PWI domain-containing protein

Overview
NamePWI domain-containing protein
Smed IDSMED30033025
Length (bp)1555
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PWI domain-containing protein (SMED30033025) t-SNE clustered cells

Violin plots show distribution of expression levels for PWI domain-containing protein (SMED30033025) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PWI domain-containing protein (SMED30033025) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PWI domain-containing protein (SMED30033025) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033025

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30033025SMESG000013292.1 dd_Smed_v4_5123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033025SMESG000013292.1 dd_Smed_v4_5123_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PWI domain-containing protein vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 98.5969 bits (244), Expect = 5.215e-21
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 98.5969 bits (244), Expect = 5.977e-21
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 98.5969 bits (244), Expect = 6.046e-21
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 88.5817 bits (218), Expect = 1.067e-20
Identity = 41/75 (54.67%), Postives = 57/75 (76.00%), Query Frame = 1
Query:  151 MENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            M  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:    1 MSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 75          
BLAST of PWI domain-containing protein vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 88.1965 bits (217), Expect = 9.958e-18
Identity = 41/75 (54.67%), Postives = 57/75 (76.00%), Query Frame = 1
Query:  151 MENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            M  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:    1 MSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 75          
BLAST of PWI domain-containing protein vs. Ensembl Celegans
Match: rsr-1 (SR protein related [Source:UniProtKB/TrEMBL;Acc:O62185])

HSP 1 Score: 80.8777 bits (198), Expect = 6.627e-16
Identity = 33/90 (36.67%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNS 369
            KL+K MKF+  L  ++D+   ++  +KPWI+ R+ ++   ED+V+++YI +Q++ K  +PK +Q N++GFL+ + +R F G+LW  L+ +
Sbjct:   23 KLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDILGMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEA 112          
BLAST of PWI domain-containing protein vs. Ensembl Celegans
Match: rsr-1 (SR protein related [Source:UniProtKB/TrEMBL;Acc:O62185])

HSP 1 Score: 80.8777 bits (198), Expect = 6.627e-16
Identity = 33/90 (36.67%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNS 369
            KL+K MKF+  L  ++D+   ++  +KPWI+ R+ ++   ED+V+++YI +Q++ K  +PK +Q N++GFL+ + +R F G+LW  L+ +
Sbjct:   23 KLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDILGMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEA 112          
BLAST of PWI domain-containing protein vs. Ensembl Fly
Match: SRm160 (gene:FBgn0036340 transcript:FBtr0075883)

HSP 1 Score: 116.316 bits (290), Expect = 5.568e-27
Identity = 51/95 (53.68%), Postives = 74/95 (77.89%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQL-EPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESN 381
            KLMK+MKF D LN RVDM  V L  ++PWISK+IT++   ED+V+++++YNQL E K+P PK++Q N++GFL+ +N+R F GELW  LL++ ES+
Sbjct:   20 KLMKQMKFGDCLNKRVDMSKVKLDVLRPWISKKITDILHIEDDVVVEFVYNQLEEEKYPCPKKMQINMTGFLNGRNARQFMGELWALLLSAQESD 114          
BLAST of PWI domain-containing protein vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 91.2781 bits (225), Expect = 2.293e-20
Identity = 41/85 (48.24%), Postives = 62/85 (72.94%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI++R+TE+   ED+V+I++++NQLE K PD K +Q NL+GFL+ KN+R F  +LW  LL++ E
Sbjct:   30 FAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 90.1225 bits (222), Expect = 1.778e-18
Identity = 41/85 (48.24%), Postives = 62/85 (72.94%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI++R+TE+   ED+V+I++++NQLE K PD K +Q NL+GFL+ KN+R F  +LW  LL++ E
Sbjct:   30 FAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 90.1225 bits (222), Expect = 1.913e-18
Identity = 41/85 (48.24%), Postives = 62/85 (72.94%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI++R+TE+   ED+V+I++++NQLE K PD K +Q NL+GFL+ KN+R F  +LW  LL++ E
Sbjct:   30 FAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 53.9138 bits (128), Expect = 5.014e-9
Identity = 23/49 (46.94%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPK 267
            F + L  +VDM  V+L  +KPWI++R+TE+   ED+V+I++++NQLE K
Sbjct:   30 FAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEK 78          
BLAST of PWI domain-containing protein vs. Ensembl Xenopus
Match: srrm1 (serine and arginine repetitive matrix 1 [Source:NCBI gene;Acc:448115])

