Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30033061
Length (bp)1720
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 77.7962 bits (190), Expect = 2.091e-14
Identity = 78/286 (27.27%), Postives = 122/286 (42.66%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++NA IQ +    P   YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 73.559 bits (179), Expect = 6.285e-13
Identity = 79/286 (27.62%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 73.1738 bits (178), Expect = 7.659e-13
Identity = 79/286 (27.62%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 73.1738 bits (178), Expect = 7.659e-13
Identity = 79/286 (27.62%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 73.1738 bits (178), Expect = 7.659e-13
Identity = 79/286 (27.62%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-3 (Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;Acc:Q9GRV2])

HSP 1 Score: 64.6994 bits (156), Expect = 9.090e-11
Identity = 74/338 (21.89%), Postives = 135/338 (39.94%), Query Frame = 1
Query:  409 EVKLSPVPLINHGVNCYMNAAIQSIFPA------LLYLNTIKETIEYDQSQECGA--IILMESLLQAYINQ--EEFSIPICIYE-QSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP----------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKN-----MTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPY---------KSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            E+   P  + N G  C+MNA +Q++         ++ L+++++ I  ++  + G     L +   +  I+Q    F  P    E + +              D+HEF+  ++D L+ E++   KL  +P          FE    S   C  C   +N K +  +D  L +   +N     +++ +  + K E+    E   C  C+ K  + S ++   +LPQ L + +KRF  +              D II+ P            D       Y L S++ H G     GHY  F K    W++ DD  V+  +  +   +S    Y+ ++ K+
Sbjct:  223 EIAYRPRGMRNVGNTCFMNAVLQALASISEFREYIMSLSSLEDYIHDEKEPKNGGNYCYLTDEYRKLLISQSARSFREPTAPNEFREAFISVCPRFRGFRQHDSHEFMRYFMDSLHTEMRKCRKLPGMPDDKHTPISKYFEGTLQSSVICQTCRNCSN-KIDEFMDLSLDIPAQRNASKVRLSDCLSTFFKLEMLEKGEKPECAKCKTKQ-TCSKQMFIRKLPQVLCLHMKRFRDNGGKN----------DAIIDFPMGQLDVTQFLTDDSDEAPCTYSLQSIIVHIGYGCGSGHYIAFGKRNGRWFQFDDTVVKGVDEAH---VSKQKAYVLLYTKI 545          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-46 (Ubiquitin carboxyl-terminal hydrolase 46 [Source:UniProtKB/Swiss-Prot;Acc:P34547])

HSP 1 Score: 53.5286 bits (127), Expect = 2.249e-7
Identity = 39/120 (32.50%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  925 CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGSLK-RGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYS 1275
            CE C  K   A   +   + PQ L + +KRF       +  K++ R+     + +   SDD     + Y LV+ V H G+   RGHY T +K  +FW   DDD V K E+  M+  S  S
Sbjct:  246 CETCSSKQ-EAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLSYRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDIVEKLEVSSMEEFSGMS 364          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-46 (Ubiquitin carboxyl-terminal hydrolase 46 [Source:UniProtKB/Swiss-Prot;Acc:P34547])

HSP 1 Score: 53.5286 bits (127), Expect = 2.680e-7
Identity = 39/120 (32.50%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  925 CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGSLK-RGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYS 1275
            CE C  K   A   +   + PQ L + +KRF       +  K++ R+     + +   SDD     + Y LV+ V H G+   RGHY T +K  +FW   DDD V K E+  M+  S  S
Sbjct:  258 CETCSSKQ-EAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLSYRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDIVEKLEVSSMEEFSGMS 376          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-46 (Ubiquitin carboxyl-terminal hydrolase 46 [Source:UniProtKB/Swiss-Prot;Acc:P34547])

HSP 1 Score: 53.5286 bits (127), Expect = 2.680e-7
Identity = 39/120 (32.50%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  925 CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGSLK-RGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYS 1275
            CE C  K   A   +   + PQ L + +KRF       +  K++ R+     + +   SDD     + Y LV+ V H G+   RGHY T +K  +FW   DDD V K E+  M+  S  S
Sbjct:  258 CETCSSKQ-EAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLSYRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDIVEKLEVSSMEEFSGMS 376          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-33 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q93875])

HSP 1 Score: 53.9138 bits (128), Expect = 2.750e-7
Identity = 46/180 (25.56%), Postives = 79/180 (43.89%), Query Frame = 1
Query:  793 CNNCGKSNNDKPNIVVDQVLF--VSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDD------KVLKQKYRLVSVVNHTG-SLKRGHYFTFLKH--GNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1299
            C +    +   P  +V Q  F   S+   +    +N    +   ++C  CEV    A+       LP+ +++ +KRF  H+ + + K+       +++E P +S D            Y LV  V H G SL+ GHY ++ +H   N WYK DD  V +C+      ++    YI ++ K
Sbjct:  379 CTSSNIEDGQDPGFLVHQGAFNKTSLESCLDRFFQNSTLQDDNQYSCSKCEVL-VDATKSTKAHRLPEVIIIQLKRFR-HTMFGSCKVG------KVVEFPLRSQDFGRWTTSGEPALYDLVGFVVHEGRSLEFGHYVSYCRHEQDNQWYKFDDMVVTRCD---ATQVAKSQPYILMYRK 547          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0073641)

HSP 1 Score: 77.0258 bits (188), Expect = 2.462e-14
Identity = 82/287 (28.57%), Postives = 123/287 (42.86%), Query Frame = 1
Query:  427 VPLINHGVNCYMNAAIQSI-FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFS-IPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKGHSKLQRIP--FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKN-GSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFL--KHGNFWYKADDDSVRKCE 1242
            V L N G  CYMN+ +Q++ F   L L+  +   E D S +   +      LQ   ++ +F   P+        +  +    WE ++     D  EFL   LDKL  ++KG      IP  FE    S   C N    N+ +     D  L +   KN+ E  ++Y+  E +EG N  +  V     AS  V+F+  P  L + + RF       +  K NDR    E I +  Y ++ +     Y L +V+ H+G    GHY  F+  K    W+K DDD V  C 
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLS-----LQRVFHELQFGDRPV------GTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVD-YNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCR 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0342732)

HSP 1 Score: 77.0258 bits (188), Expect = 2.681e-14
Identity = 82/287 (28.57%), Postives = 123/287 (42.86%), Query Frame = 1
Query:  427 VPLINHGVNCYMNAAIQSI-FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFS-IPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKGHSKLQRIP--FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKN-GSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFL--KHGNFWYKADDDSVRKCE 1242
            V L N G  CYMN+ +Q++ F   L L+  +   E D S +   +      LQ   ++ +F   P+        +  +    WE ++     D  EFL   LDKL  ++KG      IP  FE    S   C N    N+ +     D  L +   KN+ E  ++Y+  E +EG N  +  V     AS  V+F+  P  L + + RF       +  K NDR    E I +  Y ++ +     Y L +V+ H+G    GHY  F+  K    W+K DDD V  C 
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLS-----LQRVFHELQFGDRPV------GTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVD-YNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCR 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: faf (gene:FBgn0005632 transcript:FBtr0307548)

HSP 1 Score: 63.1586 bits (152), Expect = 6.069e-10
Identity = 55/221 (24.89%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  679 EDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRF----------ATHSYYQTKKIND---------RICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNF------WYKADDDSVRKCEL 1245
            +DA EF    L+ L+E LK  G  +L       +   +  C  C  + + ++P  V    + +    ++TE +E Y+K E+    + ++C+ C+ K       V   +LP  L + +KRF            + Y++  +I D              E++E+       V   KY L  +V H+G    GHYF+++   N       WYK DD  V +C++
Sbjct: 1799 QDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFS--VDIRNHSSLTESLEQYVKGELLEGADAYHCDKCD-KKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKM 2016          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: faf (gene:FBgn0005632 transcript:FBtr0339189)

HSP 1 Score: 63.1586 bits (152), Expect = 6.069e-10
Identity = 55/221 (24.89%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  679 EDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRF----------ATHSYYQTKKIND---------RICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNF------WYKADDDSVRKCEL 1245
            +DA EF    L+ L+E LK  G  +L       +   +  C  C  + + ++P  V    + +    ++TE +E Y+K E+    + ++C+ C+ K       V   +LP  L + +KRF            + Y++  +I D              E++E+       V   KY L  +V H+G    GHYF+++   N       WYK DD  V +C++
Sbjct: 1799 QDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFS--VDIRNHSSLTESLEQYVKGELLEGADAYHCDKCD-KKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKM 2016          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: faf (gene:FBgn0005632 transcript:FBtr0085844)

HSP 1 Score: 63.1586 bits (152), Expect = 6.162e-10
Identity = 55/221 (24.89%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  679 EDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRF----------ATHSYYQTKKIND---------RICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNF------WYKADDDSVRKCEL 1245
            +DA EF    L+ L+E LK  G  +L       +   +  C  C  + + ++P  V    + +    ++TE +E Y+K E+    + ++C+ C+ K       V   +LP  L + +KRF            + Y++  +I D              E++E+       V   KY L  +V H+G    GHYF+++   N       WYK DD  V +C++
Sbjct: 1799 QDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFS--VDIRNHSSLTESLEQYVKGELLEGADAYHCDKCD-KKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKM 2016          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp36 (ubiquitin specific peptidase 36 [Source:ZFIN;Acc:ZDB-GENE-030131-5450])

HSP 1 Score: 74.3294 bits (181), Expect = 2.449e-13
Identity = 80/312 (25.64%), Postives = 133/312 (42.63%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSC-YIEVFEKLN 1305
            L N G  C++N+ +Q +    P   YL + + +    QS  C   ++   ++QA+ N      P+       L+  +    + + EDAHEFL   +D + +  L G+ KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   A+           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V    ++ +     Y   Y+ + EK N
Sbjct:  124 LHNLGNTCFLNSTVQCLTYTPPLANYLLSKEHSRSCHQSGFCMICVMQNHIIQAFANTANAIKPVSFIRD--LKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGYPKLDRQTQATTLVHQIFGGYLRSRVKCSIC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKPDVLSGENAYMCAKCK-KKVPATKRFTVHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSMVHSSNIKVVLNQQAYVLFYLRIPEKKN 428          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp42 (ubiquitin specific peptidase 42 [Source:ZFIN;Acc:ZDB-GENE-030131-5739])

