Fizzy/cell division cycle 20 related 1a

Overview
NameFizzy/cell division cycle 20 related 1a
Smed IDSMED30033024
Length (bp)2127
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fizzy/cell division cycle 20 related 1a (SMED30033024) t-SNE clustered cells

Violin plots show distribution of expression levels for Fizzy/cell division cycle 20 related 1a (SMED30033024) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fizzy/cell division cycle 20 related 1a (SMED30033024) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fizzy/cell division cycle 20 related 1a (SMED30033024) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033024

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30033024SMESG000011293.1 SmedASXL_006835SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30033024SMESG000011293.1 dd_Smed_v4_4796_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Human
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:HGNC Symbol;Acc:HGNC:24824])

HSP 1 Score: 482.256 bits (1240), Expect = 8.307e-164
Identity = 263/518 (50.77%), Postives = 326/518 (62.93%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEKVYH-DRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL          + P V+ ++ T +  +        H DRFIP R  A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++    ++     S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNAE L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKD----ATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 482          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Human
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:HGNC Symbol;Acc:HGNC:24824])

HSP 1 Score: 482.256 bits (1240), Expect = 8.307e-164
Identity = 263/518 (50.77%), Postives = 326/518 (62.93%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEKVYH-DRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL          + P V+ ++ T +  +        H DRFIP R  A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++    ++     S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNAE L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKD----ATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 482          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Human
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:HGNC Symbol;Acc:HGNC:24824])

HSP 1 Score: 481.485 bits (1238), Expect = 1.547e-163
Identity = 263/517 (50.87%), Postives = 325/517 (62.86%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEKVYH-DRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKA 1551
            MD  YERRL          + P V+ ++ T +  +        H DRFIP R  A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++    ++     S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNAE L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK 
Sbjct:    1 MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKD----ATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKV 481          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Human
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:HGNC Symbol;Acc:HGNC:24824])

HSP 1 Score: 371.318 bits (952), Expect = 6.582e-122
Identity = 184/294 (62.59%), Postives = 214/294 (72.79%), Query Frame = 1
Query:  676 INRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            + RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNAE L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:  130 VTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 393          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Human
Match: CDC20 (cell division cycle 20 [Source:HGNC Symbol;Acc:HGNC:1723])

HSP 1 Score: 322.783 bits (826), Expect = 6.854e-102
Identity = 188/493 (38.13%), Postives = 264/493 (53.55%), Query Frame = 1
Query:   85 GSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSA--------LWKENKQEHYQMFDIENIQN---LPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            G  P  +P KS  S+  +T   K   DR+IP R++A        L KEN+ E+ Q    +  Q    L +N  D +   I  L G                      P +  E  +N   + + Q                      K    S R   R IP  P ++LDAP++++D+YLNLVDWSS NVLAV L   VYLW+A S +I +L  +    + I+SVAW ++G  +AVGT   +VQ+WD   +++L+ +  H+ARVG+L+WN+ +L+SGSR  ++H  D R +      L  H QEVCGL+W+ D ++LASGGNDN + VW   S  G GG +                        P   +  H  AVKA+AW P Q+ +LA+GGGT+DR I+ WN+ +   + +VD  SQVC+I WSPH  EL+S HG++QNQ+V+WKYP    +A+L GH+ RVL L +SPDG+ V + A DETLR W  FE
Sbjct:   53 GRTPGRTPGKS--SSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSG---------------------KPQNAPEGYQNRLKVLYSQ----------------------KATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVW--PSAPGEGGWV------------------------PLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFE 474          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Celegans
Match: fzr-1 (FiZzy Related family [Source:UniProtKB/TrEMBL;Acc:Q09649])

HSP 1 Score: 429.098 bits (1102), Expect = 1.044e-140
Identity = 203/358 (56.70%), Postives = 251/358 (70.11%), Query Frame = 1
Query:  469 GIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDV--NSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEK 1533
            G PF  +++R+L++PR   RK+PK PYKVLDAP+LQDDFYLNLVDWSSQN L+VGL  CVYLW+A +S++ +LCD+   ++ D +TSV WC+KG  +AVGT  G  QIWD   +++ + L GH++RVG LAWNA+ + SGSRDR +  RD R    +  + L  HRQEVCGLKWS DKQ LASGGNDN+L+VWNL                                  P   Y  H AAVKA+AWSPH +GLL SGGGTADRC++FWN LT Q +  VDTGSQVCN+AWS HS+ELVSTHGYS N +++WKYP   P+ KL GH  RVLYLA+SPDG ++VTGAGDETLRFW+VF K
Sbjct:  357 GGPFGVDSQRLLRTPRKPIRKVPKNPYKVLDAPELQDDFYLNLVDWSSQNQLSVGLAACVYLWSATTSQVIKLCDLGQTNEQDQVTSVQWCDKGDLLAVGTSRGVTQIWDVTTQKKTRELTGHSSRVGCLAWNADTICSGSRDRTIMHRDIRCDDNDMGRKLTNHRQEVCGLKWSPDKQLLASGGNDNQLLVWNLRRN------------------------------EPIQTYTQHNAAVKALAWSPHHHGLLVSGGGTADRCLRFWNTLTAQPMQCVDTGSQVCNVAWSKHSSELVSTHGYSFNHVIIWKYPSLQPVTKLVGHQYRVLYLAMSPDGESIVTGAGDETLRFWHVFNK 684          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Celegans
Match: fzy-1 (WD repeat-containing protein fzy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09373])

HSP 1 Score: 112.079 bits (279), Expect = 9.469e-26
Identity = 117/505 (23.17%), Postives = 223/505 (44.16%), Query Frame = 1
Query:  100 VSPVKSTHSTPNKTPVEKVYHDRFIPVR--NSALWKENKQEHYQMF-DIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTK-RILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDT--ITSVAWCEKGTRVAVGTHHGKVQIWD------AAAEQQLQTLE-GHTARVGTLAWNAE-LLASGSRDRNVHLRDTRTSS---TEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTR----QAVHSVDTGSQVCNIAWSPHSNEL-VSTHGYSQNQIVVWKYPGCTPLA-KLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKST 1545
            ++P ++T+  PN T V     DRF+ VR     L   N     +++ + EN+ N     N  + KS+    G+ +   +   +  +           + +    + +L +++    P  + + +   + +S N+      S +  TR + +   KVLD P L  D Y   +DW   N +AV LG  +YLWN  +  I  L + N+ ++   ITSV W ++G  +++G   G V+I+D          ++L+TL  G  +R  ++AW  + ++  G +  ++   D R S    + +     H ++V  L+WS D+    SG +D    +W+                G    GS+V  +       P    + H   V+   +   ++G+LA+GGG  D  +K W++  +    + ++  +TG     +   P+S  L  S  G+    + ++++     L+ ++   +  ++ L  SP    V+ G  +ETL+ + +F   KST
Sbjct:   31 MTPTRNTNLLPNATFV----GDRFLGVRLDQDELDHANHLMTSKLYSNKENLNNSMSEPNSPEKKSVE---GEALKQMMRHKSTGA-----------LTDADDGDRILCYKKNLAPPPAIGYINQAKVLYSTNSVINPASSVKKSTRHVKETATKVLDGPGLTKDLYSRHLDWGCHNWVAVALGHELYLWNTETCVIKNLFEDNAPTNEGLITSVRWSQEGRYISLGYASGAVKIYDPNRPKTTEYVRELRTLRVGGASRCASIAWRKQGVMTCGYKSGDIVNHDVRISQHVVSSWGGDNGHCRDVTALEWSADENMCVSGSSDRTAKIWD----------------GRHVRGSTVIQDP-----EPMFTIDEHTGQVRTAQFCSFRDGILATGGGINDGTVKLWDVKRQFQKVRELNVCETGGVGGIVFNRPYSEMLTASDDGF----LRIYRFNANYKLSHEIQASNEPIMDLVGSP-FDEVLIGDMEETLKVFQLFNVDKST 491          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Celegans
Match: W07E6.2 (pep chromosome:WBcel235:II:480722:484386:-1 gene:WBGene00021074.1 transcript:W07E6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E6.2)

HSP 1 Score: 68.5514 bits (166), Expect = 8.180e-12
Identity = 72/289 (24.91%), Postives = 125/289 (43.25%), Query Frame = 1
Query:  715 ITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQL-QTLEGHTARVGTLAWN-------AELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPF--IIYENHAAAVKAIAWSPHQNGLLASGG-----GTADRCIKFWNIL-TRQAVHSVDTGSQVCN-IAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            +  +AW    T++A    +G++ IW+A   +Q+ +TL+ H   + +LAW          LLAS  +D N+ + DT    T  + L  H   V  L+W   +  + SG  D  + +W       M   +   A    T   + +    + C  P    I  +     + +A + ++  L  +GG     G+ D  +  WN   T+Q+++ +    Q+ N + +SP +  + S        + +W       LA L GH   V  +A S D   +V+G+ D TL+   VFE
Sbjct:  150 VLCIAWSPDATKIASACKNGEICIWNAKTGEQIGKTLKRHKQWITSLAWQPMHKDPTCRLLASCGKDGNIFIWDT-VQGTVVRCLSGHTASVTCLRWG-GEGLIYSGSQDRTVKMWR-ADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVAQTRYEAALEIAGGERLVSGSDDFTLFMWNPKETKQSINRMTGHMQLVNQVVFSPDTRYIASAS--FDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLK---VFE 430          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Celegans
Match: prp-4 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q93339])

HSP 1 Score: 67.0106 bits (162), Expect = 2.587e-11
Identity = 55/258 (21.32%), Postives = 108/258 (41.86%), Query Frame = 1
Query:  751 VAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAW--NAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFW 1518
            V   ++ G V +W  + E  +  LE H  RV  +A+  N   LA+   D    + D  T+  E    + H + V  + +  D     +GG+D    VW++  R+G                          C+   +  + H   + ++ W P+   ++    G++D  +K W++  R+  +++   + V     +  + + + +  +    + +W   G  PL +L GH  R+L + +SPDG  + + A D T + W
Sbjct:  269 VVSCSYDGTVLLWSLSQESPIGELEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDL-TTKKELLYQEGHSKSVADVAFHPDGSVALTGGHDCYGRVWDM--RTGR-------------------------CI---MFLDGHTKEIHSVEWMPNGYEMIT---GSSDNSMKVWDLRMRRNTYTMPAHTSVVTRVRADAAGQYLVSASFDCT-LKMWSTTGWQPLRQLQGHDTRILCVDISPDGQWMCSSAFDRTFKLW 491          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 65.0846 bits (157), Expect = 7.957e-11
Identity = 52/192 (27.08%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  712 TITSVAW--CEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAE---LLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWS-LDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNI 1269
             +  VAW     G   +VG    K+ IWD         ++ H+A V  LA+N     +LA+GS D+ V L D R    +    + HR E+  ++WS  ++  LAS G D RL VW+L+                G   S+ ++  G   L    I+  H A +   +W+P++  ++ S   + D  ++ W +
Sbjct:  224 VVEDVAWHVLHDGVFGSVGDD-KKLLIWDVRTSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSK--------------IGEDQSAEDAEDGPPEL--LFIHGGHTAKISDFSWNPNEPWVVCS--VSEDNILQVWQM 396          

HSP 2 Score: 54.299 bits (129), Expect = 2.004e-7
Identity = 50/223 (22.42%), Postives = 100/223 (44.84%), Query Frame = 1
Query:  823 EGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSST-----EFKPL---KEHRQEVCGLKWSLDKQYLASGGNDNRLVV-WNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLN----------------------PFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILT-RQAVHSVDTG-SQVCNIAWSPHSNELVSTHGYSQNQIVVW 1392
            EG   R   +   + ++A+ S   +V++ D    S       F PL   K H +E  GL W+ +K+ L    +D++ V  W++ +   + G L  +    G    SV  +   + L+                      P    + H+A V  +A++P+   +LA+G  +AD+ +  W++   R  +HS ++   ++  + WSPH+  ++++ G +  ++ VW
Sbjct:  120 EGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVPRDNTFNPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGH--ESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTSTPGHCIDAHSAEVNCLAFNPYSEFILATG--SADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSG-TDKRLHVW 337          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Fly
Match: fzr (gene:FBgn0262699 transcript:FBtr0070687)

HSP 1 Score: 473.011 bits (1216), Expect = 8.613e-161
Identity = 258/508 (50.79%), Postives = 321/508 (63.19%), Query Frame = 1
Query:   52 LMDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDC-----DSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI---PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            +    YE+R+       SPV        ++       DRFIP R    W+ N     +  D  N         DC     DS + + LL + +   L S  ++      E N N+     + + +  +    +SP+K  +         P S  ++++L+SPR  TRKI + P+KVLDAP+LQDDFYLNLVDWSSQNVLAVGLG+CVYLW+A +S++ RLCD++ D++T+TSV+W E+G  VAVGTHHG V +WD AA +Q+  L GH+ARVG LAWN+++L+SGSRDR +  RDTRT   +  + L  HRQEVCGLKWS D QYLASGGNDNRL VWN                               + +NP   Y  H AAVKAIAWSPH +GLLASGGGTADRCI+FWN LT Q +  VDTGSQVCN+AWS HS+ELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLALSPDG  +VTGAGDETLRFWNVF K +S K
Sbjct:    1 MFSPEYEKRIL---KHYSPVARNLFNNFESSTTPTSLDRFIPCRAYNNWQTNFASINKSND--NSPQTSKKQRDCGETARDSLAYSCLLKNEL---LGSAIDDVKTAGEERNENAYTPAAKRS-LFKY----QSPTKQDYNGECPYSLSPVSAKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVTSVSWNERGNTVAVGTHHGYVTVWDVAANKQINKLNGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWN------------------------------QHSVNPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFSKARSQK 465          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Fly
Match: fzr (gene:FBgn0262699 transcript:FBtr0070686)