HSP 1 Score: 100.908 bits (250), Expect = 9.210e-22
Identity = 46/85 (54.12%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+ID+I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMGKVNLEVIKPWITKRVTEILGFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Xenopus
Match: srrm1 (serine and arginine repetitive matrix 1 [Source:NCBI gene;Acc:448115])

HSP 1 Score: 100.908 bits (250), Expect = 9.637e-22
Identity = 46/85 (54.12%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+ID+I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   25 FAECLEKKVDMGKVNLEVIKPWITKRVTEILGFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 109          
BLAST of PWI domain-containing protein vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 98.2117 bits (243), Expect = 4.016e-23
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 98.5969 bits (244), Expect = 3.779e-21
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 98.2117 bits (243), Expect = 4.801e-21
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 98.2117 bits (243), Expect = 5.096e-21
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 98.2117 bits (243), Expect = 5.113e-21
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZMJ9|SRRM1_CHICK (Serine/arginine repetitive matrix protein 1 OS=Gallus gallus OX=9031 GN=SRRM1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.596e-20
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R5Q2|SRRM1_PONAB (Serine/arginine repetitive matrix protein 1 OS=Pongo abelii OX=9601 GN=SRRM1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.681e-20
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IYB3|SRRM1_HUMAN (Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 2.903e-20
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. UniProt/SwissProt
Match: sp|Q52KI8|SRRM1_MOUSE (Serine/arginine repetitive matrix protein 1 OS=Mus musculus OX=10090 GN=Srrm1 PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 3.263e-20
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI+KR+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F GELW  LL++ E
Sbjct:   30 FAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9USH5|YJQ5_SCHPO (PWI domain-containing protein C825.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC825.05c PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.684e-14
Identity = 42/110 (38.18%), Postives = 62/110 (56.36%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFP-------------DPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVG 390
            KLM+  KF    + +VDM+ V++  +KPWI+ R+ EL   EDEV+I+++Y  LE                 DP+++Q NL+GFL   N+  FT ELW  L+ S   N+ G
Sbjct:   22 KLMRSTKFPASYDTKVDMKKVNIEVLKPWIATRLNELIGFEDEVVINFVYGMLEEAVEASKTSDSQNESTLDPRKVQLNLTGFL-ESNATAFTEELW-SLIISASQNQYG 129          
BLAST of PWI domain-containing protein vs. TrEMBL
Match: A0A0L7LMN4 (Serine/arginine repetitive matrix protein 1 (Fragment) OS=Operophtera brumata OX=104452 GN=OBRU01_04134 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.880e-27
Identity = 54/93 (58.06%), Postives = 73/93 (78.49%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLES 378
            KLMK+MKF D L  +VDM  V L  +KPWI+++ITE+ K ED+V+IDY+ NQLE KFP PK++Q NL+GFL+ KN+R+F GELW+ LL++  S
Sbjct:   82 KLMKQMKFGDCLTQQVDMSKVKLDVLKPWITQKITEILKMEDDVVIDYVNNQLEEKFPCPKKMQINLTGFLNGKNARLFMGELWELLLSAQAS 174          
BLAST of PWI domain-containing protein vs. TrEMBL
Match: A0A5E4PRA5 (PWI domain-containing protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS1157 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.211e-26
Identity = 56/97 (57.73%), Postives = 76/97 (78.35%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVG 390
            KLMK+MKF D L  +VDM  V L  +KPWI+++ITE+ K ED+V+IDY+ NQLE KFP PK++Q NL+GFL+ KN+R+F GELW +LL S +++E G
Sbjct:   21 KLMKQMKFGDCLTQQVDMSKVKLDIIKPWITQKITEILKMEDDVVIDYVNNQLEEKFPCPKKMQINLTGFLNGKNARLFMGELW-ELLLSAQASESG 116          
BLAST of PWI domain-containing protein vs. TrEMBL
Match: H2XTZ8 (PWI domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC100186689 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.658e-26
Identity = 55/97 (56.70%), Postives = 72/97 (74.23%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVG 390
            KL+K MKF D L  +VDM  + L  +KPWISKRITE+   ED+V+I ++YN LE +FPDPK +Q NL+GFL+ KNSRIF GELW+  L S + N++G
Sbjct:   23 KLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEMLGFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEH-LASAQDNDMG 118          
BLAST of PWI domain-containing protein vs. TrEMBL
Match: A0A5E4PP26 (PWI domain-containing protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS1157 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.154e-26
Identity = 56/97 (57.73%), Postives = 76/97 (78.35%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVG 390
            KLMK+MKF D L  +VDM  V L  +KPWI+++ITE+ K ED+V+IDY+ NQLE KFP PK++Q NL+GFL+ KN+R+F GELW +LL S +++E G
Sbjct:   21 KLMKQMKFGDCLTQQVDMSKVKLDIIKPWITQKITEILKMEDDVVIDYVNNQLEEKFPCPKKMQINLTGFLNGKNARLFMGELW-ELLLSAQASESG 116          
BLAST of PWI domain-containing protein vs. TrEMBL
Match: A0A5E4PQH6 (PWI domain-containing protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS1157 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.156e-26
Identity = 56/97 (57.73%), Postives = 76/97 (78.35%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVG 390
            KLMK+MKF D L  +VDM  V L  +KPWI+++ITE+ K ED+V+IDY+ NQLE KFP PK++Q NL+GFL+ KN+R+F GELW +LL S +++E G
Sbjct:   21 KLMKQMKFGDCLTQQVDMSKVKLDIIKPWITQKITEILKMEDDVVIDYVNNQLEEKFPCPKKMQINLTGFLNGKNARLFMGELW-ELLLSAQASESG 116          
BLAST of PWI domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054963.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:7602066:7607564:-1 gene:ENSAMXG00000040320.1 transcript:ENSAMXT00000054963.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 6.999e-21
Identity = 42/85 (49.41%), Postives = 62/85 (72.94%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L  +VDM  V+L  +KPWI++R+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F  +LW  LL++ E
Sbjct:   30 FAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFIFNQLEEKNPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000046927.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:7604744:7607564:-1 gene:ENSAMXG00000040320.1 transcript:ENSAMXT00000046927.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 6.923e-10
Identity = 24/49 (48.98%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPK 267
            F + L  +VDM  V+L  +KPWI++R+TE+   ED+V+I++I+NQLE K
Sbjct:   30 FAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFIFNQLEEK 78          
BLAST of PWI domain-containing protein vs. Ensembl Nematostella
Match: EDO32561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUQ0])