HSP 1 Score: 70.8626 bits (172), Expect = 2.817e-12
Identity = 71/285 (24.91%), Postives = 125/285 (43.86%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ +Q +    P   Y+ T + +    +   C    +   ++Q + N      PI +  +  L+       + + EDAHEFL   +D + +     +KL R           F     SR  C NC K+ +D  +  +D  L +   + +++  E ++K E ++G   + C  C+ K  +AS           L + +KRF     +   KI   +   E +++ P+ S      Q Y L +V+ H+G S   GHY+ ++K  N  WY+ +D SV
Sbjct:  116 LHNLGNTCFLNSTLQCLTYTAPLANYMLTREHSKTCHEPGFCMMCTMQNHIIQVFANSGNVIKPISVLNE--LKRIGKHFRFGSQEDAHEFLRYTVDAMQKSCLPGNKLDRQTQATTFVHQIFGGYLRSRVKCLNC-KAVSDTFDPYLDISLEIKTAQTLSKAFEQFVKPEQLDGDNAYKCSKCK-KMVTASKRFTVHRSSNVLTISLKRFTN---FNGGKITKDVRYAEHLDLRPFMSQSHGEPQIYALYAVLVHSGFSCHAGHYYCYIKASNGQWYQMNDSSV 393          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp42 (ubiquitin specific peptidase 42 [Source:ZFIN;Acc:ZDB-GENE-030131-5739])

HSP 1 Score: 70.8626 bits (172), Expect = 2.817e-12
Identity = 71/285 (24.91%), Postives = 125/285 (43.86%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ +Q +    P   Y+ T + +    +   C    +   ++Q + N      PI +  +  L+       + + EDAHEFL   +D + +     +KL R           F     SR  C NC K+ +D  +  +D  L +   + +++  E ++K E ++G   + C  C+ K  +AS           L + +KRF     +   KI   +   E +++ P+ S      Q Y L +V+ H+G S   GHY+ ++K  N  WY+ +D SV
Sbjct:  116 LHNLGNTCFLNSTLQCLTYTAPLANYMLTREHSKTCHEPGFCMMCTMQNHIIQVFANSGNVIKPISVLNE--LKRIGKHFRFGSQEDAHEFLRYTVDAMQKSCLPGNKLDRQTQATTFVHQIFGGYLRSRVKCLNC-KAVSDTFDPYLDISLEIKTAQTLSKAFEQFVKPEQLDGDNAYKCSKCK-KMVTASKRFTVHRSSNVLTISLKRFTN---FNGGKITKDVRYAEHLDLRPFMSQSHGEPQIYALYAVLVHSGFSCHAGHYYCYIKASNGQWYQMNDSSV 393          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 65.855 bits (159), Expect = 7.118e-11
Identity = 79/302 (26.16%), Postives = 131/302 (43.38%), Query Frame = 1
Query:  427 VPLINHGVNCYMNAAIQSIFPAL-------LYLNTIKETIEYDQSQE----CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHS--KLQRI---PFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLK--HGNFWYKADDDSVRKCELEYMKM 1260
            V L N G  CY+N  +Q  F  L        + N+  E    D   E    C  +  + +LLQ   +   +  P  + +       +L L     +DA EF   +L  L + L       LQ +    F         CN CG+ +   P+   +  L +   KN+TE +  +LK+E ++G N   CE+C+ K  +A+  +    LP+ L   + RF         KK+N  I   E++++    + +  K  Y L +V+ H G S   GHY   ++  H N WYK +D+ + K E + +++
Sbjct:   90 VGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQN--SNRRYIDPSGLVK-------ALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRES-PLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQ-NATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFLEGREEKCTYELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEGKKLQL 380          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 65.4698 bits (158), Expect = 1.322e-10
Identity = 79/302 (26.16%), Postives = 131/302 (43.38%), Query Frame = 1
Query:  427 VPLINHGVNCYMNAAIQSIFPAL-------LYLNTIKETIEYDQSQE----CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGH--SKLQRI---PFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLK--HGNFWYKADDDSVRKCELEYMKM 1260
            V L N G  CY+N  +Q  F  L        + N+  E    D   E    C  +  + +LLQ   +   +  P  + +       +L L     +DA EF   +L  L + L       LQ +    F         CN CG+ +   P+   +  L +   KN+TE +  +LK+E ++G N   CE+C+ K  +A+  +    LP+ L   + RF         KK+N  I   E++++    + +  K  Y L +V+ H G S   GHY   ++  H N WYK +D+ + K E + +++
Sbjct:   89 VGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQN--SNRRYIDPSGLVK-------ALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRES-PLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQ-NATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFLEGREEKCTYELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEGKKLQL 379          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000030414.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:124917763:124921450:-1 gene:ENSXETG00000003555.1 transcript:ENSXETT00000030414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 1.916e-14
Identity = 80/305 (26.23%), Postives = 128/305 (41.97%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            L N G  CYMN+ +Q +    P   Y  T + +    +   C     M  L+Q +I Q              ++  +        EDAHEFL   +D L +  L G+  L R        F     S   C NC   + D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:   36 LRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFC-----MMCLMQKHIAQ--------------VKRIAGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNCSGVS-DTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNKMVTATKTFSIHQPPNVLTLCLNRFDVFS---ENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000031190.1 (ubiquitin carboxyl-terminal hydrolase 42-like [Source:NCBI gene;Acc:101735032])

HSP 1 Score: 76.2554 bits (186), Expect = 2.140e-14
Identity = 80/305 (26.23%), Postives = 128/305 (41.97%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            L N G  CYMN+ +Q +    P   Y  T + +    +   C     M  L+Q +I Q              ++  +        EDAHEFL   +D L +  L G+  L R        F     S   C NC   + D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:   51 LRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFC-----MMCLMQKHIAQ--------------VKRIAGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNCSGVS-DTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNEMVTATKTFSIHQPPNVLTLCLNRFDVFS---ENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 332          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: rpl7l1 (ribosomal protein L7 like 1 [Source:Xenbase;Acc:XB-GENE-5911163])

HSP 1 Score: 75.485 bits (184), Expect = 3.313e-14
Identity = 82/305 (26.89%), Postives = 132/305 (43.28%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            L N G  CYMN+ +Q +    P   Y  T + +    +   C     M  L+Q +I Q + S+      Q+ +   +        EDAHEFL   +D L +  L G+  L R        F     S   C NC   + D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:   36 LRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFC-----MMCLMQKHIAQVK-SVSGRGANQARI---AGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNCSGVS-DTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNEMVTATKTFSIHQPPNVLTLCLNRFDVFS---DNKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 327          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000014911.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:124917318:124921450:-1 gene:ENSXETG00000003555.1 transcript:ENSXETT00000014911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 5.939e-14
Identity = 80/305 (26.23%), Postives = 128/305 (41.97%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            L N G  CYMN+ +Q +    P   Y  T + +    +   C     M  L+Q +I Q              ++  +        EDAHEFL   +D L +  L G+  L R        F     S   C NC   + D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:   36 LRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFC-----MMCLMQKHIAQ--------------VKRIAGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNCSGVS-DTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNKMVTATKTFSIHQPPNVLTLCLNRFDVFS---ENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: eif1b (eukaryotic translation initiation factor 1B [Source:Xenbase;Acc:XB-GENE-1010215])

HSP 1 Score: 66.2402 bits (160), Expect = 8.637e-11
Identity = 75/293 (25.60%), Postives = 133/293 (45.39%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQE-CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCELE 1248
            L N G  C++N+ +Q +    P   YL + +E  E   SQ+ C   ++   +  A  N      P  +     L   S    + + EDAHEFL   +D++ +  L+G  +L R           F     SR  C +C K+ +D  +  +D  L + +  ++ + +E +++ E ++G   + C  C+ +  +AS           L + +KRFA+   +   K++  I   E +++ PY SD       Y L +V+ HTG S   GHY+ ++K  N  WY  +D +V   ++ 
Sbjct:  100 LQNLGNTCFVNSVLQCLTYTAPLSNYLIS-REHSETCHSQDFCMMCVMQTHISMALSNSGGVIKPSAVVND--LRRISKNFRYGSQEDAHEFLRYTVDEMQKSCLRGSCRLDRHTQATTLIHQVFGGYLRSRVTCLSC-KAVSDTYDQYLDLTLEIKMAHSVNQALEQFVRPEQLDGDNAYKCSKCK-QMVTASKRFTIHRTSNVLTLSLKRFAS---FNGGKLSKEIKYPEYLDLRPYTSDPNGEPVIYVLYAVLIHTGFSCHGGHYYCYVKACNDQWYLMNDSTVSTTDIR 384          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp36 (ubiquitin specific peptidase 36 [Source:MGI Symbol;Acc:MGI:1919594])

HSP 1 Score: 73.9442 bits (180), Expect = 3.726e-13
Identity = 78/286 (27.27%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G++KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGGFCMLCLMQNHMVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp36 (ubiquitin specific peptidase 36 [Source:MGI Symbol;Acc:MGI:1919594])

HSP 1 Score: 73.9442 bits (180), Expect = 3.726e-13
Identity = 78/286 (27.27%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G++KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGGFCMLCLMQNHMVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp42 (ubiquitin specific peptidase 42 [Source:MGI Symbol;Acc:MGI:1924050])

