED30033069-orf-1|Name=SMED30033069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=425bp
MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPF
KSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVE
LAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCG
DSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSR
SLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVM
SNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAP
NFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLP
PGGLTAKRFIIDPLFEDLCRDKQKPQNNSSESNHTLSVLSLLTGSGTENT
YLWQRNHEAAADKTESSSSKSKTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016020membrane
GO:0043005neuron projection
Vocabulary: biological process
TermDefinition
GO:0010991negative regulation of SMAD protein complex assembly
GO:0016311dephosphorylation
GO:0030512negative regulation of transforming growth factor beta receptor signaling pathway
GO:0035970peptidyl-threonine dephosphorylation
GO:0045893positive regulation of transcription, DNA-templated
GO:0090263positive regulation of canonical Wnt signaling pathway
GO:1901223negative regulation of NIK/NF-kappaB signaling
GO:0006470protein dephosphorylation
GO:0006499N-terminal protein myristoylation
GO:0042347negative regulation of NF-kappaB import into nucleus
GO:0043124negative regulation of I-kappaB kinase/NF-kappaB signaling
Vocabulary: molecular function
TermDefinition
GO:0033192calmodulin-dependent protein phosphatase activity
GO:0003824catalytic activity
GO:0000287magnesium ion binding
GO:0030145manganese ion binding
GO:0004721phosphoprotein phosphatase activity
GO:0043169cation binding
GO:0004722protein serine/threonine phosphatase activity
GO:0005515protein binding
GO:0008022protein C-terminus binding
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0070412R-SMAD binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036457PPM-type_dom_sf
IPR036580PP2C_C_sf
IPR015655PP2C
IPR001932PPM-type_phosphatase_dom
IPR012911PP2C_C
IPR000222PP2C_BS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001932PPM-type phosphatase domainSMARTSM00332PP2C_4coord: 13..294
e-value: 2.2E-89
score: 312.9
IPR001932PPM-type phosphatase domainPFAMPF00481PP2Ccoord: 24..289
e-value: 1.7E-73
score: 247.5
IPR001932PPM-type phosphatase domainPROSITEPS51746PPM_2coord: 23..296
score: 44.693
IPR001932PPM-type phosphatase domainCDDcd00143PP2Cccoord: 23..294
e-value: 7.3483E-88
score: 265.729
IPR012911Protein serine/threonine phosphatase 2C, C-terminalPFAMPF07830PP2C_Ccoord: 290..365
e-value: 2.9E-14
score: 53.3
IPR036457PPM-type phosphatase domain superfamilyGENE3DG3DSA:3.60.40.10coord: 1..303
e-value: 1.0E-107
score: 361.8
IPR036457PPM-type phosphatase domain superfamilySUPERFAMILYSSF81606PP2C-likecoord: 4..296
IPR036580Phosphatase 2C, C-terminal domain superfamilyGENE3DG3DSA:1.10.10.430coord: 304..370
e-value: 1.0E-9
score: 39.8
IPR036580Phosphatase 2C, C-terminal domain superfamilySUPERFAMILYSSF81601Protein serine/threonine phosphatase 2C, C-terminal domaincoord: 304..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 403..424
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR13832:SF244PROTEIN PHOSPHATASE 1Bcoord: 1..330
IPR015655Protein phosphatase 2C familyPANTHERPTHR13832PROTEIN PHOSPHATASE 2Ccoord: 1..330
IPR000222PPM-type phosphatase, divalent cation bindingPROSITEPS01032PPM_1coord: 55..63