HSP 1 Score: 106.686 bits (265), Expect = 2.043e-27
Identity = 46/93 (49.46%), Postives = 74/93 (79.57%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLE-PKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            KL+K ++F+D+L+ +VDME ++L  +KPWI+KRIT++   ED+V++++++N LE  K PDPK +Q N++GFL  KN+RIF GELW+ L+++ E
Sbjct:   18 KLLKSIRFEDVLDKKVDMEKINLDVLKPWITKRITDMLGFEDDVVLEFVFNMLESEKHPDPKVMQINITGFLQAKNARIFMGELWELLVSAQE 110          
BLAST of PWI domain-containing protein vs. Ensembl Nematostella
Match: EDO28181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T770])

HSP 1 Score: 46.9802 bits (110), Expect = 2.679e-7
Identity = 20/36 (55.56%), Postives = 29/36 (80.56%), Query Frame = 1
Query:  271 PDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLES 378
            PDPK +Q N++GFL  KN+RIF GELW+ L+++ E+
Sbjct:    2 PDPKVMQINITGFLQAKNARIFMGELWELLVSAQEN 37          
BLAST of PWI domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000021894.2 (pep primary_assembly:ASM223467v1:22:16875116:16883660:1 gene:ENSORLG00000017510.2 transcript:ENSORLT00000021894.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.988e-21
Identity = 42/85 (49.41%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  121 FDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLE 375
            F + L+ +VDM  V+L  +KPWI++R+TE+   ED+V+I++I+NQLE K PD K +Q NL+GFL+ KN+R F  +LW  LL++ E
Sbjct:   30 FAECLDKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFIFNQLEEKHPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQE 114          
BLAST of PWI domain-containing protein vs. Planmine SMEST
Match: SMESG000013292.1 (SMESG000013292.1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 450/458 (98.25%), Postives = 455/458 (99.34%), Query Frame = 1
Query:   94 MNKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVGKSENQKLNSDKIKSFPRLGPSENKPPSNDVSNQNKFKDKLNYFYNVIFRIFGINTYFRRQLGWKNENRPNNLTGSQSHSFXXXXXXXXXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEITSYTSNSFSSNRKSEIVSNPKLLKSEKNKNGLNRSTYSLTSVQHSVIKVFTPNNKEYDDHYKISLFNDKYLSETDQNHSTDLSPSPVXXXXXXXXXXXXXXXXXXIAFVSPQNLQRHKKYLXXXXXXXXXXIEYMDQSLFLQQSQNHNNETESDSEIEWMTVEEYDKLMGNXXXXXXXXXXXXXXXXXXXXXXDIEWIENQQLNSLSDDYIRI 1467
            MNKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLS+KNSRIFTGELWKQLLNSLESNEVGKSENQKLNSDKIKSFPRLGPSENKPPSNDVSNQNKFKDKLNYFYNVIF IFGINTYFRRQLGWKNENRPNNLTGSQSHSFSTRYNSRSRSRSRDKYNYRSHQKYRYSRSRTKSSSRYTPYTRYSRYTESYERSQSSCSDSKSRSEITSYTSNSFSSNRKSEIVSNPKLL+SEKNKNGLNRST SLTSVQHSVIKVFTP+NK+YDDHYKISLFNDKYLSETDQNHSTDLSPSPVSNIASNQSSDSYSS STSIAFVSPQNLQRHKKYLSSNDSSSDYSIEYMDQSLFLQQSQNHNNETESDSEIEWMTVEEYDKLMGNEFNTSNSSSSTSSCCSS+YSFSDIEWIENQQLNSLSDDYIRI