HSP 1 Score: 73.1738 bits (178), Expect = 6.081e-13
Identity = 79/298 (26.51%), Postives = 130/298 (43.62%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIFPALLYLNTIKE-TIEYDQSQECGA------IILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCELEYM 1254
            L N G  C+ NAA+Q     L Y   +    + ++ S+ C A        +   + QA  N  +   P+ +  +  +   +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C NC K  +D  +  +D  L +   +++T+ +E ++K E ++G   + C  C+ K   AS           L + +KRFA    +   KI   +   E ++I PY S        Y L +V+ HTG +   GHYF ++K  N  WY+ +D  V   ++  +
Sbjct:  112 LQNLGNTCFANAALQ----CLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQTHITQALSNPGDVIKPMFVINE--MRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRSRVKCLNC-KGVSDTFDPYLDITLEIKAAQSVTKALEQFVKPEQLDGENSYKCSKCK-KMVPASKRFTIHRSSNVLTISLKRFAN---FTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRAV 398          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp17ld (ubiquitin specific peptidase 17-like D [Source:MGI Symbol;Acc:MGI:3051372])

HSP 1 Score: 68.5514 bits (166), Expect = 1.198e-11
Identity = 75/291 (25.77%), Postives = 136/291 (46.74%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSI--FPALLYLNTIKETIEYDQSQECGAIILMES-LLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIPFEAA--HD-------SRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLK-DEVEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSL-KRGHYFTFLKHGNF-WYKADDDSVRKCEL 1245
            L N G +CY+NAA+Q +   P L      +E  +   S E   +  ME+ + Q+ ++     +          +  +        EDAHEFL   L+ ++E  L+ H + +    +++  HD       S+  C +C +  +D  +  +D  L +S  +++ + + +  K +E+ G N   C  C  K   AS  +     P+ L++ +KRF   S +   K++ ++   E +++ PY S        Y L +V+ H G+    GHYF+++K G+  WYK DD  V  C++
Sbjct:   53 LQNTGNSCYLNAALQCLTHTPPLADYMLSQEYSQTCCSPEGCKMCAMEAHVTQSLLHSHSGDV------MKPSQILTSAFHKHQQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSSPIHDIFGGLWRSQIKCLHC-QGTSDTYDRFLDVPLDISSAQSVNQALWDTEKSEELRGENAYYCGRCRQKM-PASKTLHIHSAPKVLLLVLKRF---SAFMGNKLDRKVSYPEFLDLKPYLSQPTGGPLPYALYAVLVHEGATCHSGHYFSYVKAGHGKWYKMDDTKVTSCDV 332          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp17lc (ubiquitin specific peptidase 17-like C [Source:MGI Symbol;Acc:MGI:107698])

HSP 1 Score: 67.0106 bits (162), Expect = 3.326e-11
Identity = 76/292 (26.03%), Postives = 136/292 (46.58%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSI--FPALLYLNTIKETIEYDQSQECGAIILMES-LLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIPFEAA--HD-------SRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLK-DEVEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSL-KRGHYFTFLK--HGNFWYKADDDSVRKCEL 1245
            L N G +CY+NAA+Q +   P L      +E  +   S E   +  ME+ + Q+ ++     +          +  +        EDAHEFL   L+ ++E  L+ H + +    +++  HD       S+  C +C +  +D  +  +D  L +S  +++ + + +  K +E+ G N   C  C  K   AS  +     P+ L++ +KRF   S +   K++ ++   E +++ PY S        Y L +V+ H G+    GHYF+++K  HG  WYK DD  V  C++
Sbjct:   53 LQNTGNSCYLNAALQCLTHTPPLADYMLSQEYSQTCCSPEGCKMCAMEAHVTQSLLHSHSGDV------MKPSQILTSAFHKHQQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSSPIHDIFGGLWRSQIKCLHC-QGTSDTYDRFLDVPLDISSAQSVNQALWDTEKSEELRGENAYYCGRCRQKM-PASKTLHIHSAPKVLLLVLKRF---SAFMGNKLDRKVSYPEFLDLKPYLSQPTGGPLPYALYAVLVHEGATCHSGHYFSYVKARHG-AWYKMDDTKVTSCDV 332          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q09738|UBP8_SCHPO (Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp8 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.166e-13
Identity = 72/281 (25.62%), Postives = 127/281 (45.20%), Query Frame = 1
Query:  439 NHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECG-------AIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKL------QRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKN---MTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYK-SDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSV 1230
            N G  C+M+  +QSI    L  N       +  S +C        AI  M S +    N+  F  P  +   + +   S  L   + +D HEF    LD+++ E  G + +       RI F  +  +   C +C K       + VD ++ +S+  N   +   +E ++  E   ++C +C  KN  A  ++VF +LP  + + +KRF  +++  + KI+ ++     + + Y  + D V    Y+L SVV H G+L  GHY  +  + N W+  DD ++
Sbjct:  149 NLGATCFMSVILQSILHNPLVRNLFFSG--FHTSTDCKRPTCMTCAIDDMFSSIYNSKNKSTFYGPTAVL--NLMWKLSKSLCGYSQQDGHEFFVYLLDQMHTESGGGTSMPCTCPIHRI-FSGSLKNVVTCLDCKKER-----VAVDPLMDISLDINEPTLQGCLERFVSKEKVQYSCHSCGSKN--AIKQLVFDKLPPTICMQLKRFEQNNFAMSTKIDKQVSYPAFLRMRYNFNQDDV---DYQLYSVVCHKGTLDTGHYIAYTYYQNQWFLLDDTTI 414          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9VYQ8|UBP7_DROME (Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.468e-13
Identity = 82/287 (28.57%), Postives = 123/287 (42.86%), Query Frame = 1
Query:  427 VPLINHGVNCYMNAAIQSI-FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFS-IPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKGHSKLQRIP--FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKN-GSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFL--KHGNFWYKADDDSVRKCE 1242
            V L N G  CYMN+ +Q++ F   L L+  +   E D S +   +      LQ   ++ +F   P+        +  +    WE ++     D  EFL   LDKL  ++KG      IP  FE    S   C N    N+ +     D  L +   KN+ E  ++Y+  E +EG N  +  V     AS  V+F+  P  L + + RF       +  K NDR    E I +  Y ++ +     Y L +V+ H+G    GHY  F+  K    W+K DDD V  C 
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLS-----LQRVFHELQFGDRPV------GTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVD-YNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCR 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|O74442|UBP16_SCHPO (Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.130e-12
Identity = 81/299 (27.09%), Postives = 134/299 (44.82%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSI----PICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIPFEAAHDSRYF---------CNNCGKSNNDKPNIVVDQVLFVSV---GKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCELE 1248
            L+N G  C+MN+ +Q +    P + YL + + ++   +   C    + + + +AY N+         P  I  QS L+  S        EDAHEF+   +D   +  L+ H  L     E +   R F         C+ C      KP+     +L +SV   G ++ + +++++  E       + CENC+ +   AS ++     P  L +  KRF T + +Q+ KI+ +I   E   + PY SD       Y L+ V+ H G S + GHY++F K  N  W K DDD V    ++
Sbjct:  127 LVNLGNTCFMNSVLQLMTQTPPLVQYLLSGQHSLSC-RMNACVLCRMEQHVARAYPNKGTKRASAFKPSGI--QSMLKVISSHFRPYRQEDAHEFMRYLVDAWQKSCLQNHKNLDHPSRETSVVHRIFGGYLRQQILCSVC-----KKPSNTYQALLDLSVDAKGSSLADSLKHFVHAEKLTKQNKYRCENCK-QLVDASKQMTIYRAPNILTIHFKRF-TFNGFQSSKISKQISYPESFNLGPYMSDPNC-SCWYELIGVLVHAGGSTRSGHYYSFCKSSNGVWLKFDDDFVSNSSID 414          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|B1AQJ2|UBP36_MOUSE (Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.606e-12
Identity = 78/286 (27.27%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G++KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGGFCMLCLMQNHMVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9P275|UBP36_HUMAN (Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4)

