Tudor domain-containing protein

Overview
NameTudor domain-containing protein
Smed IDSMED30033050
Length (bp)1306
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tudor domain-containing protein (SMED30033050) t-SNE clustered cells

Violin plots show distribution of expression levels for Tudor domain-containing protein (SMED30033050) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tudor domain-containing protein (SMED30033050) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tudor domain-containing protein (SMED30033050) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033050

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033050SMESG000027187.1 SmedASXL_011976SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033050SMESG000027187.1 SmedASXL_011976SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A183KIB7 (Tudor domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS14772 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.103e-10
Identity = 69/265 (26.04%), Postives = 125/265 (47.17%), Query Frame = 1
Query:  100 IPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCP----EDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEY-INNPPRIPF--PIGSGCICIALGSRGKFYRGLVLSYYY---DLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNC-QLDTSTPNIDEVIYRRFLCS-RVDSKPMRVYLYFTHVSCCIPSV 858
            IP   GG +IG+ G    ++   + AE  L   P      I  + CP     D ++ V H+   + ++               NP+QLK ++ LG+ +P  I ++  + +L V + + + +  Y  M + +  +Y  NN  R+    P+ SG + +   S+G F R L++S Y     +A  Y +D G   ++  N+L KI+ K++++ ++AI V W +   + +  P++   I R F  S RV +  +R+       +CC  SV
Sbjct:  228 IPAYMGGVLIGRLGKNVRELRNAWEAEFSLNTCPGKQDTLIFKLSCPLRHKNDVLRWVSHRFRMRPSKTTI-----------GNPNQLKRQLPLGEPVPVQIRSLYGSKELFVTVPDEE-YSNYLVMQEELEKDYSTNNNYRMQLCEPVTSGTVAVVPHSQG-FARALIISVYPTWPKVAFYYLLDHGTFGIVQLNKLRKIRAKYMKVPYQAIHVSWAHAFPVYSDIPDLH--ILRTFFNSGRVHAFAVRM------ETCCRASV 471          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A095ALD8 (Tudor domain-containing protein OS=Schistosoma haematobium OX=6185 GN=MS3_03162 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.291e-10
Identity = 69/265 (26.04%), Postives = 125/265 (47.17%), Query Frame = 1
Query:  100 IPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCP----EDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEY-INNPPRIPF--PIGSGCICIALGSRGKFYRGLVLSYYY---DLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNC-QLDTSTPNIDEVIYRRFLCS-RVDSKPMRVYLYFTHVSCCIPSV 858
            IP   GG +IG+ G    ++   + AE  L   P      I  + CP     D ++ V H+   + ++               NP+QLK ++ LG+ +P  I ++  + +L V + + + +  Y  M + +  +Y  NN  R+    P+ SG + +   S+G F R L++S Y     +A  Y +D G   ++  N+L KI+ K++++ ++AI V W +   + +  P++   I R F  S RV +  +R+       +CC  SV
Sbjct:  197 IPAYMGGVLIGRLGKNVRELRNAWEAEFSLNTCPGKQDTLIFKLSCPLRHKNDVLRWVSHRFRMRPSKTTI-----------GNPNQLKRQLPLGEPVPVQIRSLYGSKELFVTVPDEE-YSNYLVMQEELEKDYSTNNNYRMQLCEPVTSGTVAVVPHSQG-FARALIISVYPTWPKVAFYYLLDHGTFGIVQLNKLRKIRAKYMKVPYQAIHVSWAHAFPVYSDIPDLH--ILRTFFNSGRVHAFAVRM------ETCCRASV 440          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A183PGC9 (Tudor domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS13415 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.307e-10