Sbjct:    1 MNKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSYKNSRIFTGELWKQLLNSLESNEVGKSENQKLNSDKIKSFPRLGPSENKPPSNDVSNQNKFKDKLNYFYNVIFLIFGINTYFRRQLGWKNENRPNNLTGSQSHSFSTRYNSRSRSRSRDKYNYRSHQKYRYSRSRTKSSSRYTPYTRYSRYTESYERSQSSCSDSKSRSEITSYTSNSFSSNRKSEIVSNPKLLESEKNKNGLNRSTNSLTSVQHSVIKVFTPDNKDYDDHYKISLFNDKYLSETDQNHSTDLSPSPVSNIASNQSSDSYSSYSTSIAFVSPQNLQRHKKYLSSNDSSSDYSIEYMDQSLFLQQSQNHNNETESDSEIEWMTVEEYDKLMGNEFNTSNSSSSTSSCCSSKYSFSDIEWIENQQLNSLSDDYIRI 458          
BLAST of PWI domain-containing protein vs. Planmine SMEST
Match: SMESG000013292.1 (SMESG000013292.1)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 450/471 (95.54%), Postives = 455/471 (96.60%), Query Frame = 1
Query:   94 MNKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPK-------------FPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVGKSENQKLNSDKIKSFPRLGPSENKPPSNDVSNQNKFKDKLNYFYNVIFRIFGINTYFRRQLGWKNENRPNNLTGSQSHSFXXXXXXXXXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEITSYTSNSFSSNRKSEIVSNPKLLKSEKNKNGLNRSTYSLTSVQHSVIKVFTPNNKEYDDHYKISLFNDKYLSETDQNHSTDLSPSPVXXXXXXXXXXXXXXXXXXIAFVSPQNLQRHKKYLXXXXXXXXXXIEYMDQSLFLQQSQNHNNETESDSEIEWMTVEEYDKLMGNXXXXXXXXXXXXXXXXXXXXXXDIEWIENQQLNSLSDDYIRI 1467
            MNKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPK             FPDPKEIQTNLSGFLS+KNSRIFTGELWKQLLNSLESNEVGKSENQKLNSDKIKSFPRLGPSENKPPSNDVSNQNKFKDKLNYFYNVIF IFGINTYFRRQLGWKNENRPNNLTGSQSHSFSTRYNSRSRSRSRDKYNYRSHQKYRYSRSRTKSSSRYTPYTRYSRYTESYERSQSSCSDSKSRSEITSYTSNSFSSNRKSEIVSNPKLL+SEKNKNGLNRST SLTSVQHSVIKVFTP+NK+YDDHYKISLFNDKYLSETDQNHSTDLSPSPVSNIASNQSSDSYSS STSIAFVSPQNLQRHKKYLSSNDSSSDYSIEYMDQSLFLQQSQNHNNETESDSEIEWMTVEEYDKLMGNEFNTSNSSSSTSSCCSS+YSFSDIEWIENQQLNSLSDDYIRI
Sbjct:    1 MNKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKVVNFFYWQIVQPMFPDPKEIQTNLSGFLSYKNSRIFTGELWKQLLNSLESNEVGKSENQKLNSDKIKSFPRLGPSENKPPSNDVSNQNKFKDKLNYFYNVIFLIFGINTYFRRQLGWKNENRPNNLTGSQSHSFSTRYNSRSRSRSRDKYNYRSHQKYRYSRSRTKSSSRYTPYTRYSRYTESYERSQSSCSDSKSRSEITSYTSNSFSSNRKSEIVSNPKLLESEKNKNGLNRSTNSLTSVQHSVIKVFTPDNKDYDDHYKISLFNDKYLSETDQNHSTDLSPSPVSNIASNQSSDSYSSYSTSIAFVSPQNLQRHKKYLSSNDSSSDYSIEYMDQSLFLQQSQNHNNETESDSEIEWMTVEEYDKLMGNEFNTSNSSSSTSSCCSSKYSFSDIEWIENQQLNSLSDDYIRI 471          
BLAST of PWI domain-containing protein vs. Planmine SMEST
Match: SMESG000023657.1 (SMESG000023657.1)