HSP 1 Score: 73.1738 bits (178), Expect = 3.678e-12
Identity = 79/286 (27.62%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  124 LHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0EB12 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00025213001 PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.665e-19
Identity = 88/322 (27.33%), Postives = 155/322 (48.14%), Query Frame = 1
Query:  415 KLSPVPLINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGA-IILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQR---------------------IPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVS---VGKNMTEMIENYLKDEV--EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1299
            +L  V L N    CY+N+A+Q     LL ++++ E I   Q ++    ++  + LL+       FS    I  QS  E  S +  +   +D+HEFL  +L K+ EEL G  K ++                       F     S+ FC +C +      + + D  L +S    G ++ + +++Y ++EV  + + C+ C+  N S    +  S+ P+YL++  KRF T  +  ++KIND I   E ++I  +   K L+ KY+L +++ H GS+  GHY  + +  + WY  DD++V K      K +S  S Y+ +++K
Sbjct:  263 QLPIVGLRNPRYYCYLNSALQ----VLLSIDSLSEGILAVQPKQGQKYLVAYQELLRTIKRSGSFS---AIAAQSVWENCSGKFQFNQQQDSHEFLLFFLGKIQEELVGKYKNKQEFNSAEQAWSDYTSKNYDIVDTIFAGQSTSQSFCKSCNQVCEGY-DPIWDLSLPISKSYTGVDLMDCLKSYYREEVINDTWKCDKCKKTNKSVKRRMFISQTPKYLIIQFKRFTT--FPTSQKINDSISYPEKLDI-QEFCSKGLQTKYKLKALITHMGSINGGHYKAYAERYDNWYLFDDETVSKIN---GKQLSDRSAYVLLYQK 570          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A091N367 (Ubiquitin carboxyl-terminal hydrolase 36 (Fragment) OS=Acanthisitta chloris OX=57068 GN=N310_00584 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.465e-16
Identity = 81/292 (27.74%), Postives = 129/292 (44.18%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELE 1248
            L N G  C++N+A+Q +    P   YL + +          C    +    +QA+ N      P+ +     L+  S  L +   EDAHEFL   +D + +  L G++KL R           F     SR  C+ C K+ +D  +  +D  L V    N+   +E +++ E  G    + C  C  K  SAS           L + +KRF + S  + +KI   +   E ++I PY S+ K     Y L +V+ H+G S   GHYF ++K  N  WY+ +D  VR   ++
Sbjct:   34 LSNLGNTCFLNSALQCLTYTPPLTNYLLSREHGRTCAHGSFCMMCTMQNHTIQAFANSGNAIKPLSVIR--DLKKISHNLQFGRQEDAHEFLRYTIDAMQKACLNGYTKLDRQTQATTLVHQIFGGYLRSRVKCSEC-KTVSDTYDPYLDMTLEVERAANVVRALELFVRPEQLGGENAYMCGKCR-KKVSASKRFTIHRASNVLTISLKRFGSCSTSRGRKITKDVGYPEYLDIRPYMSEPKGDPVAYGLYAVLVHSGYSCNAGHYFCYVKASNGQWYQMNDHEVRPSNIK 321          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A093BZT1 (Ubiquitin carboxyl-terminal hydrolase 42 (Fragment) OS=Pterocles gutturalis OX=240206 GN=N339_03396 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.436e-16
Identity = 79/278 (28.42%), Postives = 132/278 (47.48%), Query Frame = 1
Query:  451 NCYMNAAIQSIFPALLYLNTIKE-TIEYDQSQEC-GAIILMESLLQAYINQEEFSIPICIYEQ---SSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLK----DEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSVRKCELE 1248
            N Y    + SI   L Y   +    +  + SQ C      M  +L+A++N+   S    I+     S+L +          EDAHEFL C +D ++ E    + + +I F     SR  C +C K+ +D     +D +L +  G ++T  +E++++    D   G+ C  C  +  +AS  +        L VC+KRF   S     KIN  +   E +++  Y S+    +  Y L +V+ H GS  + GHY+ F+K G+  WY+ +DDSVR C+++
Sbjct:   32 NLYNTCFLNSILQCLTYTPPLANYLLSREHSQTCCQQGFCMMCVLEAHVNEALNSSGTAIWPTAVLSALRWIGAHFQLGRQEDAHEFLRCTVDAISYE--APTVVHQI-FGGELRSRVTCFSC-KAVSDTYEPFLDILLDIKAGSSVTGALEDFVRPEQLDGKNGYRCSKCG-ELATASKRLTIYRSSNVLTVCLKRFDAFS---GTKINKVVEYPEHLDLGAYMSEASEERPLYSLYAVLVHEGSGCQAGHYYCFVKAGDGQWYQMNDDSVRLCDIK 301          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A2T0FDV1 (Ubiquitin carboxyl-terminal hydrolase 10 OS=Wickerhamiella sorbophila OX=45607 GN=B9G98_00781 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 8.532e-16
Identity = 93/317 (29.34%), Postives = 149/317 (47.00%), Query Frame = 1
Query:  421 SPVPLINHGVNCYMNAAIQSIF--PAL-LYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELS-WENMEDAHEFLNCYLDKLNEE--LKG---HSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSV----GK-NMTEMIENYLKDEV------EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            +PV L N GV CYMNAA+Q +F  PA+  YL  + +  +++  +       +  L +     ++ S          LE  +  +S WE  ED+HE+L   L +L E+   KG    S +    F    + +  C NCG  +    +     V F       GK  +++ +E++   EV      EG+ CE C+ +   A  +    + P+YL V IKRF   S    +K+ D++     +++  Y   ++ L  +Y LV V+ H G +L  GHY   +K  N  WY+ DDD VRK    Y+K  +  + YI V+ +L
Sbjct:  156 APVGLENRGVTCYMNAAMQLLFHLPAIGRYLVEVSQG-KHNNVKTSSVTAELAKLFRRLTEGKKKSSVYPTRMIQRLEDINCMMSEWEQ-EDSHEYLMSLLGRLQEDSTPKGEKLRSSIMHDIFGGTVEQQVTCRNCGHVSTTNQDFYDIPVSFSRSERKQGKYTLSQSVEDFFSPEVIKPKDKEGYQCEKCK-QITKAIKQNAIQDAPEYLTVHIKRF-KFSGSLGQKVKDQMLYPLDLDLTAYSKTEEPL--RYSLVGVIVHEGRTLSSGHYIAIVKQPNMKWYEYDDDIVRKVSDSYVK--NQENAYILVYSRL 464          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A550CTT1 (Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Auriculariopsis ampla OX=97359 GN=BD626DRAFT_394782 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.184e-15
Identity = 82/301 (27.24%), Postives = 145/301 (48.17%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF--PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFL---------NC---YLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYL-KDEVEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHT-GSLKRGHYFTFLKHG-NFWYKADDDSVRKCELEYMKMISTY 1272
            L+N G  C+MN+A+Q +F  P LL + +         +  C    +  + ++A  ++  FS P  I     L  F+  L     ED+HEFL         +C   Y  K++ +L   S + ++ F     SR  C +CG  N+D  + ++D  L +   K++ + + +++  D ++G   + C+NC+ K  +A      ++ P  L V +KRF+        K+ + I  DE + + PY S+ +    +Y L  VV H+ G    GHY++F+K     WY+ +D+SV  C+  Y  + + Y
Sbjct:  122 LLNTGNTCFMNSALQCLFHTPPLLRMLSAHTRDNCKTTGFCMTCCMKVTAMRAQSSKSAFS-PDAITRH--LRVFAKSLRHGRQEDSHEFLRHAIEGLQKSCLAGYPPKIDPKLAETSWVHQL-FGGQLRSRVHCKSCGH-NSDTFDSILDLSLDIHRMKDLKDALRSFVAPDHLKGTDKYKCDNCK-KYVNAEKRFTINKAPLVLTVHLKRFSPFG----GKLTNLIEYDEHVSLKPYMSEGE-FGPRYSLYGVVCHSGGGPNSGHYYSFVKSKQGRWYEMNDESVTPCQKPYPVLKTAY 411          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000052072.1 (ubiquitin carboxyl-terminal hydrolase 17-like protein 13 [Source:NCBI gene;Acc:111194559])

HSP 1 Score: 80.1073 bits (196), Expect = 2.325e-15
Identity = 72/280 (25.71%), Postives = 124/280 (44.29%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE--VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSLKR-GHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C+MN+ +Q +    P   Y+ + +      +   C +  L   +    +N     +P  +  Q  L     +  +   EDAHEFL   +  L +       L R        FE    SR  C NC KS++D     +D  L ++  K++ E ++ ++K E   +G+ C  C V    AS  +        L +C+KRF     +  +KI+  +   + +++ P+ S+ +   Q Y+L +V+ H G  +  GHY+ ++K  +  WYK DD  V
Sbjct:   24 LWNVGNTCFMNSVLQCLSYTAPLANYMLSGEHLRTCSRYSFCMSCTLQNHITHTIMNSGTAIVPASVVTQ--LNLIGEQFCFGQQEDAHEFLRYTVRALQQSYPDGKMLGRETNLINQIFEGCMRSRVKCLNC-KSDSDTFEPYMDVALDITGAKDLNESLQRFVKPEQLSDGYKCTRCMV-TSPASKTLTIHRSSNVLTICLKRFD----FNGQKISTLVKYPKHLDMRPFMSESEGESQVYKLYAVLVHAGYNRHFGHYYCYVKASDRKWYKMDDKQV 295          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000051328.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6147300:6154718:-1 gene:ENSAMXG00000034576.1 transcript:ENSAMXT00000051328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.036e-14
Identity = 72/285 (25.26%), Postives = 134/285 (47.02%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDK----------LNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVL--KQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ +Q +    P   Y+ + + +      + C    + +   Q + N     IP+ +   S L   S +      EDAHEF +  +            L+ E +G + +++I FE    SR  C +C ++ +D     +D  L +   +++T+ +  +++ E ++G+ C  C +K   AS           L +C+KRF   ++Y   KI+  +     +++ P+ SD      +Q Y+L +V+ H+GS  + GHY+ ++K G+  WYK DD  V
Sbjct:   40 LWNLGNTCFLNSVLQCLTYTPPLANYILSGEHSNTCFSPESCITCSIQKHFTQVFANPGTVIIPVDMV--SKLTLISEQFCLGQQEDAHEFFSYTVSALEQSCLNRNMLDRETEGTNLIKQI-FEGCMRSRVKCLSC-RAESDTFEPYMDVALDIREAEDLTDALRQFVRSEQLDGYKCNVC-MKTSPASKTFAIFRSSNVLTICLKRF---NFY-GDKISKFVRYPTYLDMDPFMSDGGGSDERQTYKLYAVLVHSGSDCQIGHYYCYVKAGDSKWYKMDDSEV 315          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000047058.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6147300:6154718:-1 gene:ENSAMXG00000034576.1 transcript:ENSAMXT00000047058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.036e-14
Identity = 72/285 (25.26%), Postives = 134/285 (47.02%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDK----------LNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVL--KQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ +Q +    P   Y+ + + +      + C    + +   Q + N     IP+ +   S L   S +      EDAHEF +  +            L+ E +G + +++I FE    SR  C +C ++ +D     +D  L +   +++T+ +  +++ E ++G+ C  C +K   AS           L +C+KRF   ++Y   KI+  +     +++ P+ SD      +Q Y+L +V+ H+GS  + GHY+ ++K G+  WYK DD  V
Sbjct:   40 LWNLGNTCFLNSVLQCLTYTPPLANYILSGEHSNTCFSPESCITCSIQKHFTQVFANPGTVIIPVDMV--SKLTLISEQFCLGQQEDAHEFFSYTVSALEQSCLNRNMLDRETEGTNLIKQI-FEGCMRSRVKCLSC-RAESDTFEPYMDVALDIREAEDLTDALRQFVRSEQLDGYKCNVC-MKTSPASKTFAIFRSSNVLTICLKRF---NFY-GDKISKFVRYPTYLDMDPFMSDGGGSDERQTYKLYAVLVHSGSDCQIGHYYCYVKAGDSKWYKMDDSEV 315          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000052035.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6147300:6154718:-1 gene:ENSAMXG00000034576.1 transcript:ENSAMXT00000052035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 6.144e-14
Identity = 72/285 (25.26%), Postives = 134/285 (47.02%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDK----------LNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVL--KQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+ +Q +    P   Y+ + + +      + C    + +   Q + N     IP+ +   S L   S +      EDAHEF +  +            L+ E +G + +++I FE    SR  C +C ++ +D     +D  L +   +++T+ +  +++ E ++G+ C  C +K   AS           L +C+KRF   ++Y   KI+  +     +++ P+ SD      +Q Y+L +V+ H+GS  + GHY+ ++K G+  WYK DD  V
Sbjct:   40 LWNLGNTCFLNSVLQCLTYTPPLANYILSGEHSNTCFSPESCITCSIQKHFTQVFANPGTVIIPVDMV--SKLTLISEQFCLGQQEDAHEFFSYTVSALEQSCLNRNMLDRETEGTNLIKQI-FEGCMRSRVKCLSC-RAESDTFEPYMDVALDIREAEDLTDALRQFVRSEQLDGYKCNVC-MKTSPASKTFAIFRSSNVLTICLKRF---NFY-GDKISKFVRYPTYLDMDPFMSDGGGSDERQTYKLYAVLVHSGSDCQIGHYYCYVKAGDSKWYKMDDSEV 315          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp36 (ubiquitin specific peptidase 36 [Source:ZFIN;Acc:ZDB-GENE-030131-5450])