Identity = 69/265 (26.04%), Postives = 125/265 (47.17%), Query Frame = 1
Query:  100 IPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCP----EDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEY-INNPPRIPF--PIGSGCICIALGSRGKFYRGLVLSYYY---DLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNC-QLDTSTPNIDEVIYRRFLCS-RVDSKPMRVYLYFTHVSCCIPSV 858
            IP   GG +IG+ G    ++   + AE  L   P      I  + CP     D ++ V H+   + ++               NP+QLK ++ LG+ +P  I ++  + +L V + + + +  Y  M + +  +Y  NN  R+    P+ SG + +   S+G F R L++S Y     +A  Y +D G   ++  N+L KI+ K++++ ++AI V W +   + +  P++   I R F  S RV +  +R+       +CC  SV
Sbjct:  227 IPAYMGGVLIGRLGKNVRELRNVWEAEFSLNTCPGKQDTLIFKLSCPLRHKNDVLRWVSHRFRMRPSKTTI-----------GNPNQLKRQLPLGEPVPVQIRSLYGSKELFVTVPDEE-YSNYLVMQEELEKDYSTNNNYRMQLCEPVTSGTVAVVPHSQG-FARALIISVYPTWPKVAFYYLLDHGTFGIVQLNKLRKIRAKYMKVPYQAIHVSWAHAFPVYSDIPDLH--ILRTFFNSGRVHAFAVRM------ETCCRASV 470          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A183M8C2 (Tudor domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS12297 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.710e-10
Identity = 69/265 (26.04%), Postives = 125/265 (47.17%), Query Frame = 1
Query:  100 IPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCP----EDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEY-INNPPRIPF--PIGSGCICIALGSRGKFYRGLVLSYYY---DLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNC-QLDTSTPNIDEVIYRRFLCS-RVDSKPMRVYLYFTHVSCCIPSV 858
            IP   GG +IG+ G    ++   + AE  L   P      I  + CP     D ++ V H+   + ++               NP+QLK ++ LG+ +P  I ++  + +L V + + + +  Y  M + +  +Y  NN  R+    P+ SG + +   S+G F R L++S Y     +A  Y +D G   ++  N+L KI+ K++++ ++AI V W +   + +  P++   I R F  S RV +  +R+       +CC  SV
Sbjct:  228 IPAYMGGVLIGRLGKNVRELRNVWEAEFSLNTCPGKQDTLIFKLSCPLRHKNDVLRWVSHRFRMRPSKTTI-----------GNPNQLKRQLPLGEPVPVQIRSLYGSKELFVTVPDEE-YSNYLVMQEELEKDYSTNNNYRMQLCEPVTSGTVAVVPHSQG-FARALIISVYPTWPKVAFYYLLDHGTFGIVQLNKLRKIRAKYMKVPYQAIHVSWAHAFPVYSDIPDLH--ILRTFFNSGRVHAFAVRME------TCCRASV 471          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: Q5DBV2 (SJCHGC01079 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.895e-10
Identity = 71/262 (27.10%), Postives = 125/262 (47.71%), Query Frame = 1
Query:  100 IPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYI---NNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYD---LAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNC-QLDTSTPNIDEVIYRRFLCS-RVDSKPMRVYLYFTHVSCCIPSVN 861
            IP   GG +IG+ G    ++   + AE  L   P      I+ + CP      ++HK D  +  ++ +  T    T   NP+QLK ++ LGK +P  I ++  + +  V + + + +  Y  M   + ++Y    N   R+  P+ SG + +   S G F R L++S Y     +A  Y +D G   ++  N+L KI+ K++++ F+AI V W +   + +  P++   I R F  S RV +  +R+       +CC  SV 
Sbjct:  214 IPAYMGGVLIGRLGKNVRELRNVWQAEFSLNTCPGKQDTLILKLSCP------LKHK-DNVLRWVSNRFKTRPSKTTIGNPNQLKRQLPLGKPVPVQIRSLYGSKEFFVTIPDEE-YSNYLVMQTELENDYSTANNYRMRLCEPVTSGTVAVVPHSHG-FARALIISVYQTWPKIAFYYLLDHGTFGVVELNKLRKIRAKYMQVPFQAIHVSWAHAFPVYSDIPDLH--ILRTFFNSGRVHAFAVRME------TCCRASVG 458          