HSP 1 Score: 120.939 bits (302), Expect = 9.395e-29
Identity = 51/90 (56.67%), Postives = 74/90 (82.22%), Query Frame = 1
Query:  100 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNS 369
            KLM++MKF DIL+N++DM  +DL  +KPWI+KR+TEL   +D+V++ Y++NQLE K P+PKEIQ NL+GFL+ KNSR+F  ELW+ L+++
Sbjct:   23 KLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISA 112          
The following BLAST results are available for this feature:
BLAST of PWI domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRRM15.215e-2152.94serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM15.977e-2152.94serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM16.046e-2152.94serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM11.067e-2054.67serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM19.958e-1854.67serine and arginine repetitive matrix 1 [Source:HG... [more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rsr-16.627e-1636.67SR protein related [Source:UniProtKB/TrEMBL;Acc:O... [more]
rsr-16.627e-1636.67SR protein related [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SRm1605.568e-2753.68gene:FBgn0036340 transcript:FBtr0075883[more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
srrm12.293e-2048.24serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
srrm11.778e-1848.24serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
srrm11.913e-1848.24serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
srrm15.014e-946.94serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srrm19.210e-2254.12serine and arginine repetitive matrix 1 [Source:NC... [more]
srrm19.637e-2254.12serine and arginine repetitive matrix 1 [Source:NC... [more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srrm14.016e-2352.94serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm13.779e-2152.94serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm14.801e-2152.94serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm15.096e-2152.94serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm15.113e-2152.94serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
back to top
BLAST of PWI domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZMJ9|SRRM1_CHICK1.596e-2052.94Serine/arginine repetitive matrix protein 1 OS=Gal... [more]
sp|Q5R5Q2|SRRM1_PONAB2.681e-2052.94Serine/arginine repetitive matrix protein 1 OS=Pon... [more]
sp|Q8IYB3|SRRM1_HUMAN2.903e-2052.94Serine/arginine repetitive matrix protein 1 OS=Hom... [more]
sp|Q52KI8|SRRM1_MOUSE3.263e-2052.94Serine/arginine repetitive matrix protein 1 OS=Mus... [more]
sp|Q9USH5|YJQ5_SCHPO5.684e-1438.18PWI domain-containing protein C825.05c OS=Schizosa... [more]
back to top
BLAST of PWI domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L7LMN43.880e-2758.06Serine/arginine repetitive matrix protein 1 (Fragm... [more]
A0A5E4PRA51.211e-2657.73PWI domain-containing protein OS=Leptidea sinapis ... [more]