HSP 1 Score: 65.855 bits (159), Expect = 9.792e-11
Identity = 71/272 (26.10%), Postives = 117/272 (43.01%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQ--SIFPALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLK 1191
            L N G  C++N+ +Q  +  P L  YL + + +    QS  C   I+   ++QA+ N      P+       L+  +    + + EDAHEFL   +D + +  L G+ KL R           F     SR  C+ C KS +D  +  +D  + +    N+   +E ++K +V      + C  C+ K   A+           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K
Sbjct:  124 LHNLGNTCFLNSTVQCLTYTPPLANYLLSKEHSRACHQSGFCMICIMQNHIIQAFANTGNAIKPVSFIRD--LKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGYPKLDRQTQATTLVHQIFGGYLRSRVKCSIC-KSVSDTYDPYLDIAVEIRQAANIVRALELFVKPDVLSGENAYMCAKCK-KKVPATKRFTVHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVK 388          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008243.1 (pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 gene:ENSPMAG00000007452.1 transcript:ENSPMAT00000008243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 3.902e-7
Identity = 37/131 (28.24%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  925 CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHG--NFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 1308
            C +C+ +  S  +  ++ +LP  L++ +KRF+    ++ K + N    +  +   PY  +      +Y L +V NH GSL  GHY  +  +   + W+K DD  V   E  Y K +ST + YI  +  L +
Sbjct:  306 CSHCKQRRESVKTMEIW-KLPPVLIIHLKRFSYSGRWKQKLQTNVGFPLTSLDMKPYIINKDNRYSEYNLYAVSNHYGSLDGGHYTAYTHNTVRDSWFKFDDHEV---EFIYPKNVSTSAGYILFYSALPQ 432          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp12a (ubiquitin specific peptidase 12a [Source:NCBI gene;Acc:565736])

HSP 1 Score: 47.7506 bits (112), Expect = 3.942e-6
Identity = 36/109 (33.03%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  919 FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGS-LKRGHYFTFLKHGNFWYKADDDSVRK 1236
            + CE C  K   A   +   +LP  L + +KRF      ++  K++ R+     + +   S D     + Y LV+VV H GS   RGHY T +K   FW   DDD V K
Sbjct:  234 YYCEQCCSKQ-EAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEK 341          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 46.9802 bits (110), Expect = 4.512e-6
Identity = 37/138 (26.81%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  871 NMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICID-EIIEIPYKSDDKVLK---------------QKYRLVSVVNHTGSLKRGHYFTFLK-HGNFWYKADD 1221
            ++T+ +  + + E  G      C  C     S + ++   +LP      +KRF  HS    KKI   +    E+   P+ +  K  +                KY L +VVNH G+L+ GHY +F++ H + W+K DD
Sbjct:  101 SLTDCLRRFTRPEYLGSSAKIKCSGCRSYQES-TKQLTMKKLPIVACFHLKRFE-HSAKLRKKITTYVSFPLELDMTPFMASSKESRVNGQHQVGGDALSSENKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDD 236          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP15 (Ubiquitin-specific protease involved in protein deubiquitination; forms a complex with AAA peroxins Pex1p and Pex6p; deubiquitinates mono- and polyubiquitinated forms of Pex5p; deubiquitinates Clb5p, counteracting APC activity, and facilitating both Clb5p accumulation and S phase entry; physically interacts with anaphase-promoting complex/cyclosome (APC/C) activator, Cdh1p; catalytic activity regulated by an N-terminal TRAF-like domain and and C-terminal sequences [Source:SGD;Acc:S000004920])

HSP 1 Score: 73.1738 bits (178), Expect = 6.207e-14
Identity = 78/295 (26.44%), Postives = 119/295 (40.34%), Query Frame = 1
Query:  439 NHGVNCYMNAAIQSIFPALLYLNTIKE-TIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKG---HSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNG----SASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK------------YRLVSVVNHTGSLKRGHYFTFLKHG--NFWYKADDDSVRKC 1239
            N G  CY+N+ +QS F    +   + E   E++       + L  +  Q  ++     IP+   E       +    W+  E     D  E     +D+L   +KG     KL  I F     S   C N    +    +   D  L V   KN+ E  +NY+  E+E  N EN           A   V+F   P  L + +KRF    +Y Q  K+ND+    E I++    D  VLK+             Y L  V+ H+G +  GHY+T +K G  + WY+ DD+ V + 
Sbjct:  209 NQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVS----DIPLDTLE------LTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGKLNEI-FVGKMKSYIKCINVDYESARVEDFW-DLQLNVKNFKNLQESFDNYI--EMELMNGENQYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRV 489          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 57.7658 bits (138), Expect = 2.117e-9
Identity = 73/319 (22.88%), Postives = 127/319 (39.81%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIFPALLYLNTIKETIEY--------DQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWE--------NMEDAHEFLNCYLDKLNE----ELKGHSKLQR-----------IPFEAAHDSRYFCNNCGKSNNDKPNI--VVDQVLFVSVGKNMTEMIENYLKDE-VEGFN--CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIP----------------YKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLK-HGNFWYKADDDSV 1230
            LIN G  C+M++ +Q +     ++      I          D+   C    ++  L  A   ++  S       Q+   Y  L  +W+        + +DAHEF    ++++++    +L    ++ R             FE + +S   C  C   NN K  I   +D  L +   K + E ++++ K E ++ FN  C  C      A  ++   +LP  LV+ +KRF        +K+      D+ IE P                +  + KV    Y L+ +V+H G++  GHY  F K  G  W+K +D  V
Sbjct:  139 LINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYL-LTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGC--QNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECN-STQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKL------DDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMV 447          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP7 (Ubiquitin-specific protease that cleaves ubiquitin-protein fusions; UBP7 has a paralog, UBP11, that arose from the whole genome duplication [Source:SGD;Acc:S000001418])

HSP 1 Score: 53.1434 bits (126), Expect = 1.066e-7
Identity = 45/140 (32.14%), Postives = 69/140 (49.29%), Query Frame = 1
Query:  922 NCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQ-TKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTF----LKHG-----NFWYKADDDSV---RKCELEYMKMISTYSCYIEVFEKL 1302
            N  + + K  +    + F  LP+ LV+ + RF    YY  TKK N  +    I+ I  K++D +   KY+L  VVNHTG+L  GHY +     L+H      + WY  DD+ V   RK   +    IS+   Y+  +E++
Sbjct:  937 NSSDYKNKKLTTVKTINFVTLPKILVIHLSRF----YYDLTKKNNTVVTYPLILNIILKNNDTM---KYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERV 1069          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP5 (Putative ubiquitin-specific protease; concentrates at the bud neck; UBP5 has a paralog, DOA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000946])

HSP 1 Score: 50.447 bits (119), Expect = 5.541e-7
Identity = 48/203 (23.65%), Postives = 85/203 (41.87%), Query Frame = 1
Query:  763 FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGK-NMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATH----------------SYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHG--NFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            F+  + SR  C  C  ++       V  V    V   N+ +    + K E  G    ++C  C +K   ++ ++  + LP+ L++ +KRF                   + Y  +  N    ++E  +IP +   +V   +YRL  V  H+GSL  GHY +++  G    WY  DD   R   + +     T S Y+  +E++
Sbjct:  609 FQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPRVKTCNILDCFREFTKCERLGVDEQWSCPKC-LKKQPSTKQLKITRLPKKLIINLKRFDNQMNKNNVFVQYPYSLDLTPYWARDFNHEAIVNE--DIPTRG--QVPPFRYRLYGVACHSGSLYGGHYTSYVYKGPKKGWYFFDDSLYR--PITFSTEFITPSAYVLFYERI 804          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO32736 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SU92])

HSP 1 Score: 85.8853 bits (211), Expect = 4.885e-18
Identity = 83/292 (28.42%), Postives = 136/292 (46.58%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSI-PICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLN--------EELKGHSKLQRIP---FEAAHDSRYFCNNC-GKSNNDKP--NIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCEL 1245
            L N G  C++N+ +Q +    P + YL T + T E      C    L   +L+ + +Q+  SI P+CI ++  L   +  L + + EDAHEFL   +D +         E++  +SK   I    F   + S+  C  C   SN   P   I+VD     SV + +  M +  L D    + C  C+ K   A  +V+    P  L + +KRF  H  +   K++  I   E +++ P+ ++ K    KY+L  V+ H+G S   GHY+ +++  N  WY  +D  VR+  L
Sbjct:   93 LSNLGNTCFLNSVVQVLTYTAPLVNYLATQEHTRECQMVGFCMMCELQRHILRTFNHQQNESIKPLCIIQR--LRSIAKHLRFGHQEDAHEFLRYVIDGMQKSCLAGQPEKMDRYSKETTIVHGIFGGYYRSQVQCLKCHNTSNTFDPLMEIMVDIKHSPSVVRAIQRMCKAELLDGDNLYQCPRCK-KKVPAHKQVLIHRPPNILTIQLKRFDYHHMF-GGKVSKEITYTEHLDLRPFMTNPKGPPLKYKLYGVLVHSGYSCNSGHYYCYVRGSNDCWYNMNDSMVRQVGL 380          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO42651 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7S0W3])