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Match: SMESG000027187.1 (SMESG000027187.1)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 350/353 (99.15%), Postives = 351/353 (99.43%), Query Frame = 1
Query:   46 MMDNSPEPKEYLKRIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYINNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTSTPNIDEVIYRRFLCSRVDSKPMRVYLYFTHVSCCIPSVNIYITKPGDNANNDEFVDLLELLTTVRLAKTVPSEILLSHNCRRIASSKSSEALFYKPCNFSYYEPIMSIKSQTNENSDQRQ 1104
            MMDNSPEPKEYLKRIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVK VEHKIDEKIAEINKKINTNTINTITSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYINNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAH+YFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTSTPNIDEVIYRRFLCSRVDSKPMRVYLYFTHVSCCIPSVNIYITKPGDNANNDEFVDLLELLTTV LAKTVPSEILLSHNCRRIASSKSSEALFYKPCNFSYYEPIMSIKSQTNENSDQRQ
Sbjct:    1 MMDNSPEPKEYLKRIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVKYVEHKIDEKIAEINKKINTNTINTITSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYINNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAHVYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTSTPNIDEVIYRRFLCSRVDSKPMRVYLYFTHVSCCIPSVNIYITKPGDNANNDEFVDLLELLTTVGLAKTVPSEILLSHNCRRIASSKSSEALFYKPCNFSYYEPIMSIKSQTNENSDQRQ 353          
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Match: SMESG000027187.1 (SMESG000027187.1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 349/352 (99.15%), Postives = 350/352 (99.43%), Query Frame = 1
Query:   49 MDNSPEPKEYLKRIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYINNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTSTPNIDEVIYRRFLCSRVDSKPMRVYLYFTHVSCCIPSVNIYITKPGDNANNDEFVDLLELLTTVRLAKTVPSEILLSHNCRRIASSKSSEALFYKPCNFSYYEPIMSIKSQTNENSDQRQ 1104
            MDNSPEPKEYLKRIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVK VEHKIDEKIAEINKKINTNTINTITSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYINNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAH+YFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTSTPNIDEVIYRRFLCSRVDSKPMRVYLYFTHVSCCIPSVNIYITKPGDNANNDEFVDLLELLTTV LAKTVPSEILLSHNCRRIASSKSSEALFYKPCNFSYYEPIMSIKSQTNENSDQRQ
Sbjct:    1 MDNSPEPKEYLKRIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVKYVEHKIDEKIAEINKKINTNTINTITSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYINNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAHVYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTSTPNIDEVIYRRFLCSRVDSKPMRVYLYFTHVSCCIPSVNIYITKPGDNANNDEFVDLLELLTTVGLAKTVPSEILLSHNCRRIASSKSSEALFYKPCNFSYYEPIMSIKSQTNENSDQRQ 352          
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Match: SMESG000031739.1 (SMESG000031739.1)

HSP 1 Score: 184.111 bits (466), Expect = 1.903e-50
Identity = 117/355 (32.96%), Postives = 200/355 (56.34%), Query Frame = 1
Query:   85 RIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEY--INNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTS--TPNIDEVIYRRFLCSRVDSKPMRVYLYFTHV-SCCIPSVNIYITKP--GDNANNDEFVDLLELLTTVRLAKT--------VPSEILLSHNCRRIASSKSSEAL----FYKPCNFSYYEPIMSIKSQTNENS 1092