HSP 1 Score: 473.011 bits (1216), Expect = 8.613e-161
Identity = 258/508 (50.79%), Postives = 321/508 (63.19%), Query Frame = 1
Query:   52 LMDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDC-----DSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI---PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            +    YE+R+       SPV        ++       DRFIP R    W+ N     +  D  N         DC     DS + + LL + +   L S  ++      E N N+     + + +  +    +SP+K  +         P S  ++++L+SPR  TRKI + P+KVLDAP+LQDDFYLNLVDWSSQNVLAVGLG+CVYLW+A +S++ RLCD++ D++T+TSV+W E+G  VAVGTHHG V +WD AA +Q+  L GH+ARVG LAWN+++L+SGSRDR +  RDTRT   +  + L  HRQEVCGLKWS D QYLASGGNDNRL VWN                               + +NP   Y  H AAVKAIAWSPH +GLLASGGGTADRCI+FWN LT Q +  VDTGSQVCN+AWS HS+ELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLALSPDG  +VTGAGDETLRFWNVF K +S K
Sbjct:    1 MFSPEYEKRIL---KHYSPVARNLFNNFESSTTPTSLDRFIPCRAYNNWQTNFASINKSND--NSPQTSKKQRDCGETARDSLAYSCLLKNEL---LGSAIDDVKTAGEERNENAYTPAAKRS-LFKY----QSPTKQDYNGECPYSLSPVSAKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVTSVSWNERGNTVAVGTHHGYVTVWDVAANKQINKLNGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWN------------------------------QHSVNPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFSKARSQK 465          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Fly
Match: fzr2 (gene:FBgn0034937 transcript:FBtr0072146)

HSP 1 Score: 365.925 bits (938), Expect = 1.944e-119
Identity = 193/439 (43.96%), Postives = 274/439 (62.41%), Query Frame = 1
Query:  238 ENIQNLPINNNDCDSKSITNLL-GDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
             N  N P ++N  +S   + LL  + +D  + S  N           +   +  R+N +  F     SP +  FA+      SE+++R+L   +   R++P+ PYK+LDAP+LQDDFYLNL+DWSS+N LAVGLG  VYLW+AVS ++ RLCD N++ + IT+V+W  +G +VA+GT  G V IWDA  ++Q+  LE H+ARV  LAW    LASGSRDR++  RD R   T   + L+ H+ EVCGL+WS   +YLASGG+DNRL+VW                                    P   ++ H A VKA+ WSPH++GLLASGGG+ADRC++FWN+LT + V  ++TG+Q+ N+AW+  S ELV+THG++Q Q++ W+YP    +A+L+GH+ RVL+L++SPD  ++VTG  DETLRFW VF KQK +K
Sbjct:   37 RNFVNAPGDSNVYESSVYSCLLRNEFLDENITSLENCEQTAQVHAQTDDFRD--RHNRIFGFASGSSSPVRTPFAN-----ISESSQRLLSIFKRPMRRLPRRPYKILDAPELQDDFYLNLIDWSSKNTLAVGLGCSVYLWSAVSGQVTRLCDFNNEDNLITAVSWHGEGRQVAIGTQSGYVTIWDAENQKQINRLEEHSARVTALAWCGNRLASGSRDRSILQRDIRNPPTHITRCLRGHKLEVCGLQWSPSNRYLASGGSDNRLLVWT------------------------------DDWPEPIYAFDEHKAVVKALGWSPHKSGLLASGGGSADRCLRFWNVLTGKLVKCINTGAQISNLAWARDSRELVTTHGHAQPQVIAWRYPSLKQMARLSGHTQRVLHLSVSPDNESIVTGGADETLRFWTVFTKQKISK 438          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Fly
Match: fzy (gene:FBgn0001086 transcript:FBtr0080833)

HSP 1 Score: 324.709 bits (831), Expect = 1.478e-102
Identity = 185/482 (38.38%), Postives = 265/482 (54.98%), Query Frame = 1
Query:  112 KSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTK----------RILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVF 1527
            K +++TP+KTP      DRFIP R +             F++ +     + N D   KS      D  + +  S  +N  N  A     S  +  R   +    Q+ +S    +  +    P +  T           +   S +  +R IP    ++LDAPD  +D+YLNL+DWS+ N++AV LG+CVYLWNA +  I +L +   + D   S++W ++G  +A+G   G V++WD +  ++L+ ++GH+ARVG+LAWN+ L++SGSRD  +   D R    +   L  H QEVCGLKWS D +YLASGGNDN + VW  ++ SG  GT  D                      P   + +H AAV+A+AW P Q   LASGGGTADRCIKFWN+     + SVD+ SQVC++ +S H  EL+S HG++ NQ+ +WKYP     A LTGH+ RVL +A+SPDGS V++   DETLR WN F
Sbjct:   73 KKSNTTPSKTPGGG---DRFIPNRAAT-----------NFELAHF----LVNKDSGDKS------DEENDKATSSNSNESNVQA-----SAHKGDRQKLISEVAQVGDSKGGRILCYQNKAPAAPETHNNPLKVVYSIKTPISTKSGSRYIPTTSERILDAPDFINDYYLNLMDWSADNIVAVALGSCVYLWNAQTGNIEQLTEFE-EGDYAGSLSWIQEGQILAIGNSTGAVELWDCSKVKRLRVMDGHSARVGSLAWNSFLVSSGSRDGTIVHHDVRAREHKLSTLSGHTQEVCGLKWSTDFKYLASGGNDNLVNVW--SAASGGVGTATD----------------------PLHKFNDHQAAVRALAWCPWQPSTLASGGGTADRCIKFWNVNNGTLMKSVDSKSQVCSLLFSRHYKELISAHGFANNQLTIWKYPTMVKQADLTGHTSRVLQMAMSPDGSTVISAGADETLRLWNCF 500          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Fly
Match: CG3436 (gene:FBgn0031229 transcript:FBtr0078119)

HSP 1 Score: 72.4034 bits (176), Expect = 2.817e-13
Identity = 56/240 (23.33%), Postives = 98/240 (40.83%), Query Frame = 1
Query:  811 LQTLEGHTARVGTLAWN--AELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNV 1524
            +  LEGH   + T  ++   ELL S   DR +++            +  H   V    ++ D  ++ +   D  L  W++ +        G R                         ++ H   V ++  S     LL SG  + DR IK W+   + A H++++  QV  + +     +++S  G   N++ +W       L  L GHS  +  ++LSP+G  ++T A D TLR W+V
Sbjct:   48 IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIAT--------GQRQRR----------------------FKGHGNFVNSVQGSRRGQQLLCSG--SDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVIS--GGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDV 253          

HSP 2 Score: 64.3142 bits (155), Expect = 1.343e-10
Identity = 74/382 (19.37%), Postives = 153/382 (40.05%), Query Frame = 1
Query:  394 RRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWN---AELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            R NN+++  ++ + S + L+        ++   K +L+S     R+       ++     + + +        + +L+ G    +Y+W  V  +   +  ++  S  +    +   G+ +   +    +  WD A  Q+ +  +GH   V ++  +    +LL SGS DR + + D R          E   +V  + +    + + SGG DN + +W++  ++ +    G   T    TG S++          FI+       ++     P+  G         +RC+K +        H  +    +   AWSP S+++ S  G +   + +W       L KL GH+  V  +  SP    +++G+ D+TL    + E
Sbjct:    5 RPNNSVILAQEAKRSKNDLM-------AYTNRDKALLESG---VRRTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQ-VYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHT--LESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDT---ITGMSLSPEG------DFILTNAMDNTLRVWDVRPYAPG---------ERCVKVFQ------GHQHNFEKNLLRCAWSPGSDKITS--GSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE 347          

HSP 3 Score: 50.0618 bits (118), Expect = 4.638e-6
Identity = 23/69 (33.33%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1345 ELVSTHGYSQNQIVVWK-YPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            EL+ + G+ + QI +W+ Y  C  +  ++GHS  V+    +PDGS++ T + D+TL FW++   Q+  +
Sbjct:   68 ELLLSSGFDR-QIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRR 135          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Zebrafish
Match: fzr1a (fizzy/cell division cycle 20 related 1a [Source:ZFIN;Acc:ZDB-GENE-040426-712])

HSP 1 Score: 479.945 bits (1234), Expect = 4.525e-163
Identity = 263/519 (50.67%), Postives = 329/519 (63.39%), Query Frame = 1
Query:   55 MDSSYERRLFGSPPF----VSPVKST----HSTPN-KTPVEK--VYHDRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL           SP+K+     H TP  ++P+     + DRFIP R  A W        EN++   Q    +  ++   ++   D  + + LL + +         +    D    P++    RR+    S    R +P     +  +  P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDA A ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              + P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYERRLLRQINVQNDNTSPMKAKDVICHLTPTPESPLSSPSKHGDRFIPSRAGANWSINFHRINENEKSPSQN---KKTKDATSDSGKADGLAYSALLKNELLGAGIEKVLDPQTEDRRLQPST--PERRSLFSYSLSAKRSTPDDNSVSPYSLSPVSSKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDATAGKKLFALEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------VLPMQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCIDTGSQVCNLAWSKHTNELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 484          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Zebrafish
Match: fzr1a (fizzy/cell division cycle 20 related 1a [Source:ZFIN;Acc:ZDB-GENE-040426-712])

HSP 1 Score: 479.945 bits (1234), Expect = 4.525e-163
Identity = 263/519 (50.67%), Postives = 329/519 (63.39%), Query Frame = 1
Query:   55 MDSSYERRLFGSPPF----VSPVKST----HSTPN-KTPVEK--VYHDRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL           SP+K+     H TP  ++P+     + DRFIP R  A W        EN++   Q    +  ++   ++   D  + + LL + +         +    D    P++    RR+    S    R +P     +  +  P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDA A ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              + P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYERRLLRQINVQNDNTSPMKAKDVICHLTPTPESPLSSPSKHGDRFIPSRAGANWSINFHRINENEKSPSQN---KKTKDATSDSGKADGLAYSALLKNELLGAGIEKVLDPQTEDRRLQPST--PERRSLFSYSLSAKRSTPDDNSVSPYSLSPVSSKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDATAGKKLFALEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------VLPMQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCIDTGSQVCNLAWSKHTNELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 484          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Zebrafish
Match: fzr1b (fizzy/cell division cycle 20 related 1b [Source:ZFIN;Acc:ZDB-GENE-131120-69])

HSP 1 Score: 472.626 bits (1215), Expect = 2.161e-160
Identity = 261/513 (50.88%), Postives = 320/513 (62.38%), Query Frame = 1
Query:   55 MDSSYERRLF-----GSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLS-----FR---QIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL       + P   P K +  T    PV     DRFIP R  + W  N       F   N      N N     + T+   D + +  A   N       E  P+   ++RR+  +       FR     +  P     +  +  P S  + ++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWS+ N+L+VGLG CVYLW+A +S++ RLCD++ D D++TSV W E+G+ VAVGTH G VQIWDAA  ++L +LEGH+ARVG LAWN E L+SGSRDR +  RD RT     + L+ HRQEVCGLKWS D Q+LASGGNDN+L+VWN +S                              L P   Y +H AAVKAIAWSPHQ+GLLASGGGTADRC++FWN LT QA+ S DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K + TK +
Sbjct:    1 MDQDYERRLLRQINHQNVPEGHPTKVSMKT--SIPVSVKSGDRFIPTRAGSNWSIN-------FHYANENCWSPNQNQRAKDASTDTGKDAV-AYAALLRNELLGAGIETVPDPHTDDRRHTILTQDTHSLFRYTIHTKRVPFDNEISPYSLSPLSNKSHKLLRSPRKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLSVDGDSVTSVCWNERGSLVAVGTHKGFVQIWDAAGGRKLTSLEGHSARVGALAWNGEQLSSGSRDRVILQRDVRTPPPVERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSS------------------------------LLPVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVFSKTRCTKES 473          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Zebrafish
Match: fzr1b (fizzy/cell division cycle 20 related 1b [Source:ZFIN;Acc:ZDB-GENE-131120-69])

HSP 1 Score: 471.085 bits (1211), Expect = 7.277e-160
Identity = 260/513 (50.68%), Postives = 321/513 (62.57%), Query Frame = 1
Query:   55 MDSSYERRLF-----GSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLS-----FR---QIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL       + P   P K ++     +PV     DRFIP R  + W  N       F   N      N N     + T+   D + +  A   N       E  P+   ++RR+  +       FR     +  P     +  +  P S  + ++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWS+ N+L+VGLG CVYLW+A +S++ RLCD++ D D++TSV W E+G+ VAVGTH G VQIWDAA  ++L +LEGH+ARVG LAWN E L+SGSRDR +  RD RT     + L+ HRQEVCGLKWS D Q+LASGGNDN+L+VWN +S                              L P   Y +H AAVKAIAWSPHQ+GLLASGGGTADRC++FWN LT QA+ S DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K + TK +
Sbjct:    1 MDQDYERRLLRQINHQNVPEGHPTKQSNYAAC-SPVSVKSGDRFIPTRAGSNWSIN-------FHYANENCWSPNQNQRAKDASTDTGKDAV-AYAALLRNELLGAGIETVPDPHTDDRRHTILTQDTHSLFRYTIHTKRVPFDNEISPYSLSPLSNKSHKLLRSPRKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLSVDGDSVTSVCWNERGSLVAVGTHKGFVQIWDAAGGRKLTSLEGHSARVGALAWNGEQLSSGSRDRVILQRDVRTPPPVERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSS------------------------------LLPVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVFSKTRCTKES 474          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Zebrafish
Match: cdc20 (cell division cycle 20 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-2044])

HSP 1 Score: 301.982 bits (772), Expect = 4.099e-94
Identity = 154/358 (43.02%), Postives = 221/358 (61.73%), Query Frame = 1
Query:  484 ENTKRIL--QSPRP----QTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQK 1539
            +N  ++L  Q P P    ++R I  +P ++LDAPD+++DFYLNL+DW  QNVLAVGL   VYLW+A   +I  L  +  D++ I SV+W + G  +A+GT   KV++WD   +++L++++GH+ARVG L+WN  +L+SGSR   +H  D R +         H QEVCGL WS D +YLASGGNDN + +W +                  TTGS    N   + L+       H  AVKA+AW P Q  +LASGGGT+DR I+ WN  +   + S+DT SQV ++ ++P+  ELVS HG++ +++V+WKYP    + +  GH  R+L LALSPDGS + + A DET+R W  FEK+K
Sbjct:  147 QNNLKVLYSQVPTPVSVKKSRYISSYPERILDAPDIRNDFYLNLMDWGRQNVLAVGLANQVYLWDAGEGDIVLLKKMEDDNEYICSVSWSKDGNFLAIGTSDCKVELWDVQYQKRLRSMDGHSARVGCLSWNDHILSSGSRSGLIHQHDVRVADHHIFTFGGHTQEVCGLTWSPDGRYLASGGNDNMVYIWPM------------------TTGS---ENQAIHALS------EHQGAVKALAWCPWQPNILASGGGTSDRHIRIWNASSGSCISSLDTCSQVSSLVFAPNYKELVSGHGFAHDKVVIWKYPSFAKVTEHEGHEARILNLALSPDGSTLASIAADETIRLWKCFEKEK 477          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338])