HSP 1 Score: 62.3882 bits (150), Expect = 2.470e-10
Identity = 79/300 (26.33%), Postives = 129/300 (43.00%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQ---SQECGAIIL--MESLLQAYINQEEFSIPICIYEQSSLEY-FSLELSWENMEDAHEFLNCYLDKLNEELK--GHSKLQRIP-------------FEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVC--IKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELE 1248
            LIN G  C+MN  +Q    AL +   +++    DQ     + G  ++  M  L Q + + ++  +P   ++   L +  +  L+    +DAHEF    LD L+   K     KL   P             F     S   C  C   S    P    D  L +  G +   +   + + E  G      C  C+    S + ++   +LP  +VVC  +KRF  HS  ++KKI+  I   + +++        L  KY L +VVNH+G+L+ GHY  F++  N W+K DD  + K  ++
Sbjct:  161 LINLGNTCFMNCIVQ----ALTHTPLLRDYFLSDQHNCKGDAGTCLVCEMGLLFQEFYSGQK--VPHSPFKLLHLVWTHARHLAGYEQQDAHEFFIAALDVLHNYCKEDAPDKLAVKPNNHNQCNCIIDRIFTGGLQSDVICQTCNCVSTTVDP--FWDISLDLGHGDHKLVIFCRFTRPESLGSESKIKCNKCQSYQES-TKQLSMRKLP--IVVCFHLKRFE-HSK-KSKKISTYIPFPQELDMA-----PFLSSKYSLFAVVNHSGTLEVGHYTAFIRQQNNWFKCDDAWITKATID 442          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44477 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVM0])

HSP 1 Score: 55.8398 bits (133), Expect = 2.196e-8
Identity = 42/109 (38.53%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  925 CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQT-KKINDRICIDEIIEIPYKSDDKVLK-QKYRLVSVVNHTGS-LKRGHYFTFLKHGNFWYKADDDSVRKCE 1242
            CE C  K   A   +   +LP+ L + +KRF      Q   K++ R+     + +   SDD V   Q Y LVSVV H GS   RGHY T +K   FW   DDD V K E
Sbjct:  249 CETCCTKQ-EAQKRMRVKKLPKLLALHLKRFKYMEQLQRYTKLSYRVVFPFELRLFNTSDDAVNNDQLYDLVSVVIHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIE 356          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO35056 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SMM5])

HSP 1 Score: 55.4546 bits (132), Expect = 5.859e-8
Identity = 60/262 (22.90%), Postives = 109/262 (41.60%), Query Frame = 1
Query:  592 NQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIV--VDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQ-TKKINDRICIDEIIEI-PY------KSDDKVLKQ---------------------KYRLVSVVNHTGSLKRGHYFTFLKH---------GNFWYKADDDSVRKCELE 1248
            +Q +F IP   ++  + ++    ++     DA EF N  LD L+E +K  G+  +       +   +  C  C  + + + P I   VD     S+  +M + ++  L +    ++CE C+ K  +    +  S+LP+ + + +KRF      +   K ND       I++ PY      K++ K L Q                      YRL  ++ H+G    GHY+ ++            + WYK DD  V +C++E
Sbjct: 1666 SQLQFHIPKGFWK--TFKFLGEPVNLREQHDALEFFNNLLDNLDEGMKVLGNEPIFSKVLGGSFADQKICKGCPHRYSREAPFIALNVDIRNHQSLHDSMEQFVKGDLLEGANAYHCEKCDKKVDTV-KRMCISKLPRVMAIQLKRFDYDWERECAVKFNDYFEFPREIDMEPYTELGLAKAEGKALDQIPPELVAESEKHDPPPQALSTHYRLRGILVHSGQASGGHYYCYILQRYCILLSDDSHRWYKFDDGDVSECKME 1924          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO37466 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SFT1])

HSP 1 Score: 52.7582 bits (125), Expect = 2.395e-7
Identity = 85/367 (23.16%), Postives = 136/367 (37.06%), Query Frame = 1
Query:  334 ESREHLNATKERETEDLQNMASDHFEVKLSPVP-LINHGVNCYMNAAIQSIFPALLYLNTIKET----IEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLE----LSWE--------NMEDAHEFLNCYLDKLNEELK-------GHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVL-----------------FVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDK---VLKQK---------YRLVSVVNHTGS-LKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTY 1272
            ++RE  NA K+R     + + +     ++  +P L N G  C+MNA +QS+     +    K+     +  D S E                 EE    +C   Q +    S E      W+          +DAHEF++  +D+L+ EL        G   +    F     S   C  C  + + K +  +D  L                 F  +   M   +      E E + C  C+ K  S + +     LP  L + +KRF   ++ ++K       ID  ++ P +  D     LK +         Y L +VV H GS +  GHY TF  H   WY  +D SV + + E +     Y
Sbjct:   76 QNREAENAKKKRLISRTRFLRNQQNIGRIKQLPGLRNLGNTCFMNAVLQSLSNIQTFSCYFKDLPAFELRTDTSCEKNPYFTRSRKSDDGCLVEELRKVLCALWQGNCVSHSPEALFSTVWKVVPRFRGYQQQDAHEFMHYLMDRLHTELLLSQKACFGQDTIVTGIFGGILQSEVTCLTC-MTESRKLDPFLDLSLEIPPEFQTRKAKSRENPFCQLEDCMKHFVALEKLAESELYMCLKCKKKEQS-TKKFWIQRLPNVLCLHLKRFRFQAFLRSK-------IDTYVQFPIRGLDMSPYTLKGQEKGETKPVLYDLAAVVVHHGSGVSAGHYTTFAFHDGAWYNFNDSSVSRIDEEMVAKCKGY 433          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 81.2629 bits (199), Expect = 8.853e-16
Identity = 74/285 (25.96%), Postives = 129/285 (45.26%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQE---CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+A+Q +       N +         QE   C    +   ++Q + N      PI +  +  L+  +    + + EDAHEFL   +D + +     +KL R           F     SR  C +C K+ +D  +  +D  L + +  ++++ +E ++K E ++G   + C  C+ K  +AS        P  L + +KRFA    +   KI   +   E +++ P+ S  +   Q Y L +V+ H+G S   GHYF ++K  N  WY+ +D SV
Sbjct:   98 LQNMGNTCFLNSALQCLTYTPPLANHMLSREHSKTCQEPGFCMMCTMQNHIIQVFANSGNVIKPIGVLNE--LKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQTQATTFIHQVFGGYLRSRVKCLSC-KAVSDTFDPFLDITLEIKMAPSVSKALEQFVKPEQLDGENAYKCTKCK-KMVTASKRFTIHRSPNVLTLSLKRFAN---FTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSV 375          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 78.1814 bits (191), Expect = 1.357e-14
Identity = 74/285 (25.96%), Postives = 129/285 (45.26%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECG---AIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+A+Q +       N +         QE G      +   ++Q + N      PI +  +  L+  +    + + EDAHEFL   +D + +     +KL R           F     SR  C +C K+ +D  +  +D  L + +  ++++ +E ++K E ++G   + C  C+ K  +AS        P  L + +KRFA    +   KI   +   E +++ P+ S  +   Q Y L +V+ H+G S   GHYF ++K  N  WY+ +D SV
Sbjct:  115 LQNMGNTCFLNSALQCLTYTPPLANHMLSREHSKTCQEPGFCMMCTMQNHIIQVFANSGNVIKPIGVLNE--LKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQTQATTFIHQVFGGYLRSRVKCLSC-KAVSDTFDPFLDITLEIKMAPSVSKALEQFVKPEQLDGENAYKCTKCK-KMVTASKRFTIHRSPNVLTLSLKRFAN---FTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSV 392          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 78.1814 bits (191), Expect = 1.373e-14
Identity = 74/285 (25.96%), Postives = 129/285 (45.26%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECG---AIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1230
            L N G  C++N+A+Q +       N +         QE G      +   ++Q + N      PI +  +  L+  +    + + EDAHEFL   +D + +     +KL R           F     SR  C +C K+ +D  +  +D  L + +  ++++ +E ++K E ++G   + C  C+ K  +AS        P  L + +KRFA    +   KI   +   E +++ P+ S  +   Q Y L +V+ H+G S   GHYF ++K  N  WY+ +D SV
Sbjct:  115 LQNMGNTCFLNSALQCLTYTPPLANHMLSREHSKTCQEPGFCMMCTMQNHIIQVFANSGNVIKPIGVLNE--LKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQTQATTFIHQVFGGYLRSRVKCLSC-KAVSDTFDPFLDITLEIKMAPSVSKALEQFVKPEQLDGENAYKCTKCK-KMVTASKRFTIHRSPNVLTLSLKRFAN---FTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSV 392          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp36 (ubiquitin carboxyl-terminal hydrolase 36 [Source:NCBI gene;Acc:101172817])

HSP 1 Score: 68.5514 bits (166), Expect = 1.392e-11
Identity = 76/312 (24.36%), Postives = 133/312 (42.63%), Query Frame = 1
Query:  433 LINHGVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 1308
            L N G  C++N+ +Q +    P   YL + + +    QS  C   ++   ++Q + N      P+       L+  +    + + EDAHEFL   +D + +  L G+ KL R           F     SR  C+ C KS +D  +  +D  + +    N+   +E ++K +V      + C  C+ K   A+           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V+   +   K++     Y+  + ++ E
Sbjct:  124 LHNLGNTCFLNSTVQCLTYTPPLANYLLSKEHSRTCHQSGFCMICVMQNHIIQTFANTGNAIKPVSFIRD--LKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGYPKLDRQTQATTLVHQIFGGYLRSRVKCSIC-KSVSDTYDPYLDIAVEIRQTANIVRALELFVKPDVLSGENAYMCAKCK-KKVPATKRFTVHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYIKASNGQWYQMNDSMVQSSNI---KVVLNQQAYVLFYLRIPE 425          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: USP24 (ubiquitin specific peptidase 24 [Source:NCBI gene;Acc:101168776])