            +I+R IPVG GG IIGKKG  K ++  ++GA+L ++N P+   +Q++ I C       V ++++  +     +I  NT+ T  SNP+ LKP + LGKL+  +I++M     + + + +P++  ++ KM   +N +Y  ++N   +P P+  GC+C+A+     F R  ++  Y D+A +Y  D+GK+       LFKI+ K++ + F+ IP +  N  +     TP+I   I++RFLC++   KP+ V ++F  + +CC P VN+Y+  P   +N N++EFVDLLELL ++ L           + +EI  SH  +   + K S  L    +++P N  +YE  +   S+T ENS
Sbjct:  768 KIIRTIPVGLGGRIIGKKGKTKNELMKKYGAQLLIYNHPVENGKQVLEITCS----PSVRNQLENWVNRTLDQITKNTLQTTVSNPEWLKPMIPLGKLVAAHIVDMPTIQHVKLRIFDPEIIKEFNKMQIEMNMDYNNVDNTALLPRPVAIGCVCVAMIRPDYFLRAQIVDIYEDIAWVYLFDLGKVCQTYLYYLFKIREKYMRVPFQIIPARIPNATIKNKNITPDI---IFKRFLCNQSTLKPIMVRIFFPRMHTCCEPCVNVYVPVPTVSENENSEEFVDLLELLVSIDLCSMIKISVNSKIQTEINSSH-VKAFLNEKVSLNLTVPMYFQPLNSKFYEDFVEFNSET-ENS 1113          
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Match: SMESG000031739.1 (SMESG000031739.1)

HSP 1 Score: 184.111 bits (466), Expect = 2.192e-50
Identity = 117/355 (32.96%), Postives = 200/355 (56.34%), Query Frame = 1
Query:   85 RIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFNDPLNPMQQIIFIDCPEDQVKCVEHKIDEKIAEXXXXXXXXXXXXXXSNPDQLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEY--INNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAHIYFVDIGKIELLPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTS--TPNIDEVIYRRFLCSRVDSKPMRVYLYFTHV-SCCIPSVNIYITKP--GDNANNDEFVDLLELLTTVRLAKT--------VPSEILLSHNCRRIASSKSSEAL----FYKPCNFSYYEPIMSIKSQTNENS 1092
            +I+R IPVG GG IIGKKG  K ++  ++GA+L ++N P+   +Q++ I C       V ++++  +     +I  NT+ T  SNP+ LKP + LGKL+  +I++M     + + + +P++  ++ KM   +N +Y  ++N   +P P+  GC+C+A+     F R  ++  Y D+A +Y  D+GK+       LFKI+ K++ + F+ IP +  N  +     TP+I   I++RFLC++   KP+ V ++F  + +CC P VN+Y+  P   +N N++EFVDLLELL ++ L           + +EI  SH  +   + K S  L    +++P N  +YE  +   S+T ENS
Sbjct:  795 KIIRTIPVGLGGRIIGKKGKTKNELMKKYGAQLLIYNHPVENGKQVLEITCS----PSVRNQLENWVNRTLDQITKNTLQTTVSNPEWLKPMIPLGKLVAAHIVDMPTIQHVKLRIFDPEIIKEFNKMQIEMNMDYNNVDNTALLPRPVAIGCVCVAMIRPDYFLRAQIVDIYEDIAWVYLFDLGKVCQTYLYYLFKIREKYMRVPFQIIPARIPNATIKNKNITPDI---IFKRFLCNQSTLKPIMVRIFFPRMHTCCEPCVNVYVPVPTVSENENSEEFVDLLELLVSIDLCSMIKISVNSKIQTEINSSH-VKAFLNEKVSLNLTVPMYFQPLNSKFYEDFVEFNSET-ENS 1140          
The following BLAST results are available for this feature:
BLAST of Tudor domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183KIB72.103e-1026.04Tudor domain-containing protein OS=Schistosoma cur... [more]
A0A095ALD82.291e-1026.04Tudor domain-containing protein OS=Schistosoma hae... [more]
A0A183PGC94.307e-1026.04Tudor domain-containing protein OS=Schistosoma mat... [more]
A0A183M8C24.710e-1026.04Tudor domain-containing protein OS=Schistosoma mar... [more]
Q5DBV25.895e-1027.10SJCHGC01079 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000027187.10.000e+099.15SMESG000027187.1[more]
SMESG000027187.10.000e+099.15SMESG000027187.1[more]
SMESG000031739.11.903e-5032.96SMESG000031739.1[more]
SMESG000031739.12.192e-5032.96SMESG000031739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033050 ID=SMED30033050|Name=Tudor domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1306bp
ATCAAAACGTGAATTAGAATAGTTTATTTTAATAAGTATTATAAAATGAT