H2XTZ81.658e-2656.70PWI domain-containing protein OS=Ciona intestinali... [more]
A0A5E4PP262.154e-2657.73PWI domain-containing protein OS=Leptidea sinapis ... [more]
A0A5E4PQH62.156e-2657.73PWI domain-containing protein OS=Leptidea sinapis ... [more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000054963.16.999e-2149.41pep primary_assembly:Astyanax_mexicanus-2.0:9:7602... [more]
ENSAMXT00000046927.16.923e-1048.98pep primary_assembly:Astyanax_mexicanus-2.0:9:7604... [more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PWI domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PWI domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO325612.043e-2749.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281812.679e-755.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PWI domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000021894.21.988e-2149.41pep primary_assembly:ASM223467v1:22:16875116:16883... [more]
back to top
BLAST of PWI domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000013292.10.000e+098.25SMESG000013292.1[more]
SMESG000013292.10.000e+095.54SMESG000013292.1[more]
SMESG000023657.19.395e-2956.67SMESG000023657.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033025 ID=SMED30033025|Name=PWI domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1555bp
TGCGGATCTAACATTTGTAATTATATTTAATTTTAATCTTTTAAGGTTAT
TATCATTTTAAAGCAAATTATAATAAATACTAAGTTTGAATTAATGAACA
AATTGATGAAAGAAATGAAATTTGATGACATTTTAAATAATCGAGTGGAT
ATGGAAAATGTAGATCTTACTTTCGTGAAGCCATGGATTAGTAAAAGAAT
TACCGAACTTACTAAGGATGAAGACGAAGTCTTGATAGATTATATATACA
ATCAACTGGAACCGAAATTTCCAGATCCGAAAGAAATACAAACGAATTTA
TCCGGATTTCTGTCCCATAAAAACTCGCGAATTTTTACTGGTGAATTATG
GAAACAGTTATTAAATTCCCTGGAATCCAACGAGGTTGGAAAAAGTGAAA
ATCAAAAGCTTAATAGTGATAAAATAAAAAGTTTTCCTAGATTAGGACCT
TCTGAAAATAAACCGCCCAGTAATGATGTTTCTAATCAAAATAAATTCAA
AGACAAACTCAATTATTTTTATAACGTCATATTCCGCATTTTTGGAATTA
ATACATATTTCAGACGGCAATTAGGATGGAAGAACGAAAATCGTCCGAAT
AATTTAACAGGCTCTCAATCACATTCATTTTCCACCCGTTATAATAGCAG
AAGTAGATCAAGATCTCGCGATAAATATAATTATAGAAGTCATCAAAAAT
ACAGATATAGCAGATCTCGAACTAAAAGTTCTAGTAGATATACACCTTAT
ACTAGATATTCACGATATACTGAATCATATGAAAGGAGTCAGTCTTCATG
CAGTGATTCAAAATCTCGTTCTGAGATAACTTCTTATACTTCGAATTCAT
TTTCCTCTAATAGGAAATCTGAAATTGTGTCCAATCCAAAATTATTAAAA
TCTGAGAAGAATAAGAATGGTTTAAATCGGTCAACATATTCACTCACTAG
TGTCCAGCATTCAGTTATTAAAGTCTTTACTCCTAACAATAAAGAATATG
ACGATCATTATAAGATTTCATTGTTTAATGATAAATATCTGTCAGAAACG
GATCAAAATCATTCTACCGATTTATCACCGTCTCCCGTGAGCAATATAGC
AAGTAACCAAAGCTCCGACAGCTATAGTAGCTGTTCGACTTCTATTGCAT
TCGTAAGTCCGCAGAATCTTCAACGGCATAAAAAATACCTTTCATCCAAC
GATTCCTCGTCCGATTATTCTATTGAATATATGGATCAGAGTTTATTTTT
GCAGCAATCTCAAAATCATAACAATGAAACTGAGAGTGACAGTGAGATAG
AATGGATGACAGTTGAAGAATATGATAAGTTAATGGGAAATGAATTTAAC
ACGTCCAATAGTTCAAGCTCAACCAGTTCATGCTGTAGTTCTGAATATTC
ATTTAGCGATATTGAATGGATAGAAAATCAGCAACTCAACAGTTTGTCGG
ACGATTATATAAGGATATAACCTGTGTTTTATATTAGATCAATTTTTATT
TACCGTTTTTATTTTTATGAATTTGTTAAATATAGTTAGTAAACTTGTTT
TTACA
back to top