HSP 1 Score: 67.0106 bits (162), Expect = 3.997e-11
Identity = 77/317 (24.29%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  427 VPLINHGVNCYMNAAIQSIF--PALLYLNTIKETIEYDQSQECGAII---------LMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV-EGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEI-PYKSDDK--------------------------VLKQKYRLVSVVNHTGSLKRGHYFTFLK----HGNFWYKADDDSV 1230
            V L N G  CYMNA  Q ++  P    L     +IE D  Q   ++          LMES LQ Y+ +  + I          + ++ EL     +DA+EF    +D+L+E LK  G  ++ +  F+     +  C +C     ++  + ++  L V+  +++   ++ +++ EV EG N   CE C+ K  +     + S LP  L + + RF       ++ K +++I    ++ + PY                                + + Y LV VV H+G    GHY++F+K        WYK +D+ V
Sbjct: 1675 VGLKNGGATCYMNAVFQQLYMQPG---LPEAVLSIEDDTDQPEESVFHQVQSLFGHLMESKLQYYVPENFWKI---------FKMWNRELYVREQQDAYEFFTSLVDQLDEHLKKIGREQIFKNTFQGIFSDQKICKDCPHYEREETFMALN--LGVTSCQSLEISLDQFVRGEVLEGSNAYYCEKCKEKRTTVKRTCIKS-LPSVLCIHLMRFGFDWESGRSIKYDEQIRFPWVLNMEPYTVSGMARQDCGGEGGEGRGDGASGGSPRKKVTISENYELVGVVVHSGQAHAGHYYSFIKDRGSSRGRWYKFNDNMV 1976          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068529.1 (SMESG000068529.1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 356/407 (87.47%), Postives = 375/407 (92.14%), Query Frame = 1
Query:   82 MAFDNNQEGQFIYNFENGNTFDIFKGLQKEDGHFECIIIVSEPDLHKANMVDECNGNNCLEIITDNNSNFEYLKFDCSSDQRAAESREHLNATKERETEDLQNMASDHFEVKLSPVPLINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            MAFDNNQEGQFIYNFENGNTFDIFKGLQ EDGHFECIIIVSEPDLHKAN+VDECNGNNCLEIITDNNSNFEYLKFDCSS QRAAESREHLNATKERETEDLQNMASDHFEVKLSPVPLINHGVNCYMNAAIQSIFPA+LYLNTIKETIEYDQS ECGAIILME LL+AY N E+FSIPICI+  S LEYFS ELSW+ MEDAHEFLNCYLDKLNEELKGHSKLQ+ PFEAAHDSRYFCNNCGKSNNDKPNI V+QVLFV+VGKNMTEMIEN  K+EVEGF+CENC VKNGSAS EVVFS+LPQYLVVCIKRFA  S YQ+ KINDRICIDE IEIPYKSDDKVLKQKYRLVSVVNH G L+ GHYFTFLKHGNFWYKADD SV+K E + ++ +S YS YIEVFEKL
Sbjct:    1 MAFDNNQEGQFIYNFENGNTFDIFKGLQTEDGHFECIIIVSEPDLHKANIVDECNGNNCLEIITDNNSNFEYLKFDCSSVQRAAESREHLNATKERETEDLQNMASDHFEVKLSPVPLINHGVNCYMNAAIQSIFPAMLYLNTIKETIEYDQSPECGAIILMERLLRAYTNDEDFSIPICIFTNSKLEYFSSELSWDTMEDAHEFLNCYLDKLNEELKGHSKLQKTPFEAAHDSRYFCNNCGKSNNDKPNIAVEQVLFVNVGKNMTEMIENSFKNEVEGFSCENCGVKNGSASREVVFSDLPQYLVVCIKRFAIDS-YQSIKINDRICIDETIEIPYKSDDKVLKQKYRLVSVVNHIGGLENGHYFTFLKHGNFWYKADDHSVQKYEFKNIEGVSNYSSYIEVFEKL 406          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068557.1 (SMESG000068557.1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 335/416 (80.53%), Postives = 360/416 (86.54%), Query Frame = 1
Query:   82 MAFDNNQEGQFIYNFENGNTFDIFKGLQKEDGHFECIIIVSEPDLHKANMVDECNGNNCLEIITDN---NSNFEYLKFDCSSDQRAAESREHLNATK---ERETEDLQNMASDHFE-VKLSPVPLINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 1308
            MAF+N Q+   +Y  +N N F+IFK  QKE+ H + + I   P+    NMV+ECN NN  E ITDN   ++N  Y + +  SD +  +  E  N+T    E ET ++QNMAS+  E +  +PVPL NH VNCYMNAAIQSIFPALLYLNTIKETIEYD+SQECGAIILMESLLQAY+N EEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQR PFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQT+KINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE
Sbjct:    1 MAFNNKQDKLSVY--KNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVEECNKNNLSEYITDNLSDSNNLSYSRSNSCSDPKTPKHSE--NSTTLLLEMETNEIQNMASNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDKSQECGAIILMESLLQAYVNYEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRTPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTRKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 412          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068574.1 (SMESG000068574.1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 276/398 (69.35%), Postives = 312/398 (78.39%), Query Frame = 1
Query:  118 YNFENGNTFDIFKG---LQKEDGHFECIIIVSEPDLHKANMVDECNGNNCLEIITDNNSNFEYLKFDCSSDQRAAESREHLNATKERETEDLQNMASDHFE-VKLSPVPLINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1299
            +N + GN  +I K    L K +GH     + SE D    N VDE N +N  +  TD  S+F   KF  S +       +  +A  +RET D+QN AS+  E +   PV L NH VNC +NAAI  IFPALLYLNTIKETIEYDQSQECGAIILMESLLQAY NQEEFSI  CIYE+SSLEYFSLEL  ENMEDAH FLN YL +LNEELKGHS+LQ+ PFEAAHDSRYFCNNCGKSNNDKPNIVVDQ+LFVSVGKNMTEMIENYL +EVE FNCENCEVKNGSASSEVVFS++PQYLVVCIKRFATHSYYQT+KIN+RICIDE IEIPYKSDDKVLKQKYRLVSVVNH G ++   Y +FLK G+FWYK +DD+V+K +LE +K IS +SCYIEVFEK
Sbjct:    3 FNNDQGNIQNISKSSKNLPKAEGHSGTTNLNSEQDFVDENTVDEDNKDNFSKKRTDCKSDF---KFSTSDESSTESGEDSNDAMGKRETNDIQNTASNQSEELDHDPVSLTNHRVNCSINAAIHCIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYTNQEEFSILNCIYEKSSLEYFSLELLLENMEDAHVFLNNYLYRLNEELKGHSQLQKTPFEAAHDSRYFCNNCGKSNNDKPNIVVDQILFVSVGKNMTEMIENYLNNEVERFNCENCEVKNGSASSEVVFSDIPQYLVVCIKRFATHSYYQTRKINERICIDETIEIPYKSDDKVLKQKYRLVSVVNHIGGVEGEQYLSFLKLGDFWYKTEDDNVQKYKLEDVKNISEHSCYIEVFEK 397          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068529.1 (SMESG000068529.1)

HSP 1 Score: 478.019 bits (1229), Expect = 9.576e-168
Identity = 233/281 (82.92%), Postives = 251/281 (89.32%), Query Frame = 1
Query:  460 MNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1302
            MNAAIQSIFPA+LYLNTIKETIEYDQS ECGAIILME LL+AY N E+FSIPICI+  S LEYFS ELSW+ MEDAHEFLNCYLDKLNEELKGHSKLQ+ PFEAAHDSRYFCNNCGKSNNDKPNI V+QVLFV+VGKNMTEMIEN  K+EVEGF+CENC VKNGSAS EVVFS+LPQYLVVCIKRFA  S YQ+ KINDRICIDE IEIPYKSDDKVLKQKYRLVSVVNH G L+ GHYFTFLKHGNFWYKADD SV+K E + ++ +S YS YIEVFEKL
Sbjct:    1 MNAAIQSIFPAMLYLNTIKETIEYDQSPECGAIILMERLLRAYTNDEDFSIPICIFTNSKLEYFSSELSWDTMEDAHEFLNCYLDKLNEELKGHSKLQKTPFEAAHDSRYFCNNCGKSNNDKPNIAVEQVLFVNVGKNMTEMIENSFKNEVEGFSCENCGVKNGSASREVVFSDLPQYLVVCIKRFAIDS-YQSIKINDRICIDETIEIPYKSDDKVLKQKYRLVSVVNHIGGLENGHYFTFLKHGNFWYKADDHSVQKYEFKNIEGVSNYSSYIEVFEKL 280          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068562.1 (SMESG000068562.1)