GGATAATTCTCCTGAACCAAAAGAATATTTAAAAAGAATTGTTAGAGCTA
TTCCCGTGGGTTTTGGTGGGTATATAATTGGTAAAAAAGGAAGTTTTAAA
ACACAAATTAATACAGAATTTGGAGCCGAACTTCGCTTATTTAATGATCC
TCTTAATCCAATGCAGCAAATTATATTTATCGATTGTCCTGAAGATCAAG
TTAAATGTGTTGAACATAAAATTGATGAAAAAATTGCTGAGATTAACAAA
AAAATTAATACAAATACCATCAATACGATAACAAGTAATCCAGACCAATT
AAAACCAAGAGTTGAGCTTGGGAAATTAATACCGGGATATATTATGAATA
TGTCACAAACCAATGATCTAGTCGTTATTCTTGACAATCCCAAGGTTCAT
GTAAAGTATGAAAAGATGCACGATTCCATAAATTCAGAATACATCAATAA
TCCCCCAAGAATTCCATTCCCAATAGGATCAGGATGTATATGTATTGCAC
TAGGATCACGAGGAAAATTCTATCGTGGCTTAGTCTTAAGTTATTATTAT
GACTTAGCACACATTTATTTTGTCGATATTGGTAAAATCGAACTCCTTCC
TTATAATAGATTGTTTAAAATAAAGGTAAAACATTTAGAATTATCTTTCC
GAGCAATCCCAGTTAAATGGAATAATTGCCAACTTGACACATCCACTCCC
AACATCGATGAAGTTATTTATCGACGATTTCTTTGCAGTCGGGTTGATTC
AAAACCTATGCGAGTTTATTTGTACTTTACTCATGTCAGCTGCTGTATTC
CATCAGTTAACATTTACATCACCAAACCAGGAGACAATGCAAACAATGAT
GAATTCGTCGACTTGCTAGAGTTGTTAACAACTGTGCGATTGGCAAAAAC
TGTTCCGTCTGAGATATTATTGTCACATAATTGCCGCCGGATAGCCAGTT
CGAAATCGTCAGAGGCGTTATTCTATAAACCTTGCAATTTCTCCTACTAC
GAGCCGATAATGTCTATCAAATCTCAGACCAACGAAAACTCTGATCAACG
CCAATAGATTGTTATAGATTCTAATACAGTTTCTGACTTTATTCTAGACA
ACACATTATTCGGAATTGTGATAAGGTAGTGCTTGTGTGTAATATAAGCA
TGTGTGATTGTATGTCTGTAATTTGTGTTATTTATTATGTAAATATTTTT
ATTTTTTGTGGAATTAGGTTATTTTTATATGATTAACTGACTTGACTTGT
TAGAAC
back to top

protein sequence of SMED30033050-orf-1

>SMED30033050-orf-1 ID=SMED30033050-orf-1|Name=SMED30033050-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=354bp
MMDNSPEPKEYLKRIVRAIPVGFGGYIIGKKGSFKTQINTEFGAELRLFN
DPLNPMQQIIFIDCPEDQVKCVEHKIDEKIAEINKKINTNTINTITSNPD
QLKPRVELGKLIPGYIMNMSQTNDLVVILDNPKVHVKYEKMHDSINSEYI
NNPPRIPFPIGSGCICIALGSRGKFYRGLVLSYYYDLAHIYFVDIGKIEL
LPYNRLFKIKVKHLELSFRAIPVKWNNCQLDTSTPNIDEVIYRRFLCSRV
DSKPMRVYLYFTHVSCCIPSVNIYITKPGDNANNDEFVDLLELLTTVRLA
KTVPSEILLSHNCRRIASSKSSEALFYKPCNFSYYEPIMSIKSQTNENSD
QRQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0034237protein kinase A regulatory subunit binding
GO:0003723RNA binding
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0010738regulation of protein kinase A signaling
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004087KH_dom
IPR036612KH_dom_type_1_sf
IPR004088KH_dom_type_1
IPR002999Tudor
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 11..81
e-value: 3.5E-4
score: 29.9
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 132..225
e-value: 7.5E-12
score: 47.0
NoneNo IPR availablePANTHERPTHR22948TUDOR DOMAIN CONTAINING PROTEINcoord: 137..223
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 19..76
score: 8.408
NoneNo IPR availableCDDcd00105KH-Icoord: 19..76
e-value: 1.25489E-5
score: 40.6211
NoneNo IPR availableCDDcd04508TUDORcoord: 163..208
e-value: 2.85733E-5
score: 39.1184
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 137..225
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 18..77
e-value: 3.5E-5
score: 23.5
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 9..84
e-value: 5.7E-6
score: 27.9
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 15..83
IPR002999Tudor domainPFAMPF00567TUDORcoord: 109..224
e-value: 6.8E-13
score: 48.7
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 157..216
score: 10.241