Secreted peptide prohormone-9
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30033037 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Match: E3CTK1 (Secreted peptide prohormone-9 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 5.731e-19 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1 Query: 1 MNSXXXXXXXXXXXXXXXXXGVQKRSLPYNPEYELYKRFVEKRLIDPLTFGSGFSNL 171 MNSLIILLIVALVCLANVCCGVQKRSLPYNPEYELYKRFVEKRLIDPLTFGSGFSNL Sbjct: 1 MNSLIILLIVALVCLANVCCGVQKRSLPYNPEYELYKRFVEKRLIDPLTFGSGFSNL 57
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Match: E3T7U3 (Secreted peptide prohormone 8 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 49.2914 bits (116), Expect = 3.852e-6 Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 64 VQKRSLPY--NPEYELYKRFVEKRLIDPLTFGSGFSNL 171 V+KR++ + N LYKR +EKRLIDP+TFGSGF+NL Sbjct: 22 VEKRTMGFGFNRNMLLYKRMLEKRLIDPMTFGSGFANL 59
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Match: E3T7U0 (Secreted peptide prohormone 7 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 48.521 bits (114), Expect = 7.922e-6 Identity = 22/38 (57.89%), Postives = 29/38 (76.32%), Query Frame = 1 Query: 64 VQKRSLPY--NPEYELYKRFVEKRLIDPLTFGSGFSNL 171 + KR++ + N LYKR +EKRLIDP+TFGSGF+NL Sbjct: 22 IDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGFANL 59 The following BLAST results are available for this feature:
BLAST of Secreted peptide prohormone-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 3
BLAST of Secreted peptide prohormone-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of Secreted peptide prohormone-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 0
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30033037 ID=SMED30033037|Name=Secreted peptide prohormone-9|organism=Schmidtea mediterranea sexual|type=transcript|length=217bpback to top Aliases
The feature 'Secreted peptide prohormone-9' has the following synonyms
Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|