protein sequence of SMED30033025-orf-1

>SMED30033025-orf-1 ID=SMED30033025-orf-1|Name=SMED30033025-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=459bp
MNKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDY
IYNQLEPKFPDPKEIQTNLSGFLSHKNSRIFTGELWKQLLNSLESNEVGK
SENQKLNSDKIKSFPRLGPSENKPPSNDVSNQNKFKDKLNYFYNVIFRIF
GINTYFRRQLGWKNENRPNNLTGSQSHSFSTRYNSRSRSRSRDKYNYRSH
QKYRYSRSRTKSSSRYTPYTRYSRYTESYERSQSSCSDSKSRSEITSYTS
NSFSSNRKSEIVSNPKLLKSEKNKNGLNRSTYSLTSVQHSVIKVFTPNNK
EYDDHYKISLFNDKYLSETDQNHSTDLSPSPVSNIASNQSSDSYSSCSTS
IAFVSPQNLQRHKKYLSSNDSSSDYSIEYMDQSLFLQQSQNHNNETESDS
EIEWMTVEEYDKLMGNEFNTSNSSSSTSSCCSSEYSFSDIEWIENQQLNS
LSDDYIRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036483PWI_dom_sf
IPR002483PWI_dom
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002483PWI domainSMARTSM00311pwi_2coord: 20..95
e-value: 3.8E-13
score: 59.7
IPR002483PWI domainPFAMPF01480PWIcoord: 28..95
e-value: 6.6E-22
score: 77.6
IPR002483PWI domainPROSITEPS51025PWIcoord: 7..108
score: 27.797
NoneNo IPR availableGENE3DG3DSA:1.20.1390.10coord: 4..111
e-value: 1.1E-28
score: 101.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 167..219
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 167..185
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..131
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..200
NoneNo IPR availablePANTHERPTHR23148:SF0SERINE/ARGININE REPETITIVE MATRIX PROTEIN 1coord: 3..95
NoneNo IPR availablePANTHERPTHR23148SERINE/ARGININE REGULATED NUCLEAR MATRIX PROTEINcoord: 3..95
NoneNo IPR availableTMHMMTMhelixcoord: 139..156
IPR036483PWI domain superfamilySUPERFAMILYSSF101233PWI domaincoord: 5..95