Secreted peptide prohormone-9

Overview
NameSecreted peptide prohormone-9
Smed IDSMED30033037
Length (bp)217
Neoblast Clusters

Zeng et. al., 2018



 

 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)



Explore this single cell expression dataset with our NB Cluster Shiny App



Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020



SMED30033037

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30033037 SmedASXL_079584SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016		whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30033037 SmedASXL_079584SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016		whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30033037 BK007026smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010		whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30033037 BK007026smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010		whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
[Close]
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Match: E3CTK1 (Secreted peptide prohormone-9 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 5.731e-19
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1 
Query:    1 MNSXXXXXXXXXXXXXXXXXGVQKRSLPYNPEYELYKRFVEKRLIDPLTFGSGFSNL 171
            MNSLIILLIVALVCLANVCCGVQKRSLPYNPEYELYKRFVEKRLIDPLTFGSGFSNL
Sbjct:    1 MNSLIILLIVALVCLANVCCGVQKRSLPYNPEYELYKRFVEKRLIDPLTFGSGFSNL 57
[Close]
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Match: E3T7U3 (Secreted peptide prohormone 8 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 3.852e-6
Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = 1 
Query:   64 VQKRSLPY--NPEYELYKRFVEKRLIDPLTFGSGFSNL 171
            V+KR++ +  N    LYKR +EKRLIDP+TFGSGF+NL
Sbjct:   22 VEKRTMGFGFNRNMLLYKRMLEKRLIDPMTFGSGFANL 59
[Close]
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Match: E3T7U0 (Secreted peptide prohormone 7 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 7.922e-6
Identity = 22/38 (57.89%), Postives = 29/38 (76.32%), Query Frame = 1 
Query:   64 VQKRSLPY--NPEYELYKRFVEKRLIDPLTFGSGFSNL 171
            + KR++ +  N    LYKR +EKRLIDP+TFGSGF+NL
Sbjct:   22 IDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGFANL 59
The following BLAST results are available for this feature:
BLAST of Secreted peptide prohormone-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
E3CTK15.731e-19100.00Secreted peptide prohormone-9 OS=Schmidtea mediter... [more]
E3T7U33.852e-660.53Secreted peptide prohormone 8 OS=Schmidtea mediter... [more]
E3T7U07.922e-657.89Secreted peptide prohormone 7 OS=Schmidtea mediter... [more]
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033037 ID=SMED30033037|Name=Secreted peptide prohormone-9|organism=Schmidtea mediterranea sexual|type=transcript|length=217bp
ATGAATTCGTTGATTATTTTACTTATCGTTGCTTTGGTTTGTTTGGCCAA
CGTCTGCTGTGGGGTTCAGAAACGATCATTACCTTATAATCCTGAATATG
AATTATACAAGCGATTCGTGGAGAAAAGACTGATAGATCCCTTGACATTC
GGCAGTGGATTTTCAAATTTATGACAAATTTATTTTCAAATTTTTCTAAT
AAATTTTGAATGAATTG
back to top
Aliases
The feature 'Secreted peptide prohormone-9' has the following synonyms
Synonym
spp-9
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000420parapharyngeal region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.862
NoneNo IPR availableTMHMMTMhelixcoord: 4..21