HSP 1 Score: 484.567 bits (1246), Expect = 8.149e-165
Identity = 267/516 (51.74%), Postives = 329/516 (63.76%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEK--VYHDRFIPVRNSALWKENKQEHYQMFDIEN--IQNLPINNNDCDSKSITNLLGDLIDSEL----ASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            MD  YERRL          + P VS ++ T  TP  +P+     + DRFIP R  A W  N    +++ + E    QN    +   DS         L+ +EL         +    D    P++    +++    S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDA+A ++L TLEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK
Sbjct:    1 MDQDYERRLLRQINLQNENTMPCVSEMRRTL-TPTNSPMSSPSKHGDRFIPSRAGANWSIN---FHRINENEKSPSQNRKAKDATADSGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDASAGKKLSTLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK 480          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338])

HSP 1 Score: 483.411 bits (1243), Expect = 1.559e-162
Identity = 267/518 (51.54%), Postives = 330/518 (63.71%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEK--VYHDRFIPVRNSALWKENKQEHYQMFDIEN--IQNLPINNNDCDSKSITNLLGDLIDSEL----ASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL          + P VS ++ T  TP  +P+     + DRFIP R  A W  N    +++ + E    QN    +   DS         L+ +EL         +    D    P++    +++    S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDA+A ++L TLEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:  132 MDQDYERRLLRQINLQNENTMPCVSEMRRTL-TPTNSPMSSPSKHGDRFIPSRAGANWSIN---FHRINENEKSPSQNRKAKDATADSGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDASAGKKLSTLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 613          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338])

HSP 1 Score: 431.409 bits (1108), Expect = 1.123e-142
Identity = 243/485 (50.10%), Postives = 302/485 (62.27%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEK--VYHDRFIPVRNSALWKENKQEHYQMFDIEN--IQNLPINNNDCDSKSITNLLGDLIDSEL----ASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYL 1455
            MD  YERRL          + P VS ++ T  TP  +P+     + DRFIP R  A W  N    +++ + E    QN    +   DS         L+ +EL         +    D    P++    +++    S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDA+A ++L TLEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYL
Sbjct:  132 MDQDYERRLLRQINLQNENTMPCVSEMRRT-LTPTNSPMSSPSKHGDRFIPSRAGANWSIN---FHRINENEKSPSQNRKAKDATADSGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDASAGKKLSTLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYL 580          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338])

HSP 1 Score: 370.548 bits (950), Expect = 1.020e-121
Identity = 183/292 (62.67%), Postives = 214/292 (73.29%), Query Frame = 1
Query:  676 INRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            + RLCD++ + D++TSV W E+G  VAVGTH G VQIWDA+A ++L TLEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK
Sbjct:  130 VTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDASAGKKLSTLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK 391          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Xenopus
Match: cdc20 (cell division cycle 20 [Source:NCBI gene;Acc:394542])

HSP 1 Score: 302.753 bits (774), Expect = 3.662e-94
Identity = 157/367 (42.78%), Postives = 223/367 (60.76%), Query Frame = 1
Query:  454 FAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQ--IWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            + +N  + +S+ T     S +   R IP  P +VLDAPD+++D+YLNL+DWSSQN LAV L   VYLWN  + +I  L  +    + I+SV+W ++G  +AVGT + +VQ  +   +  ++L+ +  H++RVG L+WN  +L+SGSR  ++H  D R +      L  H QEVCGLKWS D +YLASG NDN + VW                         V  ++G +  +P   +  H  AVKA+AW P Q+ +LA+GGGT+DR I+ WN+ +   ++SVDT SQVC+I WS +  EL+S HG++QNQ+V+WKYP  T + +L GH+ RVL LA+SPDG  V + A DETLR W  FE    TK
Sbjct:  152 YQNNLKVLYSQKTTP--GSSKKTGRYIPSMPDRVLDAPDIRNDYYLNLIDWSSQNFLAVALNDSVYLWNYATGDIILLLQMEHSEEYISSVSWIKEGNYLAVGTSNSEVQWRLNRISLLKRLRNMTSHSSRVGALSWNNHILSSGSRTGHIHHHDVRVAQHHVSTLTGHTQEVCGLKWSPDGRYLASGANDNLVNVW-----------------------PCVQGDSGEF--SPVQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGTCLNSVDTHSQVCSILWSTNYKELISGHGFAQNQLVLWKYPTMTRVTELKGHTARVLNLAISPDGCTVASAAADETLRLWKCFEVDPVTK 491          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Mouse
Match: Fzr1 (fizzy and cell division cycle 20 related 1 [Source:MGI Symbol;Acc:MGI:1926790])

HSP 1 Score: 483.797 bits (1244), Expect = 1.554e-164
Identity = 266/519 (51.25%), Postives = 328/519 (63.20%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEK--VYHDRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL          + P VS ++ T  TP  +PV     + DRFIP R  A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++     +     S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYERRLLRQIIIQNENTVPCVSEMRRTL-TPANSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDA----TSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEHKGLFTYSLSSKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 482          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Mouse
Match: Fzr1 (fizzy and cell division cycle 20 related 1 [Source:MGI Symbol;Acc:MGI:1926790])

HSP 1 Score: 369.007 bits (946), Expect = 3.063e-121
Identity = 183/294 (62.24%), Postives = 214/294 (72.79%), Query Frame = 1
Query:  676 INRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            + RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:  130 VTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 393          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Mouse
Match: Cdc20 (cell division cycle 20 [Source:MGI Symbol;Acc:MGI:1859866])

HSP 1 Score: 322.783 bits (826), Expect = 4.231e-102
Identity = 156/341 (45.75%), Postives = 218/341 (63.93%), Query Frame = 1
Query:  508 SPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            S R   R IP  P ++LDAP++++D+YLNLVDWSS NVLAV L   VYLWNA S +I +L  +    D I+SVAW ++G  +AVGT + +VQ+WD   +++L+ +  H+ARV +L+WN+ +L+SGSR  ++H  D R +      L  H QEVCGL+W+ D ++LASGGNDN + VW                +G G +G +           P   +  H  AVKA+AW P Q+ +LA+GGGT+DR I+ WN+ +   + +VD  SQVC+I WSPH  EL+S HG++QNQ+V+WKYP    +A+L GH+ RVL L +SPDG+ V + A DETLR W  FE
Sbjct:  160 SSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDYISSVAWIKEGNYLAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVW---------------PSGPGESGWA-----------PLQTFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLGLTMSPDGATVASAAADETLRLWRCFE 474          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Mouse
Match: Fzr1 (fizzy and cell division cycle 20 related 1 [Source:MGI Symbol;Acc:MGI:1926790])

HSP 1 Score: 266.929 bits (681), Expect = 1.496e-82
Identity = 157/344 (45.64%), Postives = 205/344 (59.59%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEK--VYHDRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRL 1029
            MD  YERRL          + P VS ++ T  TP  +PV     + DRFIP R  A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++     +     S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN++
Sbjct:    1 MDQDYERRLLRQIIIQNENTVPCVSEMRRTL-TPANSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDA----TSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEHKGLFTYSLSSKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKV 337          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Mouse
Match: Cdc20b (cell division cycle 20B [Source:MGI Symbol;Acc:MGI:3644472])

HSP 1 Score: 204.527 bits (519), Expect = 2.325e-57
Identity = 116/317 (36.59%), Postives = 169/317 (53.31%), Query Frame = 1
Query:  571 LQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWN 1521
            L++D+YLN +DWSSQN++AV LGT VY+WN  +       D++     ++SV W  +G+ +AVGT  G+VQ+WDA  ++QL+ L GH + VG L+WN   L+SGSR   VH  D R +      L  H++ VC LKWS D + L+SG ND  L +W                 GAG  G             P  +    + AVKA+ W P Q+ +LA GGG  D C+   +I T + + +  T SQ+C++ W P + E+ +  G  +N + +W  P         GH  RVL+L+LSPD + + + A D T   W 
Sbjct:  228 LRNDYYLNTLDWSSQNLVAVALGTSVYIWNGQNHSWIENIDLSVCCHYVSSVTWMREGSCLAVGTSEGEVQLWDAITKKQLRNLHGHLSVVGALSWNHCTLSSGSRLGRVHHHDVRVAQHRVGTLY-HKEAVCSLKWSPDGRLLSSGCNDGLLTIW-------------PHDPGAGVQGL------------PLKVIP-QSTAVKAMEWCPWQSEVLAVGGGVKDGCLHVLDINTGKNIQTPSTQSQICSLIWLPKTKEIATGQGAPKNDVALWTCPTLFRSGGFFGHRDRVLHLSLSPDQTRLFSAAADGTACVWK 517          
BLAST of Fizzy/cell division cycle 20 related 1a vs. UniProt/SwissProt
Match: sp|Q9R1K5|FZR1_MOUSE (Fizzy-related protein homolog OS=Mus musculus OX=10090 GN=Fzr1 PE=1 SV=1)

HSP 1 Score: 483.797 bits (1244), Expect = 1.087e-163
Identity = 266/519 (51.25%), Postives = 328/519 (63.20%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEK--VYHDRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL          + P VS ++ T  TP  +PV     + DRFIP R  A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++     +     S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYERRLLRQIIIQNENTVPCVSEMRRTL-TPANSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDA----TSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEHKGLFTYSLSSKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 482          
BLAST of Fizzy/cell division cycle 20 related 1a vs. UniProt/SwissProt
Match: sp|Q9UM11|FZR1_HUMAN (Fizzy-related protein homolog OS=Homo sapiens OX=9606 GN=FZR1 PE=1 SV=2)

HSP 1 Score: 481.485 bits (1238), Expect = 7.427e-163
Identity = 263/517 (50.87%), Postives = 325/517 (62.86%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEKVYH-DRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKA 1551
            MD  YERRL          + P V+ ++ T +  +        H DRFIP R  A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++    ++     S    R SP          + P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNAE L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK 
Sbjct:    1 MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKD----ATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPST--PEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKV 481          
BLAST of Fizzy/cell division cycle 20 related 1a vs. UniProt/SwissProt
Match: sp|Q8L3Z8|FZR2_ARATH (Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=FZR2 PE=1 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 8.666e-137
Identity = 201/344 (58.43%), Postives = 241/344 (70.06%), Query Frame = 1
Query:  511 PRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKS 1542
            P    RK+P+ PYKVLDAP LQDDFYLNLVDWS+QNVLAVGLG CVYLWNA SS++ +LCD+ ++ D++ SV W  +GT +AVGT  GKVQIWDA+  ++ +T+EGH  RVG LAW + +L+SGSRD+++  RD R        L  H+ EVCGLKWS D + LASGGNDNRL VWN                               +   P + Y  H AAVKAIAWSPH +GLLASGGGTADRCI+FWN  T   + S+DT SQVCN+AWS + NELVSTHGYSQNQI+VWKYP  + +A LTGH+ RVLYLA+SPDG  +VTGAGDETLRFWNVF   KS
Sbjct:  153 PVKAPRKVPRSPYKVLDAPALQDDFYLNLVDWSAQNVLAVGLGNCVYLWNACSSKVTKLCDLGAE-DSVCSVGWALRGTHLAVGTSTGKVQIWDASRCKRTRTMEGHRLRVGALAWGSSVLSSGSRDKSILQRDIRCQEDHVSKLAGHKSEVCGLKWSYDNRELASGGNDNRLFVWN------------------------------QHSTQPVLKYSEHTAAVKAIAWSPHVHGLLASGGGTADRCIRFWNTTTNTHLSSIDTCSQVCNLAWSKNVNELVSTHGYSQNQIIVWKYPTMSKIATLTGHTYRVLYLAVSPDGQTIVTGAGDETLRFWNVFPSPKS 465          
BLAST of Fizzy/cell division cycle 20 related 1a vs. UniProt/SwissProt
Match: sp|Q8VZS9|FZR1_ARATH (Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=FZR1 PE=1 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 1.249e-132
Identity = 224/469 (47.76%), Postives = 288/469 (61.41%), Query Frame = 1
Query:  139 TPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPF-SENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKS 1542
            +P + +Y DRFIP R+ +        ++ +FD+ +      +  +  + S  +LL   +   +  + ++  N    ++P+  +          FR   E+   L    N   PF S+    +  SP    RKI + PYKVLDAP LQDDFYLNLVDWS+QNVLAVGLG CVYLWNA SS++ +LCD+  D +T+ SV W  +GT +A+GT  G VQIWD    + ++T+EGH  RVG LAW++ +L+SGSRD+++  RD RT       LK H+ E+CGLKWS D + LASGGNDN+L VWN                               +   P + +  HAAAVKAIAWSPH  GLLASGGGTADRCI+FWN  T   ++ VDT SQVCN+ WS + NELVSTHGYSQNQI+VWKYP  + LA LTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF   KS
Sbjct:   45 SPSKPIYSDRFIPSRSGS--------NFALFDLASSSPNKKDGKEDGAGSYASLLKTALFGPVTPEKSDVVN---GFSPSGNI----------FRFKTETQRSL----NLYPPFDSDVVSGVSPSPVKSPRKILRSPYKVLDAPALQDDFYLNLVDWSAQNVLAVGLGNCVYLWNACSSKVTKLCDLGVD-ETVCSVGWALRGTHLAIGTSSGTVQIWDVLRCKNIRTMEGHRLRVGALAWSSSVLSSGSRDKSILQRDIRTQEDHVSKLKGHKSEICGLKWSSDNRELASGGNDNKLFVWN------------------------------QHSTQPVLRFCEHAAAVKAIAWSPHHFGLLASGGGTADRCIRFWNTTTNTHLNCVDTNSQVCNLVWSKNVNELVSTHGYSQNQIIVWKYPTMSKLATLTGHSYRVLYLAVSPDGQTIVTGAGDETLRFWNVFPSPKS 457          
BLAST of Fizzy/cell division cycle 20 related 1a vs. UniProt/SwissProt
Match: sp|Q8LPL5|FZR3_ARATH (Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=FZR3 PE=1 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 1.451e-126
Identity = 214/460 (46.52%), Postives = 279/460 (60.65%), Query Frame = 1
Query:  163 DRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSI-TNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQK 1539
            DRFIP R+S+     +   + + D E    +    N+  S+ + + L G    S L S      +  +  +P +        NML F+  R + S       + +            P    RK+PK P+KVLDAP LQDDFYLN+VDWSSQNVLAVGLGTCVYLW A +S++ +LCD+  + D++ SV W  +G+ +++GT HG+VQ+WD    ++++T+ GH  R G LAWN+ +L+SGSRDRN+   D R  S     L  H+ EVCGLKWS D + LASGGNDN+L+VWN                              ++   P +    H AAVKAI WSPHQ+ LLASGGGTADRCI+FWN      ++S+DTGSQVCN+AWS + NE+VSTHGYSQNQI++WKYP  + +A LTGHS RVLYLA SPDG  +VTGAGDETLRFWNVF   K
Sbjct:   47 DRFIPCRSSS-----RLHAFDLQDKEPTTPVKEGGNEAYSRLLKSELFGSDFASPLLSPAGGQGSASSPMSPCT--------NMLRFKTDRSNSSPSSPFSPSILGNDNGHSSDSSPPPKPPRKVPKTPHKVLDAPSLQDDFYLNVVDWSSQNVLAVGLGTCVYLWTASNSKVTKLCDLGPN-DSVCSVQWTREGSYISIGTSHGQVQVWDGTQCKRVRTMGGHQTRTGVLAWNSRILSSGSRDRNILQHDIRVQSDFVSKLVGHKSEVCGLKWSHDDRELASGGNDNQLLVWN------------------------------NHSQQPILKLTEHTAAVKAITWSPHQSSLLASGGGTADRCIRFWNTTNGNQLNSIDTGSQVCNLAWSKNVNEIVSTHGYSQNQIMLWKYPSMSKVATLTGHSMRVLYLATSPDGQTIVTGAGDETLRFWNVFPSVK 462          
BLAST of Fizzy/cell division cycle 20 related 1a vs. TrEMBL
Match: A0A1S3JHS8 (fizzy-related protein homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173024 PE=4 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 2.275e-165
Identity = 260/509 (51.08%), Postives = 328/509 (64.44%), Query Frame = 1
Query:   55 MDSSYERRLF----GSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKEN---KQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNF-DAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRT-SSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YE+RLF    G  P+ SP++S    P  +PV+  Y DRFIP R  A W  +    Q+  +       +     N++    + + LL + +      D   S  F + + +   +L  +   N+  +R  R+       +  +  P    ++++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWSS N+L+VGLGTCVYLW+A +S++ RLCD+  D D++TSVAW E+G  VAVGTH G VQIWD +A +++ TLEGH+ARVG LAWNA++L+SGSRDR +  RD RT  S   + L  HRQEVCGLKWS D Q+LASGGNDN+L VWN+ S S                              P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  VDTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP    +AKLTGH+ RVLYLA+SPDG  +VTGAGDETLRFWNVF K +S K +
Sbjct:    1 MDPDYEKRLFRQQNGQSPYGSPMQS----PVASPVKDKYGDRFIPSRAGANWHISFNMPQDTGKTQSPGQTRKAKEANDNQKDMTYSCLLRNELLGAGIEDLKVSTVFQEQQPDERKILAPKDTKNLFQYRVSRKDVDSSDSSPYSLSPVGTKSQKLLRSPRKTVRKISKIPFKVLDAPELQDDFYLNLVDWSSTNILSVGLGTCVYLWSACTSQVTRLCDLAVDQDSVTSVAWSERGNSVAVGTHKGFVQIWDVSANKKISTLEGHSARVGALAWNADMLSSGSRDRLILQRDVRTPPSITERRLAGHRQEVCGLKWSPDHQHLASGGNDNKLFVWNMNSTS------------------------------PVQTYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCVDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLVQIAKLTGHTYRVLYLAISPDGEAIVTGAGDETLRFWNVFSKTRSPKES 475          
BLAST of Fizzy/cell division cycle 20 related 1a vs. TrEMBL
Match: A0A0B7BI94 (WD_REPEATS_REGION domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF189544 PE=4 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 1.789e-164
Identity = 263/516 (50.97%), Postives = 329/516 (63.76%), Query Frame = 1
Query:   55 MDSSYERRL----------FGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQN-----LPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRT-SSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YE+RL          FGS  + SP+ S +        +++Y DRFIP R+S  WK N       FDI+  Q      L   + + ++         L+ +EL S     H  D +     VL  +   N+  F   R        +  +  P    ++++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWSSQNVL+VGLGT VYLW+A +S++ RLCD+++D+DT+TSV+W E+G +VAVGT+ G VQIWD A  +++ TL GH ARVG L+WN ++L+SGSRDR +  RD RT ++T  + L  H+QEVCGLKWS D Q+LASGGNDNRL VWN TS S                              P   +  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q ++ VDTGSQVCN+AWS H NELVSTHGYSQNQI+VWKYP    +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDPVYEKRLLRQQNGQFSSFGSSGYASPLVSQN--------KRIYGDRFIPSRSSPCWKIN-------FDIQQPQTSSQSALKTKDANIETSKDGLAYACLLKNELLS-AGIEHLKDVQNEDKKVLALKETENVFKFNTPRRCIDGCDTSPYSLSPVGSKSQKLLRSPRKAVRKISKLPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGTSVYLWSACTSQVTRLCDLSTDNDTVTSVSWSERGGQVAVGTNKGYVQIWDVAVSKKVHTLTGHGARVGALSWNGDMLSSGSRDRLIFQRDIRTPNTTPERKLVGHKQEVCGLKWSPDHQHLASGGNDNRLFVWNATSTS------------------------------PVQTHMEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTHQPLNCVDTGSQVCNLAWSKHCNELVSTHGYSQNQILVWKYPSLVQVAKLTGHSFRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 470          
BLAST of Fizzy/cell division cycle 20 related 1a vs. TrEMBL
Match: A0A1S3JGC0 (fizzy-related protein homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173024 PE=4 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 3.207e-164
Identity = 258/508 (50.79%), Postives = 326/508 (64.17%), Query Frame = 1
Query:   55 MDSSYERRLF----GSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKEN---KQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRT-SSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YE+RLF    G  P+ SP++S    P  +PV+  Y DRFIP R  A W  +    Q+  +       +     N++    + + LL + +      D       + + +   +L  +   N+  +R  R+       +  +  P    ++++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWSS N+L+VGLGTCVYLW+A +S++ RLCD+  D D++TSVAW E+G  VAVGTH G VQIWD +A +++ TLEGH+ARVG LAWNA++L+SGSRDR +  RD RT  S   + L  HRQEVCGLKWS D Q+LASGGNDN+L VWN+ S S                              P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  VDTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP    +AKLTGH+ RVLYLA+SPDG  +VTGAGDETLRFWNVF K +S K +
Sbjct:    1 MDPDYEKRLFRQQNGQSPYGSPMQS----PVASPVKDKYGDRFIPSRAGANWHISFNMPQDTGKTQSPGQTRKAKEANDNQKDMTYSCLLRNELLGAGIEDLK-----EQQPDERKILAPKDTKNLFQYRVSRKDVDSSDSSPYSLSPVGTKSQKLLRSPRKTVRKISKIPFKVLDAPELQDDFYLNLVDWSSTNILSVGLGTCVYLWSACTSQVTRLCDLAVDQDSVTSVAWSERGNSVAVGTHKGFVQIWDVSANKKISTLEGHSARVGALAWNADMLSSGSRDRLILQRDVRTPPSITERRLAGHRQEVCGLKWSPDHQHLASGGNDNKLFVWNMNSTS------------------------------PVQTYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCVDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLVQIAKLTGHTYRVLYLAISPDGEAIVTGAGDETLRFWNVFSKTRSPKES 469          
BLAST of Fizzy/cell division cycle 20 related 1a vs. TrEMBL
Match: C0HB41 (Fizzy-related protein homolog OS=Salmo salar OX=8030 GN=FZR PE=2 SV=1)

HSP 1 Score: 486.493 bits (1251), Expect = 2.912e-162
Identity = 271/522 (51.92%), Postives = 336/522 (64.37%), Query Frame = 1
Query:   55 MDSSYERRLFGSPPF----VSPVKSTHS----TPNKTPVEK--VYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNT-----GI------PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  Y+RRL           SP+K T      TPN +P+     + DRFIP R  A W  N    +   + EN ++   N    D+ S ++    L  S L  +       D   +P +  E+RR     S  + R   S  L A +T     GI      P S  ++++L+SPR QTRKI K P+KVLDAP+LQDDFYLNLVDWS+ NVL+VGLGTCVYLW+A +S++ RLCD++ + +++TSV W E+G  VAVGTH G VQIWDAAA ++L TLEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S +                              P   Y +H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  + +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWN+F K +STK +
Sbjct:    1 MDQEYQRRLLRQINIQNENTSPIKVTEVMRNLTPNNSPMSSPSKHGDRFIPSRAGANWNIN----FHRIN-ENEKSPSQNRKTKDATSDSSKADGLAYSALLKNELLGAGIDKVQDPQT--EDRRLQP--STPEKRSLFSYSLSARSTTDEDNGISPYSLSPVSSKSQKLLRSPRKQTRKISKIPFKVLDAPELQDDFYLNLVDWSALNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGNSVTSVGWSERGNHVAVGTHKGYVQIWDAAAGKKLFTLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSDRQLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSTA------------------------------PVQQYTDHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCMDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPALSQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNLFSKTRSTKES 483          
BLAST of Fizzy/cell division cycle 20 related 1a vs. TrEMBL
Match: A0A4W3H770 (WD_REPEATS_REGION domain-containing protein OS=Callorhinchus milii OX=7868 GN=fzr1 PE=4 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 5.755e-162
Identity = 264/518 (50.97%), Postives = 332/518 (64.09%), Query Frame = 1
Query:   55 MDSSYERRLF--------GSPPFVSPVKSTHSTPNKTPVEKVYH--DRFIPVRNSALWK-------ENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  Y+RRL          + P ++ V+ T  TP  +PV       DRFIP R +A W        EN++   Q    ++      ++N  D  + + LL + +         +    D    P++  +       LS ++        +  ++   P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ D D++TSV W E+G  VAVGTH G VQIWDAAA ++L TLEGH+ARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN                         NS++G     P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYKRRLLRQINVQNENTVPCITEVRRTL-TPTNSPVSSPSKSGDRFIPSRAAANWSINFHRINENEKSPSQNRKAKDA----TSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKSLFKYSLSTKRASPDDGNDISPYSLS-PVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSIDGDSVTSVGWSERGNLVAVGTHKGYVQIWDAAAGKKLSTLEGHSARVGALAWNADQLSSGSRDRLILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWN-------------------------NSSSG-----PVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTSQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 482          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Cavefish
Match: fzr1a (fizzy and cell division cycle 20 related 1 [Source:NCBI gene;Acc:103039491])

HSP 1 Score: 488.804 bits (1257), Expect = 1.111e-166
Identity = 271/528 (51.33%), Postives = 331/528 (62.69%), Query Frame = 1
Query:   55 MDSSYERRLFGSPPF----VSPVKST----HSTPNKTPVEK--VYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGI-----------------PFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL           SPVK T    H TP K+P+     + DRFIP R  A W  N    +   + EN ++   N    D+ S T  +  L  S L  +       +   +P +  E+RR        Q      + LF+++                    P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              + P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYERRLLRQINVQNDNASPVKVTDVIRHLTPTKSPMSSPSKHGDRFIPSRAGANWSIN----FHRIN-ENEKSPSQNKKTKDATSDTGKVDGLAYSALLKNELLGAGIEKVQDPQT--EDRR-------LQPSTPEKRSLFSYSLSTKRTMPDDGNNVSPYSLSPVSSKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNHVAVGTHKGFVQIWDAAAGKKLFALEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------VQPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCIDTGSQVCNLAWSKHTNELVSTHGYSQNQILVWKYPSLTQIAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 484          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Cavefish
Match: ENSAMXT00000052515.1 (fizzy-related protein homolog [Source:NCBI gene;Acc:103047033])

HSP 1 Score: 481.1 bits (1237), Expect = 9.480e-164
Identity = 259/513 (50.49%), Postives = 324/513 (63.16%), Query Frame = 1
Query:   55 MDSSYERRLF---------GSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQ---EHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YE RL           SP  ++P  S  S+P+K      + DRFIP R  A W  N     E+ + +          ++N  D  + + LL + +         +    D    P++  +    +  LS ++        +  ++   P S N++++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWN + L+SGSRDR +  RD R    +  + L  HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              ++P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q + S DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYESRLLRQINIQNDNASPVKLTPTNSPLSSPSK------HGDRFIPSRAGANWSVNFHRINENEKSYSQNRKTKDGTSDNSKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKRSLFSYSLSAKRSLPDDGNSISPYSLS-PVSSNSQKLLRSPRKPMRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSVLEGHTARVGALAWNVDQLSSGSRDRLILQRDIRAPPQQSERKLLGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------VSPMQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQSTDTGSQVCNLAWSKHTNELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 476          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Cavefish
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:103024543])

HSP 1 Score: 474.937 bits (1221), Expect = 2.166e-161
Identity = 260/514 (50.58%), Postives = 319/514 (62.06%), Query Frame = 1
Query:   55 MDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSIT-------------NLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRE-SPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL       +  +   +     PV     DRFIP R  + W  N   HY     EN  +   N    D+ + T              LLG  I++     T++        + +S+     +   + F    E SP  L        P S  + ++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWS+ N+L+VGLG CVYLW+A +S++ RLCD++ D D++TSV W E+G+ VAVGTH G VQIWDAA  ++L +LEGH+ARVG LAWN E L+SGSRDR +  RD RT     + L+ HRQEVCGLKWS D Q+LASGGNDN+L+VWN +S                              L P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRC++FWN LT QA+ S DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K + TK +
Sbjct:    1 MDQDYERRLLRQINHQNVPEGQLTKSGYAPVSVKSGDRFIPTRAGSNWSINF--HYAN---ENCWSPNQNQRSKDASADTGKDAVAYAALLRNELLGAGIETVPDPHTDDRRQAILSQDTHSLFRYTIHTKRVPFDSGNEISPYSL-------SPLSNKSHKLLRSPRKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLSVDGDSVTSVCWNERGSLVAVGTHKGFVQIWDAAGGRKLTSLEGHSARVGALAWNGEQLSSGSRDRVILQRDVRTPPPMERKLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSS------------------------------LQPVQQYSEHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVFSKTRCTKES 472          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Cavefish
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:103024543])

HSP 1 Score: 424.476 bits (1090), Expect = 9.820e-142
Identity = 237/482 (49.17%), Postives = 292/482 (60.58%), Query Frame = 1
Query:   55 MDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSIT-------------NLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRE-SPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLA 1458
            MD  YERRL       +  +   +     PV     DRFIP R  + W  N   HY     EN  +   N    D+ + T              LLG  I++     T++        + +S+     +   + F    E SP  L        P S  + ++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWS+ N+L+VGLG CVYLW+A +S++ RLCD++ D D++TSV W E+G+ VAVGTH G VQIWDAA  ++L +LEGH+ARVG LAWN E L+SGSRDR +  RD RT     + L+ HRQEVCGLKWS D Q+LASGGNDN+L+VWN +S                              L P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRC++FWN LT QA+ S DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYL 
Sbjct:    1 MDQDYERRLLRQINHQNVPEGQLTKSGYAPVSVKSGDRFIPTRAGSNWSIN--FHYAN---ENCWSPNQNQRSKDASADTGKDAVAYAALLRNELLGAGIETVPDPHTDDRRQAILSQDTHSLFRYTIHTKRVPFDSGNEISPYSL-------SPLSNKSHKLLRSPRKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLSVDGDSVTSVCWNERGSLVAVGTHKGFVQIWDAAGGRKLTSLEGHSARVGALAWNGEQLSSGSRDRVILQRDVRTPPPMERKLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSS------------------------------LQPVQQYSEHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLV 440          

HSP 2 Score: 55.0694 bits (131), Expect = 1.670e-7
Identity = 41/130 (31.54%), Postives = 61/130 (46.92%), Query Frame = 1
Query: 1162 ENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTG--SQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVT---GAGDETLRFWNVFEKQ 1536
            E H+A V A+AW+  Q   L+SG  + DR I   ++ T   +     G   +VC + WSP    L S  G + N+++VW      P+ + + H   V  +A SP    ++    G  D  LRFWN    Q
Sbjct:  259 EGHSARVGALAWNGEQ---LSSG--SRDRVILQRDVRTPPPMERKLQGHRQEVCGLKWSPDHQHLAS--GGNDNKLLVWNSSSLQPVQQYSEHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQ 381          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Cavefish
Match: fzr1a (fizzy and cell division cycle 20 related 1 [Source:NCBI gene;Acc:103039491])

HSP 1 Score: 368.237 bits (944), Expect = 6.610e-121
Identity = 182/294 (61.90%), Postives = 213/294 (72.45%), Query Frame = 1
Query:  676 INRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            + RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD RT   +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              + P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  +DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:  131 VTRLCDLSVEGDSVTSVGWSERGNHVAVGTHKGFVQIWDAAAGKKLFALEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------VQPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCIDTGSQVCNLAWSKHTNELVSTHGYSQNQILVWKYPSLTQIAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 394          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Sea Lamprey
Match: fzr1a (fizzy/cell division cycle 20 related 1a [Source:ZFIN;Acc:ZDB-GENE-040426-712])

HSP 1 Score: 457.218 bits (1175), Expect = 7.265e-155
Identity = 259/506 (51.19%), Postives = 319/506 (63.04%), Query Frame = 1
Query:   94 PFVSPVKSTHSTPNKTPVEKVYH--DRFIPVRNSALW--------KENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTG----IPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTC-VYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARV---GTLAWNAELLASGSRDRNVHLRDTRTSS-TEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            P ++P      TP+ +P        DRFIP R  A W        +EN +   Q    ++       +N  DS +   LL + +         +  + D     ++ +  +RN    S    R SP +    H+       P S  ++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGL  C VYL+  V +++ RLCD++ D D++TSV+W E+G  VAVGTH G VQIWDAAA +++ TLEGHTARV   G LAWNA+ L+SGSRDR +  RD R    T  + L+ HRQEVCGLKWS D Q+LASGGNDN+L VWN                     GSS         L+P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +  VDTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:   25 PCMTPTSHRALTPSGSPFASPSKSGDRFIPTRAGANWGIGFHSTSEENNKSPGQNRKAKDASA----DNGKDSLAYLALLKNELLGAGIEKVQDPQSEDRRLQSSTPM--KRNLFHYSISTKRSSPDE---DHDISPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLYVCRVYLFLCVCAQVTRLCDLSVDGDSVTSVSWSERGNHVAVGTHKGLVQIWDAAAGKKINTLEGHTARVAGAGALAWNADQLSSGSRDRMIVQRDVRAPPVTTERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLFVWN---------------------GSS---------LSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQYVDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKES 491          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Sea Lamprey
Match: cdc20 (cell division cycle 20 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-2044])

HSP 1 Score: 278.87 bits (712), Expect = 5.316e-86
Identity = 179/508 (35.24%), Postives = 250/508 (49.21%), Query Frame = 1
Query:  100 VSPVK------STHSTPNKTPVEKVYH------------DRFIPVRNS-----ALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTC-VYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRV-AVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            VSP+K      ST  TP +TP  K  +            DRFIPVRNS     A +  ++++H  +    +++            ++ +LL  +       D   +     +     V E   N              K+L++     P S   K+         R IP  P +VLDAP +++DFYLN +DWS  NV+ V LG    YLW+A +  + +   +    D  +SV+W   G  + A+GT    VQIWD    + L+ ++GH+ RV +L+WN  LL+SGSR   +H  D R        L  H QEVCGL WS   + LASG NDN L+VW                   GTT S+           P    + H AAVKA+AW P Q  LLASGGGT D  I+ WNI T    ++VD  SQVC++ WS    EL+S HGY++NQ+ +W YP   P+A+L GH+ RVL +  SPDGS+V++   DE+LR W  F+  +S K
Sbjct:   40 VSPMKGTSRTNSTSRTPGRTPTSKCQNTPGAKGKSSPGDDRFIPVRNSKNMEVASYLVSREKHMDLVKPPSLKE--------KQAAMMHLLSGV-------DVEKARILRYQGPAPPVPEGYSNTQ------------KVLYSQQGYTPLSLLKKK---------RHIPTQPERVLDAPAVRNDFYLNPLDWSVDNVVCVALGQFGTYLWDAETGNVTQHMKMEGQ-DYPSSVSWVPTGGNIIAIGTSFKTVQIWDVERNKCLRNMQGHSGRVSSLSWNGHLLSSGSRSGQIHHHDVRMVQHHVATLSGHSQEVCGLAWSPGGRLLASGSNDNNLLVW-----------------ANGTTSSA-----------PLHSLQQHTAAVKALAWCPWQASLLASGGGTNDHHIRLWNINTGICFNAVDAKSQVCSVLWSSEHKELLSAHGYAKNQLTLWAYPAMVPIAELLGHTERVLQVVASPDGSSVMSVGADESLRLWRCFQGDESRK 482          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 63.5438 bits (153), Expect = 8.783e-11
Identity = 66/279 (23.66%), Postives = 118/279 (42.29%), Query Frame = 1
Query:  709 DTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAW--NAELLASGSRDRNVHL--RDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSV-DTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            DTITSV +     ++A G+    + +W+   + +     GH   V ++ +  +  L+ S SRD+ V L     +  ST F   K H   V  + +S D Q L +  +D  + VW                        +V+     Y LN       H+  V++  +SP    +++   G+ DR ++ W+  +R+ VH+  + G  V  + + P S   ++  G + N + VW       L     H   V  L+  P G+ ++T + D TL+  ++ E
Sbjct:   19 DTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVF---KAHTATVRSVSFSADGQSLVTASDDKSIKVW------------------------TVHRQKFLYSLN------QHSNWVRSAKFSPDGRLIVS---GSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHP-SGTCIAAAG-TDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVE 259          

HSP 2 Score: 55.8398 bits (133), Expect = 1.863e-8
Identity = 65/303 (21.45%), Postives = 119/303 (39.27%), Query Frame = 1
Query:  622 LAVG-LGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNA--ELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNI-LTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFW 1518
            LA G +  C+ +WN       R        D + SV +   G  V   +    V++W  + + +    + HTA V +++++A  + L + S D+++ +         +  L +H   V   K+S D + + SG +D  + VW+  SR                            C++ F  YE H   V  + + P    + A+G    D  +K W+I + +   H    G+ V ++++ P  N L++    + + + V           L GH      +A S  G    +G  DE +  W
Sbjct:   33 LASGSMDACLMVWNFKPQ--TRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYS-LNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRE---------------------------CVHTF--YE-HGGFVNQVDFHPSGTCIAAAG---TDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLIT--ASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005462.1 (pep scaffold:Pmarinus_7.0:GL486569:2309:8090:1 gene:ENSPMAG00000004968.1 transcript:ENSPMAT00000005462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.671e-10
Identity = 70/283 (24.73%), Postives = 119/283 (42.05%), Query Frame = 1
Query:  742 GTRVAVGTHHGKVQIWDAAAE-QQLQ---TLEGHTARVGTLAW---NAELLASGSRD-RNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTS---------RSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPF----IIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQ---VCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFW 1518
            G+++A G+    V +WD   E QQL+   TLEGHT  V  LAW   +A L+A G  D   + L + +T   + K  + H   +    W+ D +   +GG   +    +L           R      +GD   G     S  +     Y         I+ E+H      +A++  +NG LA     A + +  W++  R  V      +Q     + A+     + +++ G   +++ VW   G  P+A L GHS  V  ++ +P    + + + D T+R W
Sbjct:  112 GSKLATGSKDSTVILWDVDMESQQLKVARTLEGHTYGVSYLAWSPDDAHLIACGPDDCSELWLWNVQTGELKVKMSQSHEDSLTCAAWNPDGKRFVTGGQRGQFYQCDLEGNVLDSWEGVRVQCLCCVGD---GKTVLASDTHQRIRGYNFEELTDRNIVQEDHPI----MAFTVSRNGRLALLN-VATQGVHLWDLQDRVLVRKYQGATQGFYTIHSAFGGLHEDFIAS-GSEDHKVYVWHKRGELPIAVLAGHSHTVNCVSWNPRLPMLASASDDGTVRIW 385          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008002.1 (pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene:ENSPMAG00000007189.1 transcript:ENSPMAT00000008002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.994e-9
Identity = 45/172 (26.16%), Postives = 78/172 (45.35%), Query Frame = 1
Query:  775 KVQIWDAAA---EQQLQTLEGHTARVGTLAWNAE---LLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSL-DKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNI 1269
            K+ IWD  +    +   +++ HTA V  L++N     +LA+GS D+ V L D R    +    + HR E+  ++WS  ++  LAS G D RL VW+L S+ G      D   G                     ++  H A +   +W+P++  ++ S   + D  ++ W +
Sbjct:  251 KLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADQTVALWDLRNLKLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLNVWDL-SKIGEEQAAEDVEDGPPEL---------------LFVHGGHTAKISDFSWNPNEPWVICS--VSEDNIMQVWQM 404          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Yeast
Match: CDH1 (Activator of anaphase-promoting complex/cyclosome (APC/C); antagonist of the spindle assembly checkpoint; directs ubiquitination of cyclins resulting in mitotic exit; targets the APC/C to specific substrates including: Cdc20p, Ase1p, Cin8p, Fin1p and Clb5p; partially active in metaphase, and fully active in anaphase; cell-cycle regulated [Source:SGD;Acc:S000002971])

HSP 1 Score: 322.783 bits (826), Expect = 2.738e-102
Identity = 165/387 (42.64%), Postives = 241/387 (62.27%), Query Frame = 1
Query:  397 RNNNMLSFRQI---RESPSKLLFAH--NTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKS 1542
            R  ++L+++Q    R S + LL +   ++  P   ++K++L SP  Q R+I K PY+VLDAP L DDFY +L+DWSS +VLAV LG  ++L +  + ++  LCD  ++    TS++W   G+ +AVG  +G V+I+D    + ++TL GH  RV  L+WN  +L SGSRD  +  RD R     F+ ++ H QEVCGLKW++    LASGGNDN + V+  TS+S                              P + ++ H AAVKA+AWSPH+ G+LA+GGGTADR +K WN+ T   +  +D+GSQ+CN+ WS ++NELV++HGYS+  + +W      P+A L GHS RVL+L LS DG+ VV+GAGDETLR+W +F+K K+
Sbjct:  197 RGASLLTYQQRKGRRLSAASLLQSQFFDSMSPVRPDSKQLLLSPGKQFRQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENE---YTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKS------------------------------PILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKPKA 550          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Yeast
Match: CDC20 (Activator of anaphase-promoting complex/cyclosome (APC/C); APC/C is required for metaphase/anaphase transition; directs ubiquitination of mitotic cyclins, Pds1p, and other anaphase inhibitors; cell-cycle regulated; potential Cdc28p substrate; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003084])

HSP 1 Score: 226.098 bits (575), Expect = 1.971e-65
Identity = 124/346 (35.84%), Postives = 185/346 (53.47%), Query Frame = 1
Query:  526 RKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLE-GHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSP---------HSNELVSTHGYSQNQIVVWKYPGCTPLAKLT-GHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            RKI   P ++LDAP  QDDFYLNL+ WS +NVLA+ L T +YLWNA + +++ L D   ++ TI SV W +    +++G   G  +IWD      ++T+  G   R+G+L+W   L+A+GSR   + + D R          EH  EVCGL +  D   LASGGNDN +++W+  +R+ +                            P    + H AAVKA++W P+   +LASGGG  D+ I FWN +T   V S++TGSQV ++ W            + E+V+T G  +N I V+ Y     +A++   H  R+    LSPDG+ + T  GDE L+F+ +F+
Sbjct:  243 RKINTNPERILDAPGFQDDFYLNLLSWSKKNVLAIALDTALYLWNATTGDVSLLTDF--ENTTICSVTWSDDDCHISIGKEDGNTEIWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATGSRSGEIQINDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIWD--TRTSL----------------------------PQFSKKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSITGARVGSINTGSQVSSLHWGQSHTSTNGGMMNKEIVATGGNPENAISVYNYETKFKVAEVVHAHEARICCSQLSPDGTTLATVGGDENLKFYKIFD 556          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Yeast
Match: AMA1 (Activator of meiotic anaphase promoting complex (APC/C); Cdc20p family member; required for initiation of spore wall assembly; required for Clb1p degradation during meiosis; prevents premature assembly of the meiosis I spindle, required for DSB induced prophase I arrest [Source:SGD;Acc:S000003457])

HSP 1 Score: 146.747 bits (369), Expect = 1.245e-37
Identity = 108/382 (28.27%), Postives = 175/382 (45.81%), Query Frame = 1
Query:  505 QSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWS-SQNVLAVGLGTCVYLWNAVSSEINRLCD--VNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAA---------EQQLQTLEGHTAR-VGTLAW--NAEL--LASGSRDRNVHLRDTRTSSTEFK--------------PLKEHR------QEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQ----IVVWKYPGCTPLAKL-TGHSCRVLYLALSPDGSNVVTGAGDETLRFWNV 1524
            Q  RP  R     PY+VLDAP L++DFY NL+ WS + N + VGLG  VY+W+     ++ L    ++   D +T V++C   T   VGT  G++ ++D            ++ +   +  + + +  L W    E+     G  + NV L + ++     K               LK H       Q+VCG+  +     LA GGNDN   +W+++          D+                   +  F++   H AAVKAIA+ P    LLA+GGG+ DRCIKFW+  T   +  + T  QV ++ WS    ++V+T G+   +    I ++ YP  + L ++ + +  RVL   +SP    +     DET+RF+ +
Sbjct:  203 QIQRPAKRVKSHIPYRVLDAPCLRNDFYSNLISWSRTTNNVLVGLGCSVYIWSEKEGAVSILDHQYLSEKRDLVTCVSFCPYNTYFIVGTKFGRILLYDQKEFFHSSNTNEKEPVFVFQTESFKGICCLEWFKPGEICKFYVGEENGNVSLFEIKSLHFPIKNWSKRQKLEDENLIGLKLHSTYQAQAQQVCGISLNEHANLLAVGGNDNSCSLWDISDL--------DKP------------------IKKFVL--PHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFWHTSTGTLLDEICTSGQVTSLIWSLRHKQIVATFGFGDTKNPVLITLYSYPKLSKLLEVRSPNPLRVLSAVISPSSMAICVATNDETIRFYEL 556          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 66.2402 bits (160), Expect = 9.199e-12
Identity = 66/289 (22.84%), Postives = 115/289 (39.79%), Query Frame = 1
Query:  715 ITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAW--NAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDT---GSQVCNIAWSPHSNELVST----------HGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLA------LSPDGSNVVTGAGDETLRFW 1518
            I SV +   G  +A G     ++IWD    + +  L+GH   + +L +  + + L SGS DR V + D RT         E       +    D +Y+A+G  D  + VW+  +     G L +R      +G+                   H  +V ++ ++     +++   G+ DR +K WN+  + A +  D+    S  C + +  H + ++S            G     ++ W      PL  L GH   V+ +A      L P+ +   TG+GD   R W
Sbjct:  446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG-DGKYIAAGSLDRAVRVWDSET-----GFLVERLDSENESGTG------------------HKDSVYSVVFTRDGQSVVS---GSLDRSVKLWNL--QNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705          

HSP 2 Score: 53.1434 bits (126), Expect = 1.115e-7
Identity = 40/196 (20.41%), Postives = 83/196 (42.35%), Query Frame = 1
Query:  958 QEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKL-------TGHSCRVLYLALSPDGSNVVTGAGDETLRFWNV 1524
            + VC   +S D ++LA+G  D  + +W++ +R  +                              +I + H   + ++ + P  + L++   G+ DR ++ W++ T Q   ++     V  +A SP   + ++  G     + VW       + +L       TGH   V  +  + DG +VV+G+ D +++ WN+
Sbjct:  447 RSVC---FSPDGKFLATGAEDRLIRIWDIENRKIV------------------------------MILQGHEQDIYSLDYFPSGDKLVS---GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAA-GSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 65.4698 bits (158), Expect = 1.343e-11
Identity = 65/283 (22.97%), Postives = 121/283 (42.76%), Query Frame = 1
Query:  745 TRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAW--NAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSL-------DKQYLASGGNDNRLVVWNLTSR------SGMGGTL------GDRATGAGTTGSSV---NSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWN 1521
            +R+  G      +IWD   +  + TL+GH   V  ++W  + E++A+GS D  + L D ++       L+ H + +  L W          K  LAS   D  + +W+  SR      SG   ++      G     +G+   +V   + N+   C+N   I ++HA  V  ++ S       A   G  D   K  +        +++   ++C    + +S E++ T        +        P+A++TGH   V ++A SPDG  +V+ + D +++ W+
Sbjct:  157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCIN---ILKSHAHWVNHLSLSTD----YALRIGAFDHTGKKPSTPEEAQKKALENYEKICKK--NGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430          

HSP 2 Score: 62.3882 bits (150), Expect = 1.231e-10
Identity = 36/133 (27.07%), Postives = 64/133 (48.12%), Query Frame = 1
Query:  646 VYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAE--LLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVW 1038
            ++LWN + S    +  +      +  VA+   G  +   +    +++WD    + + T  GH A V  +AW+++  LL S S+D  + + D RT       L  H+ EV  + WS+D + + SGG D  + +W
Sbjct:  383 MFLWNPLKS-TKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVD-LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          

HSP 3 Score: 59.6918 bits (143), Expect = 8.366e-10
Identity = 83/331 (25.08%), Postives = 128/331 (38.67%), Query Frame = 1
Query:  598 VDWSSQ-NVLAVG-LGTCVYLWNAVSSEINRLCD-VNSDSDTITSVAW-----CEKGT--RVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAE-LLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSS---VNSNAGSYCL---------NPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTG-SQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFW 1518
            V WS    V+A G +   + LW+  S +   L D +   S  ITS++W      + G+  R+A  +  G ++IWD  +     T+ GHT  V  + W  + LL SGS DR V + D  +       LK H   V  L  SL   Y    G  +       T        L +        G+S   + + +  Y +          P      H   V  +A+SP    ++++   + D  IK W+    + + +     + V  +AWS     LVS        + VW          L GH   V  +  S DG  V +G  D+ +R W
Sbjct:  192 VSWSPDGEVIATGSMDNTIRLWDPKSGQC--LGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHL--SLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSA---SFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCS--KDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          

HSP 4 Score: 49.2914 bits (116), Expect = 1.535e-6
Identity = 28/84 (33.33%), Postives = 44/84 (52.38%), Query Frame = 1
Query: 1270 LTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWN 1521
            +TR +      GS +   A++PH++  + T G   N   +W     TP+  L GH   VL ++ SPDG  + TG+ D T+R W+
Sbjct:  132 VTRSSSAIAGHGSTILCSAFAPHTSSRMVT-GAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWD 214          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Nematostella
Match: EDO45134 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTR8])

HSP 1 Score: 485.337 bits (1248), Expect = 8.023e-166
Identity = 265/524 (50.57%), Postives = 336/524 (64.12%), Query Frame = 1
Query:   55 MDSSYERRLF----GSPPFVSPVKSTH------------STPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASD---TNNSHNFDAEYNPNSVLENRR----NNNMLS--FR-QIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            MD  +ERRL      + P  SP+ S               +P  +P ++ Y DRFIP R  A WK N       +  EN      N     S SIT   G       A      N       E      LE+R+    N+N +   F+ Q+R S  +   +  +  P S+ ++R+L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWS+QN+L+VGLGTCVYLW+A +S++ +LCD++SD D++TSV+W E+   V+VGT+ G VQIWDA+A+++L T++GH+ARVG LAWN ++L+SGSRDR +  RDTR+ +   + L  HRQEVCGLKWS D Q+LASGGNDN+L+VWNL+                G+T              P   Y  H AAVKAI+WSPHQ+GLLASGGGTADR I+FWN LT Q +  VDTGSQVCN+AWS HSNELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K+  ++
Sbjct:    1 MDPGFERRLLMQQKATSPAASPISSVRIRYFMHLNSPLSCSPVASPSKERYSDRFIPSRLGAAWKSNYN-----YVQEN------NEPGTHSGSITREAGTETKEGFAYQCLLKNELLGAGIEDLKECQLEDRKVLSSNSNYVHNVFQYQVRRSKKEESSSAYSLSPVSKKSQRLLRSPRKSTRKISKIPFKVLDAPELQDDFYLNLVDWSAQNILSVGLGTCVYLWSACTSQVTKLCDLSSDGDSVTSVSWSERNGLVSVGTYKGLVQIWDASAQKKLLTMDGHSARVGALAWNGDMLSSGSRDRLILQRDTRSPTQLERRLVGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNLS----------------GST--------------PIQQYSEHTAAVKAISWSPHQHGLLASGGGTADRRIRFWNTLTGQPLQCVDTGSQVCNLAWSKHSNELVSTHGYSQNQILVWKYPSLTQVAKLTGHSFRVLYLAVSPDGEAIVTGAGDETLRFWNVFSKESKSE 483          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Nematostella
Match: EDO33700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRF1])

HSP 1 Score: 338.191 bits (866), Expect = 1.828e-108
Identity = 167/383 (43.60%), Postives = 243/383 (63.45%), Query Frame = 1
Query:  400 NNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            N  +L+++    +P +  + ++  + +S+ +K    S +   R +P+ P ++LDAPDL DD+YLNL+DWS  N LAV L   VYLWNA S +I +LC ++S    + SV+W  +G  +A+GT  G V++WD  ++++++ + GH +R+G L+WN+ +++SG R   +H  D R +      L +H QEVCGLKWS D +YLASGGNDN L +W+                 A  + S +++N+  +CL+       H AAVKA+ W P Q  +LASGGGTADR IKFWN  T   ++S+DT SQVC+I WS    EL+S+HGY+QNQ++VWKYP  T + +LTGHSCRVL++A+SPDG  VV+ A DETLR W  F    + K
Sbjct:  130 NARILAYKNKAPTPREG-YMNDLRVLYSQ-SKTTSVSKKKNWRHVPQVPERILDAPDLIDDYYLNLLDWSCNNHLAVALSGFVYLWNASSGDIVQLCKMDSPDSYVGSVSWIAEGNYLALGTSDGAVELWDVESQKRIRNMTGHPSRIGALSWNSFIVSSGCRSGKIHHHDVRAAEHHVATLDKHTQEVCGLKWSPDGKYLASGGNDNLLNIWD-----------------ANISASGISTNS-LFCLS------QHQAAVKALDWCPFQRNVLASGGGTADRQIKFWNASTGSCLNSIDTKSQVCSILWSKEYKELISSHGYAQNQLIVWKYPSMTKMTELTGHSCRVLHMAMSPDGQTVVSAAADETLRLWKCFTTDPTKK 486          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Nematostella
Match: EDO31404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY11])

HSP 1 Score: 276.944 bits (707), Expect = 8.197e-85
Identity = 157/348 (45.11%), Postives = 217/348 (62.36%), Query Frame = 1
Query:  523 TRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTR---VAVGTHHGKVQI-WDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            +R IP+ P ++LDAP+L DD+YLNL+DW + N+L++ L   VY+WNA SS+I  L  ++ + + ++SVAW ++ +    +AVGTH G VQ+    +  + ++ + GH ARVG+L+WN  LL+SGSR   +H  D R ++ +   L  H QEVCGLKWS D + LASGGNDN + +W   S                T GSS    +    + P     +H AAVKAI+W P Q  +LA+GGGTADR I+FWN  T   ++SVDT SQVC+I WS    E++S HG+SQ+Q+ +WKYP    +A LTGH+ RVL +A+SPDG  V + A DETLR W  F  Q   K T
Sbjct:  181 SRHIPQAPDRILDAPELLDDYYLNLLDWGNNNLLSLALAGAVYIWNAESSDIKHLFQMD-EGEYVSSVAWVQEHSMTQYLAVGTHDGNVQVRISQSGSKCVRCMGGHAARVGSLSWNCFLLSSGSRSGAIHHHDVRVANHKIGTLLNHSQEVCGLKWSPDGKLLASGGNDNVVNIWPYPS----------------TVGSSAGEPSP---VEPLFSLTHHQAAVKAISWCPWQPNVLATGGGTADRHIRFWNGSTGATLNSVDTKSQVCSILWSNEYKEIISGHGFSQHQLTIWKYPSMARVADLTGHTSRVLCMAMSPDGQYVASAAADETLRLWKCFATQPKQKKT 508          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Nematostella
Match: EDO33006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STH2])

HSP 1 Score: 102.449 bits (254), Expect = 4.771e-26
Identity = 46/110 (41.82%), Postives = 73/110 (66.36%), Query Frame = 1
Query:  589 LNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTR 918
            LNL+DWS  N LAV L   VYLWNA S +I +LC ++S    + SV+W  +G  +A+GT  G V++WD  ++++++ + GH +R+G L+WN+ +++SG R   +H  D R
Sbjct:    1 LNLLDWSCNNHLAVALSGFVYLWNASSGDIVQLCKLDSPDSYVGSVSWIAEGNYLALGTSDGAVELWDVESQKRIRNMTGHPSRIGALSWNSFIVSSGCRSGKIHHHDVR 110          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Nematostella
Match: EDO32308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE1])

HSP 1 Score: 88.9669 bits (219), Expect = 1.036e-21
Identity = 40/81 (49.38%), Postives = 51/81 (62.96%), Query Frame = 1
Query: 1312 VCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            VC+I WS    E++S HG SQ+Q+ +WKY     +A LTGH+ RVL +A+SPDG  V + A DETLR W  F  Q   K T
Sbjct:    1 VCSILWSNEYKEIISGHGLSQHQLTIWKYTSMAHVADLTGHTSRVLCMAMSPDGQYVASAAADETLRLWKCFATQPKQKKT 81          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Medaka
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:NCBI gene;Acc:101164344])

HSP 1 Score: 476.093 bits (1224), Expect = 1.424e-161
Identity = 261/520 (50.19%), Postives = 326/520 (62.69%), Query Frame = 1
Query:   55 MDSSYERRLF---------GSP-PF--VSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNL-------PINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEF-KPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YE RL           SP P   V+ V+S   T +       + DRFIP R  A W  N    +++ +IE   N          ++N  D  +   LL + +         +  + D    P++  +    +  +S ++          +  +  P S N++++L+SPR  TRKI K P+KVLDAP+LQDDFYLNLVDWSS NVL+VGLGTCVYLW+A +S++ RLCD++ + D++TSV W E+G  VAVGTH G VQIWDAAA ++L  LEGHTARVG LAWNA+ L+SGSRDR +  RD R    +  + L+ HRQEVCGLKWS D Q LASGGNDN+L+VWN +S                              + P   Y  H AAVKAIAWSPHQ+GLLASGGGTADRCI+FWN LT Q +   DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K +STK +
Sbjct:    1 MDQDYECRLLKQINIQNENASPSPIKAVAAVRSLTPTSSPLSSPSKHGDRFIPSRAGANWSVN---FHRINEIEKSHNQNRKTKDGTTDSNKADGLAYLALLKNELLGAGIEKVQDPQSEDRRLQPSTPAKRSLFSYSVSTKRTLPEEDGNTVSPYSLSPVSSNSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGYVQIWDAAAGKKLSVLEGHTARVGALAWNADQLSSGSRDRVILQRDIRAPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSS------------------------------VVPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCTDTGSQVCNLAWSKHTNELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKMRSTKES 487          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Medaka
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:101174862])

HSP 1 Score: 474.552 bits (1220), Expect = 4.083e-161
Identity = 263/527 (49.91%), Postives = 328/527 (62.24%), Query Frame = 1
Query:   55 MDSSYERRLFG--------SPPFVSPVKSTHSTPNK-TPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIEN-IQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLF---AHNTGIPF--------------SENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MD  YERRL          S   ++ V+S  S     +PV     DRFIP R  + W  N   HY   +  +  QN    +   DS         L+ +EL          D+  +P+   ++RR+        +    S+ LF    H   +PF              S  + ++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWS+ N+L+VGLG CVYLW+A +S++ RLCD++ D D++TSV W E+G+ V+VGTH G VQIWDAA  ++L +LEGH+ARVG LAWN E L+SGSRDR +  RD RT  +  + L+ HRQEVCGLKWS D Q+LASGGNDN+L+VWN +S                              L P   Y +H AAVKAIAWSPHQ+GLLASGGGTADRC++FWN LT QA+ S DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K + TK +
Sbjct:    1 MDQEYERRLLRQINHQNLPSKACLTKVRSRESLGAACSPVSVKSGDRFIPTRAGSNWSIN--FHYANENCRSPSQNYKAKDAGSDSGKDAVAYAALLRNELLGA-----GIDSVPDPHG--DDRRH-------AVLTQDSRGLFRYTVHTKRVPFDSDNEVSPYSLSPLSNKSHKLLRSPRKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLSVDGDSVTSVCWNERGSLVSVGTHKGYVQIWDAAGGRKLTSLEGHSARVGALAWNGEQLSSGSRDRVILQRDVRTPPSAERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSS------------------------------LLPVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVFSKTRCTKES 481          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Medaka
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:101174862])

HSP 1 Score: 472.626 bits (1215), Expect = 1.757e-160
Identity = 262/522 (50.19%), Postives = 324/522 (62.07%), Query Frame = 1
Query:   55 MDSSYERRLFGS------PPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIEN-IQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLF---AHNTGIPF--------------SENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTK 1548
            MD  YERRL         P      KS  +    +PV     DRFIP R  + W  N   HY   +  +  QN    +   DS         L+ +EL          D+  +P+   ++RR+        +    S+ LF    H   +PF              S  + ++L+SPR   RKI K P+KVLDAP+LQDDFYLNLVDWS+ N+L+VGLG CVYLW+A +S++ RLCD++ D D++TSV W E+G+ V+VGTH G VQIWDAA  ++L +LEGH+ARVG LAWN E L+SGSRDR +  RD RT  +  + L+ HRQEVCGLKWS D Q+LASGGNDN+L+VWN +S                              L P   Y +H AAVKAIAWSPHQ+GLLASGGGTADRC++FWN LT QA+ S DTGSQVCN+AWS H+NELVSTHGYSQNQI+VWKYP  T +AKLTGHS RVLYLA+SPDG  +VTGAGDETLRFWNVF K + TK
Sbjct:    1 MDQEYERRLLRQINHQNLPSKACLTKSLGAAC--SPVSVKSGDRFIPTRAGSNWSIN--FHYANENCRSPSQNYKAKDAGSDSGKDAVAYAALLRNELLGA-----GIDSVPDPHG--DDRRH-------AVLTQDSRGLFRYTVHTKRVPFDSDNEVSPYSLSPLSNKSHKLLRSPRKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLSVDGDSVTSVCWNERGSLVSVGTHKGYVQIWDAAGGRKLTSLEGHSARVGALAWNGEQLSSGSRDRVILQRDVRTPPSAERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSS------------------------------LLPVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVFSKTRCTK 474          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Medaka
Match: cdc20 (cell division cycle 20 [Source:NCBI gene;Acc:100301582])

HSP 1 Score: 311.612 bits (797), Expect = 6.451e-98
Identity = 195/495 (39.39%), Postives = 273/495 (55.15%), Query Frame = 1
Query:   85 GSPPFVSPVKSTHSTPNKTPVE------KVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELA-SDTNNSHNF-DAEY-----NPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            G P  VS   S+  TP+KTP +      K+  DRFIP RNS           +  D+ N   L   N   D+    N  G  ++S+ A S + N +N  DA+       P +  E  +NN             K+L++  +  P S  TK+        TR I   P ++LDAPDL++DFYLNL+DW S N+LAV L   VYLW+A   +I  L  +  + D I S++W + G+ +AVGT   KVQ+WD   +++L+++  HTARVG+L+WN  +L+SGSR  ++H  D R +      L  H QEVCGL+WS D +YLASGGNDN + VW                      GS+ N      C      +  H  AVKA+AW P Q+ +LASGGGT+DR I+ WN+ +   + S+DT SQV ++ ++P+  ELVS HGY+ N +V+WKYP  + +A+L GH  RVL + LSPDGS + + AGDET+R W  FE
Sbjct:   46 GKPTNVS--LSSSKTPSKTPGKSKKTPSKIGGDRFIPTRNS-----------KQMDVANFL-LTKENEPLDA----NTAGSTLESQKAWSVSLNGYNIEDAKILHFGGKPLNAPEGYQNN------------LKVLYSQGS-TPAS--TKK--------TRYISSTPDRILDAPDLRNDFYLNLLDWGSHNILAVALHNSVYLWDATKGDIILLMRMEREEDYICSLSWTKDGSYLAVGTSDCKVQLWDVENQKRLRSMSSHTARVGSLSWNDHILSSGSRSGHIHHHDVRVADHHIFTLTTHTQEVCGLQWSPDGRYLASGGNDNLVCVWPRVHE-----------------GSAGNDTQFVNC------WSEHQGAVKALAWCPWQSNILASGGGTSDRHIRIWNVNSGSCISSLDTQSQVSSLVFAPNYKELVSAHGYAHNNVVIWKYPSFSKVAELNGHEDRVLSVILSPDGSTIASVAGDETIRLWKSFE 476          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Medaka
Match: cdc20 (cell division cycle 20 [Source:NCBI gene;Acc:100301582])

HSP 1 Score: 311.612 bits (797), Expect = 6.451e-98
Identity = 195/495 (39.39%), Postives = 273/495 (55.15%), Query Frame = 1
Query:   85 GSPPFVSPVKSTHSTPNKTPVE------KVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELA-SDTNNSHNF-DAEY-----NPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            G P  VS   S+  TP+KTP +      K+  DRFIP RNS           +  D+ N   L   N   D+    N  G  ++S+ A S + N +N  DA+       P +  E  +NN             K+L++  +  P S  TK+        TR I   P ++LDAPDL++DFYLNL+DW S N+LAV L   VYLW+A   +I  L  +  + D I S++W + G+ +AVGT   KVQ+WD   +++L+++  HTARVG+L+WN  +L+SGSR  ++H  D R +      L  H QEVCGL+WS D +YLASGGNDN + VW                      GS+ N      C      +  H  AVKA+AW P Q+ +LASGGGT+DR I+ WN+ +   + S+DT SQV ++ ++P+  ELVS HGY+ N +V+WKYP  + +A+L GH  RVL + LSPDGS + + AGDET+R W  FE
Sbjct:   46 GKPTNVS--LSSSKTPSKTPGKSKKTPSKIGGDRFIPTRNS-----------KQMDVANFL-LTKENEPLDA----NTAGSTLESQKAWSVSLNGYNIEDAKILHFGGKPLNAPEGYQNN------------LKVLYSQGS-TPAS--TKK--------TRYISSTPDRILDAPDLRNDFYLNLLDWGSHNILAVALHNSVYLWDATKGDIILLMRMEREEDYICSLSWTKDGSYLAVGTSDCKVQLWDVENQKRLRSMSSHTARVGSLSWNDHILSSGSRSGHIHHHDVRVADHHIFTLTTHTQEVCGLQWSPDGRYLASGGNDNLVCVWPRVHE-----------------GSAGNDTQFVNC------WSEHQGAVKALAWCPWQSNILASGGGTSDRHIRIWNVNSGSCISSLDTQSQVSSLVFAPNYKELVSAHGYAHNNVVIWKYPSFSKVAELNGHEDRVLSVILSPDGSTIASVAGDETIRLWKSFE 476          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Planmine SMEST
Match: SMESG000011293.1 (SMESG000011293.1)

HSP 1 Score: 1043.49 bits (2697), Expect = 0.000e+0
Identity = 500/500 (100.00%), Postives = 500/500 (100.00%), Query Frame = 1
Query:   55 MDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 1554
            MDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT
Sbjct:    1 MDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKENKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHNFDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRILQSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT 500          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Planmine SMEST
Match: SMESG000051492.1 (SMESG000051492.1)

HSP 1 Score: 108.997 bits (271), Expect = 8.107e-25
Identity = 87/351 (24.79%), Postives = 158/351 (45.01%), Query Frame = 1
Query:  514 RPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVN-SDSDTITSVAWCEKGTR------VAVGTHHGKVQIWDAAAEQQLQTLEG----HTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNEL-VSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE 1530
            R   R I   P +VLDAP++    + N++DWS QNV+AV LG+ VYLW+A++ ++  + +   + S +I+ + W   GT+      +A+G+  G + +WD+  + +++ +      + + V ++A    +L+ G     +   D R +S    P  ++++ +  LKWSLD  YLA    D+ L  W                       SS           P +++ +    +  IAWS     +           +K +NI  R  + ++ TG  +  + WS    E+ + +   +  +I V        + +L GH   +L +A +P G  + T   DE +R WN F+
Sbjct:  130 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFH-GTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHV-PDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFW-----------------AENRLYSS-----------PLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQ 446          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Planmine SMEST
Match: SMESG000045329.1 (SMESG000045329.1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.790e-13
Identity = 54/237 (22.78%), Postives = 98/237 (41.35%), Query Frame = 1
Query:  820 LEGHTARV--GTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRC-IKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWN 1521
            L GH   V  G  A     LAS   DR + L +T     +   L  H   +  L++S D  ++ +   D  +++W+          +G+R                         ++ H + V +++   H   L  SG   +D C I+ W+   +   H++D    V ++A+SP  + + S  G  +N I  W       +    GH+  +  +A+S DG+ +++ + D TLR W+
Sbjct:   56 LSGHKGEVFCGKFAPEGSFLASAGHDREIILWNTYGDIKDLAVLSGHNGAILDLQFSSDSDWIYTASTDKTVMIWDTR--------VGERVKK----------------------FKGHTSIVNSVSAVSHTRELFCSG---SDDCKIRLWDKRVKNTTHTIDAKHSVLDVAYSPFGDYIFS--GGIENVINQWDVREMKIIQTFAGHTDSITSVAVSNDGNFLLSNSVDNTLRVWD 257          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Planmine SMEST
Match: SMESG000006229.1 (SMESG000006229.1)

HSP 1 Score: 71.2478 bits (173), Expect = 9.921e-13
Identity = 62/262 (23.66%), Postives = 119/262 (45.42%), Query Frame = 1
Query:  751 VAVGTHHGKVQIWDAAAEQQLQTLEGHTA-RVGTLAWN--AELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDT-GSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNV 1524
            +A   H G V++W  ++++ +  +EGH   RV  L ++     LA+   D +  L D  T   E    + H +EV  + +  D   + SGG D+   VW+L  RSG                          C+      E H+  + +  WS   NG      G+AD   K W++  +Q ++++    S V  + + P  ++ + T  Y  ++  +W +P  TP+ ++T H+ ++++  +S D + + T + D+ ++ W+V
Sbjct:  228 LATSDHDGCVKLWSLSSQEPVGFVEGHEPHRVSKLDFHPSGRFLATTCSDYSWRLWDL-TVGEEILHQEGHSKEVYDINFHPDGSLILSGGFDSFGRVWDL--RSGR-------------------------CI---YFLEGHSDKILSAVWS--DNGC-HMATGSADNTAKIWDLRYKQCIYTIPAHQSSVSAVKFQPGLSQFILTTSYD-HKTKIWAHPTWTPIKEMTEHTEKIMHSDISRDCNYIATCSFDKQVKLWSV 454          
BLAST of Fizzy/cell division cycle 20 related 1a vs. Planmine SMEST
Match: SMESG000050897.1 (SMESG000050897.1)

HSP 1 Score: 64.6994 bits (156), Expect = 7.036e-11
Identity = 62/243 (25.51%), Postives = 102/243 (41.98%), Query Frame = 1
Query:  814 QTLEGHTARVGTLAW--NAELLASGSRDRNVHLRDTRTSSTEFKPLK----EHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPG--CTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFW 1518
            Q L GHT RV  L+W  N  LLAS S D+ V +     S+  +K +     +H + +  + WS    YLAS G D  + +  + SR+ +     +  T                         +H   +K+++WS   N L +     + R     +I +   + ++     V ++ W P ++ LVS+     N I + K  G      A LTGH   V     + DGS + + + D+T+R W
Sbjct:    5 QALSGHTDRVWDLSWNFNGSLLASCSGDKTVRIWSFSNSTQNWKCINVLDGKHTRTIRCVSWSPCGNYLASAGFDGVVYIEEIVSRNPLEFESTEFPT-------------------------DHLHEIKSVSWSASGNYLASCARDKSVRIFDIEDINSPYCLETILHTQDVKSVKWHPITDILVSSS--YDNTIKILKEDGEDWVEEASLTGHLSTVWTAEFNYDGSILASCSDDKTIRLW 220          
The following BLAST results are available for this feature:
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZR18.307e-16450.77fizzy and cell division cycle 20 related 1 [Source... [more]
FZR18.307e-16450.77fizzy and cell division cycle 20 related 1 [Source... [more]
FZR11.547e-16350.87fizzy and cell division cycle 20 related 1 [Source... [more]
FZR16.582e-12262.59fizzy and cell division cycle 20 related 1 [Source... [more]
CDC206.854e-10238.13cell division cycle 20 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzr-11.044e-14056.70FiZzy Related family [Source:UniProtKB/TrEMBL;Acc... [more]
fzy-19.469e-2623.17WD repeat-containing protein fzy-1 [Source:UniPro... [more]
W07E6.28.180e-1224.91pep chromosome:WBcel235:II:480722:484386:-1 gene:W... [more]
prp-42.587e-1121.32Yeast PRP (Splicing factor) related [Source:UniPr... [more]
lin-537.957e-1127.08Probable histone-binding protein lin-53 [Source:U... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzr8.613e-16150.79gene:FBgn0262699 transcript:FBtr0070687[more]
fzr8.613e-16150.79gene:FBgn0262699 transcript:FBtr0070686[more]
fzr21.944e-11943.96gene:FBgn0034937 transcript:FBtr0072146[more]
fzy1.478e-10238.38gene:FBgn0001086 transcript:FBtr0080833[more]
CG34362.817e-1323.33gene:FBgn0031229 transcript:FBtr0078119[more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzr1a4.525e-16350.67fizzy/cell division cycle 20 related 1a [Source:ZF... [more]
fzr1a4.525e-16350.67fizzy/cell division cycle 20 related 1a [Source:ZF... [more]
fzr1b2.161e-16050.88fizzy/cell division cycle 20 related 1b [Source:ZF... [more]
fzr1b7.277e-16050.68fizzy/cell division cycle 20 related 1b [Source:ZF... [more]
cdc204.099e-9443.02cell division cycle 20 homolog [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln18.149e-16551.74mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338][more]
mcoln11.559e-16251.54mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338][more]
mcoln11.123e-14250.10mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338][more]
mcoln11.020e-12162.67mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338][more]
cdc203.662e-9442.78cell division cycle 20 [Source:NCBI gene;Acc:39454... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzr11.554e-16451.25fizzy and cell division cycle 20 related 1 [Source... [more]
Fzr13.063e-12162.24fizzy and cell division cycle 20 related 1 [Source... [more]
Cdc204.231e-10245.75cell division cycle 20 [Source:MGI Symbol;Acc:MGI:... [more]
Fzr11.496e-8245.64fizzy and cell division cycle 20 related 1 [Source... [more]
Cdc20b2.325e-5736.59cell division cycle 20B [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R1K5|FZR1_MOUSE1.087e-16351.25Fizzy-related protein homolog OS=Mus musculus OX=1... [more]
sp|Q9UM11|FZR1_HUMAN7.427e-16350.87Fizzy-related protein homolog OS=Homo sapiens OX=9... [more]
sp|Q8L3Z8|FZR2_ARATH8.666e-13758.43Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana OX... [more]
sp|Q8VZS9|FZR1_ARATH1.249e-13247.76Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana OX... [more]
sp|Q8LPL5|FZR3_ARATH1.451e-12646.52Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana OX... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JHS82.275e-16551.08fizzy-related protein homolog isoform X1 OS=Lingul... [more]
A0A0B7BI941.789e-16450.97WD_REPEATS_REGION domain-containing protein OS=Ari... [more]
A0A1S3JGC03.207e-16450.79fizzy-related protein homolog isoform X2 OS=Lingul... [more]
C0HB412.912e-16251.92Fizzy-related protein homolog OS=Salmo salar OX=80... [more]
A0A4W3H7705.755e-16250.97WD_REPEATS_REGION domain-containing protein OS=Cal... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzr1a1.111e-16651.33fizzy and cell division cycle 20 related 1 [Source... [more]
ENSAMXT00000052515.19.480e-16450.49fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
fzr1b2.166e-16150.58fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
fzr1b9.820e-14249.17fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
fzr1a6.610e-12161.90fizzy and cell division cycle 20 related 1 [Source... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzr1a7.265e-15551.19fizzy/cell division cycle 20 related 1a [Source:ZF... [more]
cdc205.316e-8635.24cell division cycle 20 homolog [Source:ZFIN;Acc:ZD... [more]
POC1A8.783e-1123.66POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
ENSPMAT00000005462.11.671e-1024.73pep scaffold:Pmarinus_7.0:GL486569:2309:8090:1 gen... [more]
ENSPMAT00000008002.11.994e-926.16pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDH12.738e-10242.64Activator of anaphase-promoting complex/cyclosome ... [more]
CDC201.971e-6535.84Activator of anaphase-promoting complex/cyclosome ... [more]
AMA11.245e-3728.27Activator of meiotic anaphase promoting complex (A... [more]
TUP19.199e-1222.84General repressor of transcription; forms complex ... [more]
RSA41.343e-1122.97WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451348.023e-16650.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337001.828e-10843.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314048.197e-8545.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330064.771e-2641.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323081.036e-2149.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZR11.424e-16150.19fizzy and cell division cycle 20 related 1 [Source... [more]
fzr1b4.083e-16149.91fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
fzr1b1.757e-16050.19fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
cdc206.451e-9839.39cell division cycle 20 [Source:NCBI gene;Acc:10030... [more]
cdc206.451e-9839.39cell division cycle 20 [Source:NCBI gene;Acc:10030... [more]
back to top
BLAST of Fizzy/cell division cycle 20 related 1a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011293.10.000e+0100.00SMESG000011293.1[more]
SMESG000051492.18.107e-2524.79SMESG000051492.1[more]
SMESG000045329.16.790e-1322.78SMESG000045329.1[more]
SMESG000006229.19.921e-1323.66SMESG000006229.1[more]
SMESG000050897.17.036e-1125.51SMESG000050897.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033024 ID=SMED30033024|Name=Fizzy/cell division cycle 20 related 1a|organism=Schmidtea mediterranea sexual|type=transcript|length=2127bp
AATATTAATGCAGTTTTTATTTAAACACAAATACCTATTTTAGTTAATAC
ACTCATGGATAGTTCATATGAGCGTCGATTATTTGGTTCACCTCCATTTG
TTTCACCAGTGAAATCTACACACTCAACTCCTAATAAAACTCCAGTTGAA
AAAGTTTATCATGACAGATTTATCCCCGTTCGTAATAGCGCACTATGGAA
AGAGAACAAACAAGAACATTATCAAATGTTTGATATCGAAAATATTCAAA
ATCTACCTATAAATAATAATGATTGCGATAGTAAATCCATTACTAATTTA
TTGGGTGATCTAATCGACAGCGAACTAGCTAGCGATACTAATAATTCACA
TAATTTTGACGCAGAATACAATCCAAATAGTGTATTAGAAAATAGAAGAA
ATAACAACATGCTTTCATTTAGACAGATAAGAGAATCTCCAAGTAAACTA
CTGTTTGCCCACAATACCGGAATTCCTTTTTCAGAAAATACAAAACGCAT
ATTACAAAGTCCAAGACCGCAAACAAGAAAAATTCCCAAATTTCCCTACA
AAGTTCTAGACGCGCCAGATTTGCAAGATGATTTCTATTTAAATCTAGTT
GATTGGTCTTCTCAGAATGTACTTGCAGTTGGTTTAGGAACTTGTGTTTA
TTTATGGAATGCAGTCTCGTCTGAGATCAATCGGTTATGCGATGTGAACT
CTGACAGTGACACAATCACATCAGTGGCCTGGTGTGAAAAAGGCACTCGA
GTGGCAGTTGGCACTCACCATGGTAAGGTTCAGATCTGGGATGCTGCCGC
TGAGCAACAGTTACAGACATTAGAAGGCCATACGGCTCGAGTGGGAACAT
TGGCCTGGAATGCCGAGTTGCTGGCATCAGGCAGTCGAGACCGCAATGTG
CATTTACGCGACACCAGAACCTCATCGACCGAATTCAAGCCGCTCAAGGA
GCATCGACAAGAAGTGTGTGGCCTGAAATGGTCGCTAGACAAGCAGTATT
TGGCGTCAGGGGGTAACGACAACCGATTGGTCGTATGGAATCTGACGAGC
CGCAGTGGGATGGGTGGGACATTGGGTGACAGGGCGACCGGGGCAGGCAC
CACTGGCAGTTCCGTGAATTCCAACGCCGGCAGCTACTGCCTGAACCCGT
TCATAATCTATGAGAACCATGCTGCCGCCGTGAAAGCTATCGCCTGGTCC
CCACATCAGAATGGGCTGCTGGCCAGTGGCGGTGGCACAGCTGATAGGTG
CATCAAATTCTGGAACATCCTCACCCGACAAGCAGTCCACAGCGTCGACA
CCGGCAGCCAGGTCTGCAACATCGCCTGGTCTCCACATTCCAATGAATTG
GTATCGACACATGGATATTCACAGAACCAAATCGTCGTATGGAAATATCC
CGGCTGTACGCCACTCGCAAAGCTCACTGGACATTCGTGTCGCGTTCTCT
ATCTTGCACTGAGTCCTGACGGCTCAAATGTTGTCACAGGCGCCGGTGAT
GAAACTTTGCGATTTTGGAACGTGTTTGAGAAACAGAAATCCACCAAAGC
CACCACAGTGAGGATTATGATTTATATTACTATTATATTACTGATTAACC
GATTATTAATTAATTAATATTAAGTTATGTATTAATTAACATTATACGTT
TAATTGATTTTAAATTAACTTATTTTTGATATACAAAATACACAACGCGA
GTAATTAGGGTTAAACGTCACATGTTGCAACTTGGCACTTGGTAAAATAT
CGAATCGAACCTTTAACCAACGGTTGCGTGATGAGATCTCTCGATGGTTC
CCTTAAGCAATATGAATAACCTGCAATCATTTAAACACGCGTCTACTATC
TATTTCGTCCGTTTTATATAAATTTTCTGTAATTTTATTCATTCATTTTT
AATTGAAAGATTTTAATTTTTTAAATTTAAAGCAAACAATCAAAAACCAC
ACTAAAATCTTTAACTATTTTATTACCTTCAGAACGGTTGCACTCAGGAC
TTAGTACATTTGTGCTCTTATCCAATGAACTTATCAACAGTGCTTCACAT
ATTACATGTTCCAAATAATTATATAAACGTTTTAGCACTTTTAAAATCAG
ACACGCCCATCAAACATATACATACAC
back to top

protein sequence of SMED30033024-orf-1

>SMED30033024-orf-1 ID=SMED30033024-orf-1|Name=SMED30033024-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MCRYQFIGMWRPGDVADLAAGVDAVDCLSGEDVPEFDAPISCATATGQQP
ILMWGPGDSFHGGSMVLIDYERVQAVAAGVGIHGTASGACPGRPVTQCPT
HPTAARQIPYDQSVVVTP*
back to top

protein sequence of SMED30033024-orf-2

>SMED30033024-orf-2 ID=SMED30033024-orf-2|Name=SMED30033024-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=521bp
MDSSYERRLFGSPPFVSPVKSTHSTPNKTPVEKVYHDRFIPVRNSALWKE
NKQEHYQMFDIENIQNLPINNNDCDSKSITNLLGDLIDSELASDTNNSHN
FDAEYNPNSVLENRRNNNMLSFRQIRESPSKLLFAHNTGIPFSENTKRIL
QSPRPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYL
WNAVSSEINRLCDVNSDSDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAE
QQLQTLEGHTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEH
RQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTT
GSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCI
KFWNILTRQAVHSVDTGSQVCNIAWSPHSNELVSTHGYSQNQIVVWKYPG
CTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFEKQKSTKAT
TVRIMIYITIILLINRLLIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR033010Cdc20/Fizzy
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR024977Apc4_WD40_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0010997anaphase-promoting complex binding
GO:0097027ubiquitin-protein transferase activator activity
Vocabulary: biological process
TermDefinition
GO:0051301cell division
GO:1904668positive regulation of ubiquitin protein ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 450..489
e-value: 1.8E-6
score: 37.5
coord: 207..246
e-value: 0.016
score: 24.4
coord: 290..329
e-value: 8.3E-6
score: 35.3
coord: 407..447
e-value: 17.0
score: 9.2
coord: 362..404
e-value: 0.03
score: 23.5
coord: 249..286
e-value: 9.7E-5
score: 31.8
IPR001680WD40 repeatPFAMPF00400WD40coord: 295..329
e-value: 2.2E-4
score: 22.0
coord: 365..404
e-value: 0.002
score: 18.9
coord: 453..489
e-value: 1.0E-4
score: 23.0
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 457..498
score: 14.017
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 256..295
score: 9.807
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 297..332
score: 12.981
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 214..255
score: 11.21
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 161..492
e-value: 5.3E-116
score: 388.9
IPR024977Anaphase-promoting complex subunit 4, WD40 domainPFAMPF12894ANAPC4_WD40coord: 215..270
e-value: 6.2E-5
score: 23.2
IPR033010The WD repeat Cdc20/Fizzy familyPANTHERPTHR19918CELL DIVISION CYCLE 20 CDC20 FIZZY -RELATEDcoord: 24..500
NoneNo IPR availablePANTHERPTHR19918:SF1FIZZY-RELATED PROTEIN HOMOLOGcoord: 24..500
NoneNo IPR availableTMHMMTMhelixcoord: 500..519
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 391..405
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 316..330
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 476..490
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 214..498
score: 32.404
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 140..490