HSP 1 Score: 420.239 bits (1079), Expect = 2.427e-143
Identity = 226/382 (59.16%), Postives = 270/382 (70.68%), Query Frame = 1
Query:  154 KGLQKEDGHFECIIIVSEPDLHKANMVDECNGNNCLEIITDNNSNFEYLKFDCSSDQRAAESREHLNATKERETEDLQNMASDHFEVKLSPVPLINHGVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1299
            K L K +GH E   + SE D    N VDE N +N  +  T   S+F   KF  S +       +  +A  ERET D+QN A    E KL+P   IN  V   MNAAIQSIFPA+ Y NTIKETIEYDQS +CGAIILME+LLQAY N  EFSI  CIY+  S EY+S      NMEDAHEFL CYL KLNEELKGHSKL++ PFE A+D +YFCNNCGKS +D PNI +++V FV+VGKNM EMIEN LK+E E + CE C++KNGS S + VFSE+PQYL++ I RF   S     + ND+I  DEIIEIPYKSDDKVLKQKYR+VSVVNH GS + G+Y +FLK G+FWYK D+DS++KCELE +K IS +SCYIEVFEK
Sbjct:   18 KSLPKAEGHNETTNLNSEQDFVDENTVDEDNKDNFSKKRTGCKSDF---KFSTSDESSTESGEDSNDAMGERETNDIQNTADRQLEPKLNPFSFINKKVYNSMNAAIQSIFPAMFYWNTIKETIEYDQSPDCGAIILMETLLQAYTNDREFSISNCIYKNCSFEYYSSGYMCLNMEDAHEFLRCYLYKLNEELKGHSKLKKTPFEVAYDLKYFCNNCGKSIDDDPNIDINEVFFVNVGKNMIEMIENSLKNEKELYYCEICQLKNGSKSRKFVFSEIPQYLIIYIFRFILFS---NIEYNDKIPFDEIIEIPYKSDDKVLKQKYRMVSVVNHIGSFENGYYLSFLKLGDFWYKTDEDSLQKCELEDVKNISEHSCYIEVFEK 393          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC022966.12.091e-1427.27ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.16.285e-1327.62ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.17.659e-1327.62ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.17.659e-1327.62ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.17.659e-1327.62ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp-39.090e-1121.89Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;... [more]
usp-462.249e-732.50Ubiquitin carboxyl-terminal hydrolase 46 [Source:... [more]
usp-462.680e-732.50Ubiquitin carboxyl-terminal hydrolase 46 [Source:... [more]
usp-462.680e-732.50Ubiquitin carboxyl-terminal hydrolase 46 [Source:... [more]
usp-332.750e-725.56Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp72.462e-1428.57gene:FBgn0030366 transcript:FBtr0073641[more]
Usp72.681e-1428.57gene:FBgn0030366 transcript:FBtr0342732[more]
faf6.069e-1024.89gene:FBgn0005632 transcript:FBtr0307548[more]
faf6.069e-1024.89gene:FBgn0005632 transcript:FBtr0339189[more]
faf6.162e-1024.89gene:FBgn0005632 transcript:FBtr0085844[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp362.449e-1325.64ubiquitin specific peptidase 36 [Source:ZFIN;Acc:Z... [more]
usp422.817e-1224.91ubiquitin specific peptidase 42 [Source:ZFIN;Acc:Z... [more]
usp422.817e-1224.91ubiquitin specific peptidase 42 [Source:ZFIN;Acc:Z... [more]
usp487.118e-1126.16ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
usp481.322e-1026.16ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000030414.11.916e-1426.23pep primary_assembly:Xenopus_tropicalis_v9.1:5:124... [more]
ENSXETT00000031190.12.140e-1426.23ubiquitin carboxyl-terminal hydrolase 42-like [Sou... [more]
rpl7l13.313e-1426.89ribosomal protein L7 like 1 [Source:Xenbase;Acc:XB... [more]
ENSXETT00000014911.15.939e-1426.23pep primary_assembly:Xenopus_tropicalis_v9.1:5:124... [more]
eif1b8.637e-1125.60eukaryotic translation initiation factor 1B [Sourc... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp363.726e-1327.27ubiquitin specific peptidase 36 [Source:MGI Symbol... [more]
Usp363.726e-1327.27ubiquitin specific peptidase 36 [Source:MGI Symbol... [more]
Usp426.081e-1326.51ubiquitin specific peptidase 42 [Source:MGI Symbol... [more]
Usp17ld1.198e-1125.77ubiquitin specific peptidase 17-like D [Source:MGI... [more]
Usp17lc3.326e-1126.03ubiquitin specific peptidase 17-like C [Source:MGI... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09738|UBP8_SCHPO1.166e-1325.62Probable ubiquitin carboxyl-terminal hydrolase 8 O... [more]
sp|Q9VYQ8|UBP7_DROME2.468e-1328.57Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosoph... [more]
sp|O74442|UBP16_SCHPO2.130e-1227.09Probable ubiquitin carboxyl-terminal hydrolase 16 ... [more]
sp|B1AQJ2|UBP36_MOUSE2.606e-1227.27Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus mu... [more]
sp|Q9P275|UBP36_HUMAN3.678e-1227.62Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo s... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0EB121.665e-1927.33Uncharacterized protein OS=Paramecium tetraurelia ... [more]
A0A091N3673.465e-1627.74Ubiquitin carboxyl-terminal hydrolase 36 (Fragment... [more]
A0A093BZT14.436e-1628.42Ubiquitin carboxyl-terminal hydrolase 42 (Fragment... [more]
A0A2T0FDV18.532e-1629.34Ubiquitin carboxyl-terminal hydrolase 10 OS=Wicker... [more]
A0A550CTT11.184e-1527.24Ubiquitin carboxyl-terminal hydrolase (Fragment) O... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052072.12.325e-1525.71ubiquitin carboxyl-terminal hydrolase 17-like prot... [more]
ENSAMXT00000051328.13.036e-1425.26pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047058.13.036e-1425.26pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052035.16.144e-1425.26pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
usp369.792e-1126.10ubiquitin specific peptidase 36 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008243.13.902e-728.24pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 ... [more]
usp12a3.942e-633.03ubiquitin specific peptidase 12a [Source:NCBI gene... [more]
usp224.512e-626.81ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
UBP156.207e-1426.44Ubiquitin-specific protease involved in protein de... [more]
UBP82.117e-922.88Ubiquitin-specific protease component of the SAGA ... [more]
UBP71.066e-732.14Ubiquitin-specific protease that cleaves ubiquitin... [more]
UBP55.541e-723.65Putative ubiquitin-specific protease; concentrates... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327364.885e-1828.42Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO426512.470e-1026.33Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO444772.196e-838.53Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO350565.859e-822.90Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO374662.395e-723.16Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp428.853e-1625.96ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
usp421.357e-1425.96ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
usp421.373e-1425.96ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
usp361.392e-1124.36ubiquitin carboxyl-terminal hydrolase 36 [Source:N... [more]
USP243.997e-1124.29ubiquitin specific peptidase 24 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068529.10.000e+087.47SMESG000068529.1[more]
SMESG000068557.10.000e+080.53SMESG000068557.1[more]
SMESG000068574.10.000e+069.35SMESG000068574.1[more]
SMESG000068529.19.576e-16882.92SMESG000068529.1[more]
SMESG000068562.12.427e-14359.16SMESG000068562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033061 ID=SMED30033061|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1720bp
TGCACAATGACATTTACATAATTACGTCATTTTATGAATTTTTAAAAGAG
ATTTTTTAAATTAAATTACTATATTTTGGCAATGGCTTTTGACAATAATC
AAGAAGGGCAATTTATATATAATTTTGAAAATGGAAATACTTTTGATATA
TTCAAAGGTCTTCAGAAGGAAGATGGTCATTTTGAGTGTATAATTATAGT
TTCTGAACCTGATCTTCATAAAGCAAATATGGTTGATGAATGCAATGGAA
ATAATTGTTTAGAAATTATAACTGACAATAATTCGAATTTCGAATATTTA
AAATTTGATTGCTCTTCTGATCAAAGAGCCGCCGAATCAAGAGAACATTT
AAACGCAACTAAAGAACGGGAAACAGAAGATCTTCAGAATATGGCCAGCG
ATCATTTTGAAGTGAAATTAAGTCCAGTTCCATTGATAAATCATGGAGTT
AACTGCTACATGAATGCTGCTATTCAAAGTATTTTTCCTGCACTGCTCTA
CTTGAATACAATTAAAGAAACCATTGAATATGATCAATCTCAAGAGTGTG
GAGCGATCATTTTAATGGAAAGCCTTTTACAAGCTTACATCAATCAAGAA
GAATTCTCAATTCCGATTTGTATTTACGAACAGTCCAGTTTGGAATATTT
TAGTCTAGAATTATCATGGGAAAATATGGAAGATGCTCACGAGTTTTTGA
ATTGTTATCTAGATAAATTAAACGAAGAGTTGAAAGGACATTCTAAATTG
CAAAGGATTCCATTTGAAGCGGCCCATGATTCGAGATATTTCTGTAACAA
TTGTGGGAAATCGAATAATGATAAGCCGAACATTGTTGTTGACCAAGTAT
TGTTTGTGAGTGTCGGTAAAAACATGACAGAAATGATAGAAAACTATTTA
AAAGACGAAGTTGAAGGATTTAATTGTGAGAATTGTGAAGTCAAAAACGG
CTCGGCTAGCAGTGAGGTTGTATTTTCTGAGCTTCCGCAATATCTGGTGG
TTTGCATTAAACGGTTTGCTACACATTCATATTATCAAACTAAAAAGATT
AATGACAGAATATGTATTGACGAGATTATTGAAATACCTTATAAATCTGA
CGACAAAGTTCTCAAACAAAAGTATCGTTTGGTTTCAGTTGTAAATCATA
CCGGTAGCTTAAAAAGGGGGCACTATTTTACATTTTTGAAGCATGGGAAC
TTTTGGTACAAAGCTGATGACGATTCTGTACGGAAATGTGAATTGGAATA
CATGAAAATGATCAGTACATATTCGTGCTATATTGAGGTTTTTGAGAAAC
TAAATGAATGATGATTTCAATTGTTTTAATCATAAATGTTTCATTTATAT
ATCTGGTAAAGTAACAGCGGTAAAGCTCATTATGATTTGAACCAAAAGCA
TATGCAATCAAAGCCCAAATTCACGCTGCATAACTCAACAGAAAAATTAC
CCAAGCGTTTTTGTTACATAACGCCAAGCAAATCATAAAAGCTATTTGCA
AGAAAAAATTGTCTTATAGAGTTCAAGATACCTTAGTCACAAAAACATCC
AAAATATAATTTTTTATAAGTAGCTTAACTTAATGAATACCAAAATTTAC
CCACACTTAAAATTTCCTTTTTTTGATAAAAATTACACTTAAATTTAGTT
CCAAACCAATAGCCCGGCTTACAGCAAGCGGAACTTTTGTGGAATCAAAA
TACGAAGGTTACAGGTACTC
back to top

protein sequence of SMED30033061-orf-1

>SMED30033061-orf-1 ID=SMED30033061-orf-1|Name=SMED30033061-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=410bp
MAFDNNQEGQFIYNFENGNTFDIFKGLQKEDGHFECIIIVSEPDLHKANM
VDECNGNNCLEIITDNNSNFEYLKFDCSSDQRAAESREHLNATKERETED
LQNMASDHFEVKLSPVPLINHGVNCYMNAAIQSIFPALLYLNTIKETIEY
DQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENME
DAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPN
IVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSE
LPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRL
VSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCY
IEVFEKLNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom