Histone acetyltransferase KAT6A

Overview
NameHistone acetyltransferase KAT6A
Smed IDSMED30033020
Length (bp)2755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone acetyltransferase KAT6A (SMED30033020) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone acetyltransferase KAT6A (SMED30033020) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone acetyltransferase KAT6A (SMED30033020) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone acetyltransferase KAT6A (SMED30033020) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033020

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033020h1SMcG0018103 SmedASXL_015134SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033020h1SMcG0003207 Contig4555GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033020h1SMcG0018103 Contig4555GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30033020h1SMcG0018103 dd_Smed_v4_11245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033020h1SMcG0018103 dd_Smed_v4_11245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033020h1SMcG0018103 dd_Smed_v4_11245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033020h1SMcG0018103 dd_Smed_v4_11245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033020h1SMcG0018103 dd_Smed_v4_11245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Human
Match: SAMD1 (sterile alpha motif domain containing 1 [Source:HGNC Symbol;Acc:HGNC:17958])

HSP 1 Score: 83.9593 bits (206), Expect = 1.765e-18
Identity = 39/74 (52.70%), Postives = 52/74 (70.27%), Query Frame = 1
Query: 2404 KIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQNDG 2625
            K +P D  +W+  DV ++ TE GF  Q+  F+EQEIDG SLLLM+R DVLT L+++LGPA+KIYE   K+   G
Sbjct:   47 KEKPSDPVEWTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPALKIYEHHIKVLQQG 120          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Human
Match: KAT6A (lysine acetyltransferase 6A [Source:HGNC Symbol;Acc:HGNC:13013])

HSP 1 Score: 86.2705 bits (212), Expect = 2.194e-17
Identity = 47/137 (34.31%), Postives = 70/137 (51.09%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNCYKEGFRIRSEESMKNSSDSITKTY 2277
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C     R +  + ++  +  I + Y
Sbjct:  202 VAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQICRP---RKKGRKLLQKKAAQIKRRY 331          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Human
Match: KAT6A (lysine acetyltransferase 6A [Source:HGNC Symbol;Acc:HGNC:13013])

HSP 1 Score: 87.8113 bits (216), Expect = 7.981e-17
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Human
Match: KAT6A (lysine acetyltransferase 6A [Source:HGNC Symbol;Acc:HGNC:13013])

HSP 1 Score: 87.8113 bits (216), Expect = 8.468e-17
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Human
Match: KAT6A (lysine acetyltransferase 6A [Source:HGNC Symbol;Acc:HGNC:13013])

HSP 1 Score: 87.8113 bits (216), Expect = 8.468e-17
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Celegans
Match: dpff-1 (Zinc finger protein dpff-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09477])

HSP 1 Score: 67.781 bits (164), Expect = 1.195e-11
Identity = 26/74 (35.14%), Postives = 44/74 (59.46%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQE 2166
            E  + C DC    HPSCL++   +T+  ++S WQC  CK+C +C    +++ +  CD CD+G+H  C  P +++
Sbjct:  274 EDLVSCHDCGRSGHPSCLNFNQNVTKIIKRSGWQCLECKSCTICGTSENDDKLLFCDDCDRGYHLYCLTPALEK 347          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Celegans
Match: phf-10 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2A949])

HSP 1 Score: 54.6842 bits (130), Expect = 6.100e-9
Identity = 18/62 (29.03%), Postives = 28/62 (45.16%), Query Frame = 1
Query: 1960 CKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSAC 2145
            C  C +  HP C+     +    +   W C  C+ C +C      + +  CD CD+GFH+ C
Sbjct:    4 CATCKIAYHPQCIEMPERMAALVKTYEWSCVDCRLCSICNKPEKEDEIVFCDRCDRGFHTYC 65          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Celegans
Match: phf-10 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2A949])

HSP 1 Score: 55.0694 bits (131), Expect = 1.600e-7
Identity = 20/75 (26.67%), Postives = 33/75 (44.00%), Query Frame = 1
Query: 1921 CKSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSAC 2145
            C S +    + + C  C +  HP C+     +    +   W C  C+ C +C      + +  CD CD+GFH+ C
Sbjct:  335 CDSCEKTGGEMICCATCKIAYHPQCIEMPERMAALVKTYEWSCVDCRLCSICNKPEKEDEIVFCDRCDRGFHTYC 409          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Celegans
Match: phf-10 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2A949])

HSP 1 Score: 55.0694 bits (131), Expect = 1.600e-7
Identity = 20/75 (26.67%), Postives = 33/75 (44.00%), Query Frame = 1
Query: 1921 CKSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSAC 2145
            C S +    + + C  C +  HP C+     +    +   W C  C+ C +C      + +  CD CD+GFH+ C
Sbjct:  335 CDSCEKTGGEMICCATCKIAYHPQCIEMPERMAALVKTYEWSCVDCRLCSICNKPEKEDEIVFCDRCDRGFHTYC 409          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0335258)

HSP 1 Score: 72.0182 bits (175), Expect = 1.165e-12
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIR 2229
            E+ + C DC    HPSCL +   +    ++  WQC  CK C +C    +++ +  CD CD+G+H  C  P +  P     +W C  C +E  +I+
Sbjct:  404 EELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPE--GSWSCKLCMEEFHKIK 496          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0086082)

HSP 1 Score: 72.0182 bits (175), Expect = 1.189e-12
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIR 2229
            E+ + C DC    HPSCL +   +    ++  WQC  CK C +C    +++ +  CD CD+G+H  C  P +  P     +W C  C +E  +I+
Sbjct:  405 EELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPE--GSWSCKLCMEEFHKIK 497          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0111115)

HSP 1 Score: 70.8626 bits (172), Expect = 1.288e-12
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIR 2229
            E+ + C DC    HPSCL +   +    ++  WQC  CK C +C    +++ +  CD CD+G+H  C  P +  P     +W C  C +E  +I+
Sbjct:  247 EELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPE--GSWSCKLCMEEFHKIK 339          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0086083)

HSP 1 Score: 72.0182 bits (175), Expect = 1.312e-12
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIR 2229
            E+ + C DC    HPSCL +   +    ++  WQC  CK C +C    +++ +  CD CD+G+H  C  P +  P     +W C  C +E  +I+
Sbjct:  403 EELVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPE--GSWSCKLCMEEFHKIK 495          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Fly
Match: e(y)3 (gene:FBgn0087008 transcript:FBtr0334279)

HSP 1 Score: 66.6254 bits (161), Expect = 1.156e-10
Identity = 25/67 (37.31%), Postives = 35/67 (52.24%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSAC 2145
            E F+ C  C  +VHPSC+   P +  R R   WQC+ CK C  C+       +  C+ CD+G+H  C
Sbjct: 1717 EAFIRCYTCRKRVHPSCVDMPPRMVGRVRNYNWQCAGCKCCIKCRSSQRPGKMLYCEQCDRGYHIYC 1783          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Zebrafish
Match: kat6a (K(lysine) acetyltransferase 6A [Source:ZFIN;Acc:ZDB-GENE-021022-3])

HSP 1 Score: 88.5817 bits (218), Expect = 2.970e-17
Identity = 46/113 (40.71%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 1891 VGAVIELCSEC---KSPQTDY--EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C   K    D   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  223 VAEPIPICSFCLGTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTVRVKALWWQCIECKTCSSCQDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 331          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Zebrafish
Match: samd13 (sterile alpha motif domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-060929-676])

HSP 1 Score: 72.7886 bits (177), Expect = 3.907e-15
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query: 2419 DVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            D   W+  DV ++    GF  Q+N F++QEIDG SLLLM R DVLT L++KLGPA+KIYE  +K +Q
Sbjct:   22 DPAHWAVADVVNYFKATGFEEQANAFQDQEIDGKSLLLMTRNDVLTGLSIKLGPALKIYEYHVKPLQ 88          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Zebrafish
Match: samd13 (sterile alpha motif domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-060929-676])

HSP 1 Score: 72.7886 bits (177), Expect = 3.907e-15
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query: 2419 DVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            D   W+  DV ++    GF  Q+N F++QEIDG SLLLM R DVLT L++KLGPA+KIYE  +K +Q
Sbjct:   22 DPAHWAVADVVNYFKATGFEEQANAFQDQEIDGKSLLLMTRNDVLTGLSIKLGPALKIYEYHVKPLQ 88          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Zebrafish
Match: samd13 (sterile alpha motif domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-060929-676])

HSP 1 Score: 72.7886 bits (177), Expect = 3.907e-15
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query: 2419 DVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            D   W+  DV ++    GF  Q+N F++QEIDG SLLLM R DVLT L++KLGPA+KIYE  +K +Q
Sbjct:   22 DPAHWAVADVVNYFKATGFEEQANAFQDQEIDGKSLLLMTRNDVLTGLSIKLGPALKIYEYHVKPLQ 88          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Zebrafish
Match: kat6b (K(lysine) acetyltransferase 6B [Source:ZFIN;Acc:ZDB-GENE-000607-52])

HSP 1 Score: 78.1814 bits (191), Expect = 2.236e-14
Identity = 46/119 (38.66%), Postives = 60/119 (50.42%), Query Frame = 1
Query: 1903 IELCSEC---KSPQTDY--EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNCY---KEGFRI 2226
            I +CS C   K    D   E+ L C DC    HPSCL +  +LT   +   WQC  CKTC  C+ +  N + +  CD CD+GFH  C +P    P+SR     WIC  C    +EG R+
Sbjct:  213 IPICSFCLGTKESNRDKRPEELLSCADCGSSGHPSCLKFSADLTANVKALRWQCIECKTCSSCQIQGKNADEMLFCDSCDRGFHMECCDP----PLSRMPKGMWICQVCRPKEQEGKRL 327          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Xenopus
Match: samd13 (sterile alpha motif domain containing 13 [Source:NCBI gene;Acc:100135078])

HSP 1 Score: 83.5741 bits (205), Expect = 1.302e-18
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query: 2410 RPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            RP D   W+ DDV ++    GF  Q++ F+EQEIDG SLLLM R DVLT L+LKLGPA+KIYE  +K +Q
Sbjct:   36 RPPDPAHWAVDDVVNYFKTAGFEEQASAFKEQEIDGKSLLLMTRNDVLTGLSLKLGPALKIYEYHVKPLQ 105          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Xenopus
Match: samd13 (sterile alpha motif domain containing 13 [Source:NCBI gene;Acc:100135078])

HSP 1 Score: 82.8037 bits (203), Expect = 2.799e-18
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query: 2410 RPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            RP D   W+ DDV ++    GF  Q++ F+EQEIDG SLLLM R DVLT L+LKLGPA+KIYE  +K +Q
Sbjct:   38 RPPDPAHWAVDDVVNYFKTAGFEEQASAFKEQEIDGKSLLLMTRNDVLTGLSLKLGPALKIYEYHVKPLQ 107          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Xenopus
Match: samd13 (sterile alpha motif domain containing 13 [Source:NCBI gene;Acc:100135078])

HSP 1 Score: 82.0333 bits (201), Expect = 4.052e-18
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query: 2410 RPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            RP D   W+ DDV ++    GF  Q++ F+EQEIDG SLLLM R DVLT L+LKLGPA+KIYE  +K +Q
Sbjct:   26 RPPDPAHWAVDDVVNYFKTAGFEEQASAFKEQEIDGKSLLLMTRNDVLTGLSLKLGPALKIYEYHVKPLQ 95          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Xenopus
Match: phf10 (PHD finger protein 10 [Source:NCBI gene;Acc:595031])

HSP 1 Score: 75.0998 bits (183), Expect = 1.773e-13
Identity = 32/87 (36.78%), Postives = 44/87 (50.57%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNC 2205
            E+ + C  C+   HPSCL   PEL    ++ PWQC  CKTC +C      E +  CD CD+G+H+ C    +      +  WIC  C
Sbjct:  338 ERLIHCSQCDNSGHPSCLDMSPELVTVIKKYPWQCMECKTCIICGQPHHEEEMMFCDTCDRGYHTFC----VGLGALPSGRWICDCC 420          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Xenopus
Match: phf10 (PHD finger protein 10 [Source:NCBI gene;Acc:595031])

HSP 1 Score: 75.0998 bits (183), Expect = 1.818e-13
Identity = 32/87 (36.78%), Postives = 44/87 (50.57%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNC 2205
            E+ + C  C+   HPSCL   PEL    ++ PWQC  CKTC +C      E +  CD CD+G+H+ C    +      +  WIC  C
Sbjct:  349 ERLIHCSQCDNSGHPSCLDMSPELVTVIKKYPWQCMECKTCIICGQPHHEEEMMFCDTCDRGYHTFC----VGLGALPSGRWICDCC 431          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Mouse
Match: Kat6a (K(lysine) acetyltransferase 6A [Source:MGI Symbol;Acc:MGI:2442415])

HSP 1 Score: 89.7373 bits (221), Expect = 1.188e-17
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          

HSP 2 Score: 51.2174 bits (121), Expect = 7.393e-6
Identity = 40/158 (25.32%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRK----NSANGGGIMNPPSIT-NRILE-SFRHMDKTRSTDSQNPHKVGYSINEIEQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMR 1113
            Y EWILEAI K++++K RP  ERI   +   H +     +  L      G ++ V  KG  SY++P    +       N G +    S+  N++L+ +F  + +T  +  ++  +   S  ++  A   +   G  +    QLR  ++R   +G+L++
Sbjct:    9 YTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRRTVLEQLELSVKDGTILKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDTKQSVDWNKLLKRAFEGLAETGGSTLKSIERFLKSQKDVSAACGGSAAPGFHQ----QLRLAIKRAVGHGRLLK 162          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Mouse
Match: Kat6a (K(lysine) acetyltransferase 6A [Source:MGI Symbol;Acc:MGI:2442415])

HSP 1 Score: 89.7373 bits (221), Expect = 1.188e-17
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          

HSP 2 Score: 51.2174 bits (121), Expect = 7.393e-6
Identity = 40/158 (25.32%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRK----NSANGGGIMNPPSIT-NRILE-SFRHMDKTRSTDSQNPHKVGYSINEIEQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMR 1113
            Y EWILEAI K++++K RP  ERI   +   H +     +  L      G ++ V  KG  SY++P    +       N G +    S+  N++L+ +F  + +T  +  ++  +   S  ++  A   +   G  +    QLR  ++R   +G+L++
Sbjct:    9 YTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRRTVLEQLELSVKDGTILKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDTKQSVDWNKLLKRAFEGLAETGGSTLKSIERFLKSQKDVSAACGGSAAPGFHQ----QLRLAIKRAVGHGRLLK 162          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Mouse
Match: Kat6a (K(lysine) acetyltransferase 6A [Source:MGI Symbol;Acc:MGI:2442415])

HSP 1 Score: 89.7373 bits (221), Expect = 1.529e-17
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          

HSP 2 Score: 51.2174 bits (121), Expect = 8.632e-6
Identity = 40/158 (25.32%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRK----NSANGGGIMNPPSIT-NRILE-SFRHMDKTRSTDSQNPHKVGYSINEIEQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMR 1113
            Y EWILEAI K++++K RP  ERI   +   H +     +  L      G ++ V  KG  SY++P    +       N G +    S+  N++L+ +F  + +T  +  ++  +   S  ++  A   +   G  +    QLR  ++R   +G+L++
Sbjct:    9 YTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRRTVLEQLELSVKDGTILKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDTKQSVDWNKLLKRAFEGLAETGGSTLKSIERFLKSQKDVSAACGGSAAPGFHQ----QLRLAIKRAVGHGRLLK 162          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Mouse
Match: Samd13 (sterile alpha motif domain containing 13 [Source:MGI Symbol;Acc:MGI:2686498])

HSP 1 Score: 76.6406 bits (187), Expect = 1.432e-16
Identity = 40/79 (50.63%), Postives = 50/79 (63.29%), Query Frame = 1
Query: 2410 RPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE------KIKKIQNDGS 2628
            RP D   W+  DV ++    GF  Q+  F+EQEIDG SLLLM R DVLT L LKLGPA+KIYE      + K ++N+ S
Sbjct:    5 RPPDPADWAVTDVVNYFRTAGFEEQACAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS 83          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Mouse
Match: Samd13 (sterile alpha motif domain containing 13 [Source:MGI Symbol;Acc:MGI:2686498])

HSP 1 Score: 77.0258 bits (188), Expect = 1.625e-16
Identity = 40/79 (50.63%), Postives = 50/79 (63.29%), Query Frame = 1
Query: 2410 RPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE------KIKKIQNDGS 2628
            RP D   W+  DV ++    GF  Q+  F+EQEIDG SLLLM R DVLT L LKLGPA+KIYE      + K ++N+ S
Sbjct:   24 RPPDPADWAVTDVVNYFRTAGFEEQACAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS 102          
BLAST of Histone acetyltransferase KAT6A vs. UniProt/SwissProt
Match: sp|Q5TKR9|KAT6A_RAT (Histone acetyltransferase KAT6A OS=Rattus norvegicus OX=10116 GN=Kat6a PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 3.836e-17
Identity = 45/113 (39.82%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E  + C DC    HPSCL + PELT R R   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKKPEDLISCADCGNSGHPSCLKFSPELTVRVRALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          

HSP 2 Score: 54.6842 bits (130), Expect = 5.135e-6
Identity = 41/158 (25.95%), Postives = 77/158 (48.73%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRK----NSANGGGIMNPPSIT-NRILE-SFRHMDKTRSTDSQNPHKVGYSINEIEQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMR 1113
            Y +WILEAI K++++K RP  ERI   +   H +  +  +  L      G ++ V  KG  SY++P    +       N G + N  S+  N++L+ +F  + ++  +  ++  +   S  ++  A   T  SG  +    QLR  ++R   +G+L++
Sbjct:    9 YTQWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTILKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQSVDWNKLLKRAFEGLAESGGSTLKSIERFLKSQKDVSAACGGTAASGFHQ----QLRLAIKRAVGHGRLLK 162          
BLAST of Histone acetyltransferase KAT6A vs. UniProt/SwissProt
Match: sp|Q92794|KAT6A_HUMAN (Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 4.067e-16
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          
BLAST of Histone acetyltransferase KAT6A vs. UniProt/SwissProt
Match: sp|Q8BZ21|KAT6A_MOUSE (Histone acetyltransferase KAT6A OS=Mus musculus OX=10090 GN=Kat6a PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 5.245e-16
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1891 VGAVIELCSEC-----KSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C     ++ +   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  202 VAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 310          
BLAST of Histone acetyltransferase KAT6A vs. UniProt/SwissProt
Match: sp|Q5VXD3|SAM13_HUMAN (Sterile alpha motif domain-containing protein 13 OS=Homo sapiens OX=9606 GN=SAMD13 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.195e-16
Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 1
Query: 2410 RPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            RP D   W+  DV ++    GF  Q++ F+EQEIDG SLLLM R DVLT L LKLGPA+KIYE  +K +Q
Sbjct:   44 RPPDPADWAVMDVVNYFRTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQ 113          
BLAST of Histone acetyltransferase KAT6A vs. UniProt/SwissProt
Match: sp|D3YUG0|SAM13_MOUSE (Sterile alpha motif domain-containing protein 13 OS=Mus musculus OX=10090 GN=Samd13 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.137e-15
Identity = 40/79 (50.63%), Postives = 50/79 (63.29%), Query Frame = 1
Query: 2410 RPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE------KIKKIQNDGS 2628
            RP D   W+  DV ++    GF  Q+  F+EQEIDG SLLLM R DVLT L LKLGPA+KIYE      + K ++N+ S
Sbjct:   24 RPPDPADWAVTDVVNYFRTAGFEEQACAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS 102          
BLAST of Histone acetyltransferase KAT6A vs. TrEMBL
Match: A0A267DJ50 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031630g2 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.051e-48
Identity = 99/225 (44.00%), Postives = 119/225 (52.89%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENXXXXXXXXXXXXXXXNVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQN 2619
            E+ L C+DC+ + HPSC+ Y  EL  RARQSPWQCS CKTCCVC D    E + ICD CDKG+H +CH PKI E  +  A WICS C K    I  + SM                                            +RK   F     P D +KW+   V  WL  EGF L +  F +QEIDG SL+LMKRMDVL  L LKLGPAVK++E+I K+QN
Sbjct:  562 EQLLTCRDCSHRAHPSCMLYSVELASRARQSPWQCSECKTCCVCLDPGDAELMLICDACDKGYHVSCHRPKIPEKPASEAKWICSACQK----IEDDGSM--------------------------------------------NRKSPVFLDDPNPFDASKWTIAQVKSWLLSEGFPLAAQAFVDQEIDGASLMLMKRMDVLAGLGLKLGPAVKVFERINKLQN 738          

HSP 2 Score: 104.375 bits (259), Expect = 4.144e-19
Identity = 59/172 (34.30%), Postives = 95/172 (55.23%), Query Frame = 1
Query:  661 REWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYSINEIEQAI--IATQTS-------GSIELSKTQLRHCLEREAAYGKLMRRADCTYVIDENG 1149
            R  IL  IDKLRERKARPD +RI +++ R+H +  E  V  L +L D G+V+ V+YKG++SYRN  KWR+ S     ++N  + + R+L +   +    ++D  +    G+++ ++   +  + + TS       G+  L    L   LEREA+ G L R +   Y +D +G
Sbjct:  139 RTMILTIIDKLRERKARPDIDRICSMVTRHHGLQREAIVQLLERLVDDGSVLKVEYKGSVSYRNASKWRRGSLI-SSVLNSSATSRRLLAAVGSL----ASDQPDALASGFTVQDVADRLRCLPSATSEEEDSAPGAEPLQGETLEMALEREASTGGLCRVSTGRYTLDPDG 305          
BLAST of Histone acetyltransferase KAT6A vs. TrEMBL
Match: A0A267EAI3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027627g1 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.135e-48
Identity = 99/225 (44.00%), Postives = 119/225 (52.89%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENXXXXXXXXXXXXXXXNVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQN 2619
            E+ L C+DC+ + HPSC+ Y  EL  RARQSPWQCS CKTCCVC D    E + ICD CDKG+H +CH PKI E  +  A WICS C K    I  + S+                                            SRK   F     P D +KW+   V  WL  EGF L +  F +QEIDG SL+LMKRMDVL  L LKLGPAVK++E+I K+QN
Sbjct:  574 EQLLTCRDCSHRAHPSCMLYSVELASRARQSPWQCSECKTCCVCLDPGDAELMLICDACDKGYHVSCHRPKIPEKPASEAKWICSACQK----IEDDGSVN-------------------------------------------SRKSPVFLDDPNPFDASKWTIAQVKSWLLSEGFPLAAQAFVDQEIDGASLMLMKRMDVLAGLGLKLGPAVKVFERINKLQN 751          

HSP 2 Score: 103.99 bits (258), Expect = 5.844e-19
Identity = 59/172 (34.30%), Postives = 95/172 (55.23%), Query Frame = 1
Query:  661 REWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYSINEIEQAI--IATQTS-------GSIELSKTQLRHCLEREAAYGKLMRRADCTYVIDENG 1149
            R  IL  IDKLRERKARPD +RI +++ R+H +  E  V  L +L D G+V+ V+YKG++SYRN  KWR+ S     ++N  + + R+L +   +    ++D  +    G+++ ++   +  + + TS       G+  L    L   LEREA+ G L R +   Y +D +G
Sbjct:  142 RTMILTIIDKLRERKARPDIDRICSMVTRHHGLQREAIVQLLERLVDDGSVLKVEYKGSVSYRNASKWRRGSLI-SSVLNSSATSRRLLAAVGSL----ASDQPDVLASGFTVQDVADRLRCLPSATSEEEDSAPGAEPLQGETLEMALEREASTGGLCRVSTGRYTLDPDG 308          
BLAST of Histone acetyltransferase KAT6A vs. TrEMBL
Match: A0A267DCC5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031630g3 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.729e-48
Identity = 99/225 (44.00%), Postives = 119/225 (52.89%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENXXXXXXXXXXXXXXXNVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQN 2619
            E+ L C+DC+ + HPSC+ Y  EL  RARQSPWQCS CKTCCVC D    E + ICD CDKG+H +CH PKI E  +  A WICS C K    I  + S+                                            SRK   F     P D +KW+   V  WL  EGF L +  F +QEIDG SL+LMKRMDVL  L LKLGPAVK++E+I K+QN
Sbjct:  563 EQLLTCRDCSHRAHPSCMLYSVELASRARQSPWQCSECKTCCVCLDPGDAELMLICDACDKGYHVSCHRPKIPEKPASEAKWICSACQK----IEDDGSVN-------------------------------------------SRKSPVFLDDPNPFDASKWTIAQVKSWLLFEGFPLAAQAFVDQEIDGASLMLMKRMDVLAGLGLKLGPAVKVFERINKLQN 740          

HSP 2 Score: 103.99 bits (258), Expect = 5.581e-19
Identity = 59/172 (34.30%), Postives = 95/172 (55.23%), Query Frame = 1
Query:  661 REWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYSINEIEQAI--IATQTS-------GSIELSKTQLRHCLEREAAYGKLMRRADCTYVIDENG 1149
            R  IL  IDKLRERKARPD +RI +++ R+H +  E  V  L +L D G+V+ V+YKG++SYRN  KWR+ S     ++N  + + R+L +   +    ++D  +    G+++ ++   +  + + TS       G+  L    L   LEREA+ G L R +   Y +D +G
Sbjct:  142 RTMILTIIDKLRERKARPDIDRICSMVTRHHGLQREAIVQLLERLVDDGSVLKVEYKGSVSYRNASKWRRGSLI-SSVLNSSATSRRLLAAVGSL----ASDQPDVLASGFTVQDVADRLRCLPSATSEEEDSAPGAEPLQGETLEMALEREASTGGLCRVSTGRYTLDPDG 308          
BLAST of Histone acetyltransferase KAT6A vs. TrEMBL
Match: A0A1I8I8E0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.807e-46
Identity = 98/243 (40.33%), Postives = 124/243 (51.03%), Query Frame = 1
Query: 1906 ELCSECKSPQTDY-----EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENXXXXXXXXXXXXXXXNVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQN 2619
            +LC  C+SP +       E+ L C+DC  K HPSC+ Y PEL  RA QSPWQCS CKTCCVC      E + ICD CDKG+H +CH P++ E  + +A W+CS C       R EE +  S     +   + S  +L                                       D + WS   V  WL  EGF L +    EQEIDG SL+LMKRMDVLT L LKLGPAVK+++KI ++Q 
Sbjct:   61 DLCDFCQSPPSANRMGVPERMLRCRDCAHKAHPSCMLYGPELAARACQSPWQCSECKTCCVCSGSGDPELILICDACDKGYHVSCHRPRVTERPASDAKWVCSRC-------REEERVDGSGQ---QPPPQESQAQLAG-------------------------------------DASLWSIAQVRSWLDGEGFPLAAQACVEQEIDGASLMLMKRMDVLTGLGLKLGPAVKVFDKISRLQG 256          
BLAST of Histone acetyltransferase KAT6A vs. TrEMBL
Match: A0A267ET35 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000786g1 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 7.433e-46
Identity = 98/243 (40.33%), Postives = 124/243 (51.03%), Query Frame = 1
Query: 1906 ELCSECKSPQTDY-----EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENXXXXXXXXXXXXXXXNVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQN 2619
            +LC  C+SP +       E+ L C+DC  K HPSC+ Y PEL  RA QSPWQCS CKTCCVC      E + ICD CDKG+H +CH P++ E  + +A W+CS C       R EE +  S     +   + S  +L                                       D + WS   V  WL  EGF L +    EQEIDG SL+LMKRMDVLT L LKLGPAVK+++KI ++Q 
Sbjct:  278 DLCDFCQSPPSANRMGVPERMLRCRDCAHKAHPSCMLYGPELAARACQSPWQCSECKTCCVCSGSGDPELILICDACDKGYHVSCHRPRVTERPASDAKWVCSRC-------REEERVDGSGQ---QPPPQESQAQLAG-------------------------------------DASLWSIAQVRSWLDGEGFPLAAQACVEQEIDGASLMLMKRMDVLTGLGLKLGPAVKVFDKISRLQG 473          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Cavefish
Match: ENSAMXT00000015644.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000039.1:1252603:1294619:1 gene:ENSAMXG00000015159.2 transcript:ENSAMXT00000015644.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 4.932e-17
Identity = 50/127 (39.37%), Postives = 68/127 (53.54%), Query Frame = 1
Query: 1891 VGAVIELCSEC---KSPQTDY--EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC--YKEGFRIRSEES 2241
            V   I +CS C   K    D   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N E++  CD CD+GFH  C +P    P++R     WIC  C   K+G ++  E++
Sbjct:  197 VAEPIPICSFCLGTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTVRVKALWWQCIECKTCSSCQDQGKNAENMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQICRPRKKGKKLLQEKA 319          

HSP 2 Score: 52.373 bits (124), Expect = 2.104e-6
Identity = 48/167 (28.74%), Postives = 74/167 (44.31%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYR---NPYKWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYS-INEIE-----QAIIATQTSGSIELS----KTQLRHCLEREAAYGKLMRRA 1119
            Y  WILEAI K++++K RP  ERI   +   H +  +  +  L      G+++ V  KG  SY+   NP +       GGG ++   +  R L+                H+ G S I  IE     QA +A   SGS  +       QLR  L+R  A+G++ ++ 
Sbjct:    9 YTTWILEAIKKVKKQKQRPSEERICNAVNMSHGLDRKTVLEHLELSVKDGSILKVSNKGLNSYKDPDNPGRLALPKPRGGG-LDWNKLIKRALDGL--------------HEAGGSTIKSIERFLKCQADVAGYLSGSGSMGPGIFHQQLRLALKRAVAHGRVAKQG 160          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Cavefish
Match: samd13 (sterile alpha motif domain containing 13 [Source:NCBI gene;Acc:103030059])

HSP 1 Score: 73.559 bits (179), Expect = 1.675e-15
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query: 2419 DVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            D   W+  DV ++    GF  Q+N F++QEIDG SLLLM R DVLT L++KLGPA+KIYE  +K +Q
Sbjct:   22 DPAHWAVADVVNYFKATGFEEQANAFQDQEIDGKSLLLMTRNDVLTGLSIKLGPALKIYEYHVKPLQ 88          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Cavefish
Match: ENSAMXT00000045561.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001677.1:227870:233764:-1 gene:ENSAMXG00000037217.1 transcript:ENSAMXT00000045561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 4.876e-15
Identity = 41/86 (47.67%), Postives = 55/86 (63.95%), Query Frame = 1
Query: 2392 TFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKI------QNDGSI 2631
            T S  + P D   W+  DV ++ T  GF  Q+  FR QEIDG SLLLM+R DVLT L+++LGPA+KIYE+  K+      Q+DG+ 
Sbjct:  190 TESSVVNPVD---WTVSDVANYFTAVGFPEQALAFRTQEIDGKSLLLMQRNDVLTGLSIRLGPALKIYERHVKVLQRTHFQDDGAF 272          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Cavefish
Match: ENSAMXT00000029811.1 (atherin-like [Source:NCBI gene;Acc:103043625])

HSP 1 Score: 78.5666 bits (192), Expect = 7.366e-15
Identity = 36/72 (50.00%), Postives = 48/72 (66.67%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKN 873
            YREWIL+ ID LR RKARPD ERI  +++R H    + T + L KL    AV+ V+YKG++SYRN  K ++ 
Sbjct:    6 YREWILDTIDSLRSRKARPDLERICRMVRRRHGSEADRTCVELEKLIQEHAVLKVNYKGSVSYRNAAKVQRG 77          

HSP 2 Score: 75.8702 bits (185), Expect = 5.195e-14
Identity = 37/73 (50.68%), Postives = 50/73 (68.49%), Query Frame = 1
Query: 2407 IRPEDVTK----WSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKI 2613
            ++ E++T+    WS  DV  + T  GF  Q+  FR QEIDG SLLLM+R DVLT L+++LGPA+KIYE   K+
Sbjct:  310 VKSEEITQDPLLWSVSDVVSYFTAVGFPEQAVAFRTQEIDGKSLLLMQRSDVLTGLSIRLGPALKIYEHHVKV 382          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Cavefish
Match: kat6b (lysine acetyltransferase 6B [Source:NCBI gene;Acc:103034382])

HSP 1 Score: 77.7962 bits (190), Expect = 5.135e-14
Identity = 37/90 (41.11%), Postives = 48/90 (53.33%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            E+ L C DC    HPSCL +  +LT   +   WQC  CKTC  C+ +  N + +  CD CD+GFH  C +P    P+SR     WIC  C
Sbjct:  232 EELLSCADCGSSGHPSCLKFSADLTANVKALRWQCIECKTCSSCQIQGKNADEMLFCDSCDRGFHMECCDP----PLSRMPKGMWICQVC 317          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Sea Lamprey
Match: samd13 (sterile alpha motif domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-060929-676])

HSP 1 Score: 73.559 bits (179), Expect = 2.206e-16
Identity = 36/64 (56.25%), Postives = 46/64 (71.88%), Query Frame = 1
Query: 2431 WSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQN 2619
            WS  DV  +    GF  ++  F+EQEIDG SLLLMKR DVLT L++KLGPA+KIYE  +K +Q+
Sbjct:    5 WSIADVVSYFRTAGFDEEARAFQEQEIDGKSLLLMKRSDVLTGLSIKLGPALKIYEFHVKALQS 68          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Sea Lamprey
Match: dpf2 (D4, zinc and double PHD fingers family 2 [Source:ZFIN;Acc:ZDB-GENE-041024-2])

HSP 1 Score: 68.5514 bits (166), Expect = 2.687e-12
Identity = 29/87 (33.33%), Postives = 43/87 (49.43%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNC 2205
            E+ + C DC    HPSCL +   +    +   WQC  CK C +C    +++ +  CD CD+G+H  C  P + EP     +W C  C
Sbjct:  306 EELVSCSDCGRSGHPSCLQFTSNMIAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLSPAMSEPP--EGSWSCRLC 390          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002602.1 (pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 gene:ENSPMAG00000002341.1 transcript:ENSPMAT00000002602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.383e-10
Identity = 36/98 (36.73%), Postives = 44/98 (44.90%), Query Frame = 1
Query: 1912 CSECKSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNC 2205
            C  C  P  +    LFC  C    H  CL   P    RA    WQC  CKT   C     +  + +CD CDKGFH+ C  P +Q  I +N  W C +C
Sbjct:  214 CVVCDQP-GELHNQLFCTSCGQHYHGRCLEIAPSTAIRAG---WQCPECKTNKKCMQPGDDSKMLVCDACDKGFHTYCLRPAMQS-IPKN-TWKCKHC 305          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Sea Lamprey
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-100922-38])

HSP 1 Score: 54.299 bits (129), Expect = 1.124e-7
Identity = 26/70 (37.14%), Postives = 43/70 (61.43%), Query Frame = 1
Query: 2422 VTKWSTDDVCDWLTE-EGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQNDGS 2628
            V+KW  D+V  +++   G   Q+  F+ ++IDG + LL+ + D++  + +KLGPA+KIY  I   QN  S
Sbjct:  683 VSKWGVDEVAKFISALPGCDEQAKFFQNEQIDGPAFLLLTQCDLVKIMAIKLGPALKIYNSILMFQNADS 752          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003495.1 (pep scaffold:Pmarinus_7.0:GL478114:2294:5331:1 gene:ENSPMAG00000003192.1 transcript:ENSPMAT00000003495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.947e-6
Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = 1
Query: 2416 EDVTKWSTDDVCDWLTE-EGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEK 2601
            ED+  WS D+VC ++    G    +  FR   IDG +L L+    +L+ L L+LGPA+KI  +
Sbjct:  324 EDMRAWSVDNVCTFVAALSGCAESAQAFRHHAIDGETLPLLTETHLLSTLGLRLGPALKILAQ 386          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Nematostella
Match: EDO39741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S985])

HSP 1 Score: 93.5893 bits (231), Expect = 4.521e-21
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query: 1909 LCSECKSP-----QTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQE 2166
            LC  C  P     + DYE+ + C DC    HPSCL Y P LT R +  PWQC  CKTC VC+D    +++  CD CD+GFH  C +P + E
Sbjct:  178 LCGFCLGPAESNKEGDYEELISCADCGNSGHPSCLKYSPALTARVQSEPWQCIECKTCSVCRDAGDADNLLFCDMCDRGFHMECLDPPMSE 268          

HSP 2 Score: 48.1358 bits (113), Expect = 8.425e-6
Identity = 24/76 (31.58%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYK---WRKNS 876
            Y  WIL+AI+K++ +K RP  +RI  +++  + +  +     L++  ++G V+ V +KG  SY++P +   W+K S
Sbjct:    1 YLLWILQAINKVKGQKQRPSEDRIIHVLETGYGLSRDIISEQLDRCVEAGKVLKVTFKGKNSYKDPSRMPGWKKPS 76          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Nematostella
Match: EDO43906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX57])

HSP 1 Score: 78.9518 bits (193), Expect = 7.593e-18
Identity = 37/66 (56.06%), Postives = 46/66 (69.70%), Query Frame = 1
Query: 2419 DVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQ 2616
            D +KW   DV  +L   GF  +S  F+EQEIDG +LLLM R DVLT L+LKLGPA+KIY  + K+Q
Sbjct:   19 DASKWEVADVIKFLETAGFTEESKNFKEQEIDGSALLLMSRNDVLTGLSLKLGPALKIYSHVSKLQ 84          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Nematostella
Match: EDO43904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX55])

HSP 1 Score: 78.5666 bits (192), Expect = 8.996e-18
Identity = 37/66 (56.06%), Postives = 46/66 (69.70%), Query Frame = 1
Query: 2419 DVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQ 2616
            D +KW   DV  +L   GF  +S  F+EQEIDG +LLLM R DVLT L+LKLGPA+KIY  + K+Q
Sbjct:   14 DASKWEVADVIKFLETAGFTEESKNFKEQEIDGSALLLMSRNDVLTGLSLKLGPALKIYSHVSKLQ 79          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Nematostella
Match: EDO41238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z1])

HSP 1 Score: 77.7962 bits (190), Expect = 2.037e-15
Identity = 33/87 (37.93%), Postives = 49/87 (56.32%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNC 2205
            E+ L C DC    HPSCL + P+LT   ++  WQC  CK+C +C    +++ +  CD CD+G+H  C  P + +P      W+CS C
Sbjct:  209 EELLSCSDCGRSGHPSCLQFTPKLTYNVKKYRWQCIECKSCTLCGTSDNDDQLLFCDDCDRGYHMYCLNPPMDKPP--EGHWMCSLC 293          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Nematostella
Match: EDO31764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX13])

HSP 1 Score: 65.4698 bits (158), Expect = 2.975e-13
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 1
Query: 1969 CNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNC 2205
            C +  HPSCL     + +  +  PWQC+ CKTC +C        + +CD CD+G+H +C +PK+ +  +   AW C  C
Sbjct:    2 CCLVGHPSCLDLGDNVADIIKHYPWQCNDCKTCHLCDTGEVQNELLLCDNCDRGYHMSCLDPKLTK--APKGAWHCVLC 78          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Medaka
Match: kat6b (lysine acetyltransferase 6B [Source:NCBI gene;Acc:101170471])

HSP 1 Score: 86.6557 bits (213), Expect = 9.518e-17
Identity = 45/109 (41.28%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 1903 IELCSEC---KSPQTD--YEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            I +CS C   K    D   E+ L C DC    HPSCL + P+LT   ++  WQC  CKTC  C+ +  N E +  CD CD+GFH  C +P    P+SR     WIC  C
Sbjct:  212 IPICSFCLGTKESNRDKRAEELLSCADCGSSGHPSCLKFSPDLTSNVKKLRWQCIECKTCSSCRIQGKNAEEMLFCDSCDRGFHMECCDP----PLSRMPKGTWICQVC 316          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Medaka
Match: kat6b (lysine acetyltransferase 6B [Source:NCBI gene;Acc:101170471])

HSP 1 Score: 85.8853 bits (211), Expect = 1.396e-16
Identity = 45/109 (41.28%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 1903 IELCSEC---KSPQTD--YEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            I +CS C   K    D   E+ L C DC    HPSCL + P+LT   ++  WQC  CKTC  C+ +  N E +  CD CD+GFH  C +P    P+SR     WIC  C
Sbjct:  212 IPICSFCLGTKESNRDKRAEELLSCADCGSSGHPSCLKFSPDLTSNVKKLRWQCIECKTCSSCRIQGKNAEEMLFCDSCDRGFHMECCDP----PLSRMPKGTWICQVC 316          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Medaka
Match: kat6a (lysine acetyltransferase 6A [Source:NCBI gene;Acc:101165316])

HSP 1 Score: 85.8853 bits (211), Expect = 1.701e-16
Identity = 46/113 (40.71%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 1891 VGAVIELCSEC---KSPQTDY--EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSN-ESVYICDGCDKGFHSACHEPKIQEPISR--NAAWICSNC 2205
            V   I +CS C   K    D   E+ + C DC    HPSCL + PELT R +   WQC  CKTC  C+D+  N +++  CD CD+GFH  C +P    P++R     WIC  C
Sbjct:  240 VAEPIPICSFCLGTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTARVKALWWQCIECKTCSSCQDQGKNADNMLFCDSCDRGFHMECCDP----PLTRMPKGMWICQIC 348          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Medaka
Match: samd13 (sterile alpha motif domain containing 13 [Source:NCBI gene;Acc:101159905])

HSP 1 Score: 70.8626 bits (172), Expect = 1.881e-14
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query: 2419 DVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYE-KIKKIQ 2616
            D + W   DV ++    GF  Q+  F++QEIDG SLLLM R DVLT L++KLGPA+KIYE  +K +Q
Sbjct:   33 DPSNWGVADVVNYFKATGFEEQAVAFQDQEIDGKSLLLMTRNDVLTGLSIKLGPALKIYEYHVKPLQ 99          
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Medaka
Match: ENSORLT00000008811.2 (atherin [Source:NCBI gene;Acc:101167122])

HSP 1 Score: 76.2554 bits (186), Expect = 3.823e-14
Identity = 33/66 (50.00%), Postives = 48/66 (72.73%), Query Frame = 1
Query: 2416 EDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKI 2613
            +++ +W+  DV  + +  GF  Q+  FR QEIDG SLLLM+R DVLT L+++LGPA+KIYE+  K+
Sbjct:  336 QNLLQWTVADVASYFSAAGFPEQAVAFRTQEIDGKSLLLMQRSDVLTGLSIRLGPALKIYERHVKV 401          

HSP 2 Score: 76.2554 bits (186), Expect = 3.997e-14
Identity = 37/73 (50.68%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  658 YREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKNS 876
            YREWIL+ ID LR RKARPD ERI  +++R H    + T   L KL     V+ V+YKG+ISYRN  K ++ S
Sbjct:    6 YREWILDTIDSLRSRKARPDLERICRMVRRRHGSEPDRTCAELEKLIQEQTVLKVNYKGSISYRNAAKVQRRS 78          
BLAST of Histone acetyltransferase KAT6A vs. Planmine SMEST
Match: SMESG000038926.1 (SMESG000038926.1)

HSP 1 Score: 1449.11 bits (3750), Expect = 0.000e+0
Identity = 846/848 (99.76%), Postives = 846/848 (99.76%), Query Frame = 1
Query:  109 MSKPINSLPIQKNCHVXXXXXXXXXXXXXXXXIQNAPLQIQPKPVVTFLQTTNQSRIISSQPAFAIQPNNQYLANIQPNFSHNNATRPQAYNIPPANSFTFTLAPIAAKPMDXXXXXXXXXXXXXXXXXXXXXXXXXXXHVTGLPSNFQPIQMRPSNSNTSKQPPVTMPQXXXXXXXXXXGGYYREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYSINEIEQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMRRADCTYVIDENGEXXXXXXXXXXXXXXXFSHKPAPNKXXXXXXXXXXXXXXXQMLTNIQNPIVSNNSFTTFSLQQIPSYNPQFLSQNDRQIVPMLTSNNPFASISLASVSQPSPILPKQTPPHVAFVKCEASLAPEINSIPQLPIVVTKTTHNNFTAENEMKEAQXXXXXXXXXXXXXXXXXXXXXXXGNTASVELKVTTKTSRRGRPPGSKNKRYQESEITSTNKKQKIDVENHATXXXXXXXXXXXXXXXXDQTVPAVGAVIELCSECKSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENXXXXXXXXXXXXXXXNVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQNDGSIWKYDDCF 2652
            MSKPINSLPIQKNCHVSNNSSNSITTTMCSTSIQNAPLQIQPKPVVTFLQTTNQSRIISSQPAFAIQPNNQYLANIQPNFSHNNATRPQAYNIPPANSFTFTLAPIAAKPMDNSNNTVNNNNNVNNINNSNNNNINNNNHVTGLPSNFQPIQMRPSNSNTSKQPPVTMPQSSANISSAAAGGYYREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYSINEIEQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMRRADCTYVIDENGEKKIRKAAAIQAKKTAFSHKPAPNKTIAAAPHPITIATTTQMLTNIQNPIVSNNSFTTFSLQQIPSYNPQFLSQNDRQIVPMLTSNNPFASISLASVSQPSPILPKQTPPHVAFVKCEASLAPEINSIPQLPIVVTKTTHNNFTAENEMKEAQISSNISSTTMPSISSAIISTPTMGNTASVELKVTTKTSRRGRPPGSKNKRYQESEITSTNKKQKIDVENHATNVSAPSSCSALSVSNSDQTVPAVGAVIELCSECKSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENKT IEKISI EIKKENVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQNDGSIWKYDDCF
Sbjct:    1 MSKPINSLPIQKNCHVSNNSSNSITTTMCSTSIQNAPLQIQPKPVVTFLQTTNQSRIISSQPAFAIQPNNQYLANIQPNFSHNNATRPQAYNIPPANSFTFTLAPIAAKPMDNSNNTVNNNNNVNNINNSNNNNINNNNHVTGLPSNFQPIQMRPSNSNTSKQPPVTMPQSSANISSAAAGGYYREWILEAIDKLRERKARPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPYKWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYSINEIEQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMRRADCTYVIDENGEKKIRKAAAIQAKKTAFSHKPAPNKTIAAAPHPITIATTTQMLTNIQNPIVSNNSFTTFSLQQIPSYNPQFLSQNDRQIVPMLTSNNPFASISLASVSQPSPILPKQTPPHVAFVKCEASLAPEINSIPQLPIVVTKTTHNNFTAENEMKEAQISSNISSTTMPSISSAIISTPTMGNTASVELKVTTKTSRRGRPPGSKNKRYQESEITSTNKKQKIDVENHATNVSAPSSCSALSVSNSDQTVPAVGAVIELCSECKSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSSDSITKTYKENSSDKLENKTAIEKISIIEIKKENVLVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQEIDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQNDGSIWKYDDCF 848          
BLAST of Histone acetyltransferase KAT6A vs. Planmine SMEST
Match: SMESG000031948.1 (SMESG000031948.1)

HSP 1 Score: 72.4034 bits (176), Expect = 5.380e-13
Identity = 33/104 (31.73%), Postives = 55/104 (52.88%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSACKTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFRIRSEESMKNSS 2256
            E+ + C DC+   HPSCL++   +     +  WQC  CK C +C    +++ +  CD CD+G+H  C +P + +P + N  W C  C    FR ++  +  +SS
Sbjct:  319 EQMIKCSDCDRSAHPSCLNFSENMRFSVTRYRWQCLECKMCSMCGTAENDDEMLFCDDCDRGYHMYCLQPPLSQPPAGN--WSCDLCINT-FREKAASARLDSS 419          
BLAST of Histone acetyltransferase KAT6A vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.610e-11
Identity = 35/95 (36.84%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPE-LTERARQSPWQCSACKTCCVCKDRS-SNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFR 2223
            E  + C DC    HP+CL  WP+ L ++ R   WQC  CK C  C   S  ++ + +CD CD+GFH  C +P I+        W+C  C   G R
Sbjct:  206 ENMINCWDCGTCAHPTCLQ-WPDSLFQKVRTIRWQCLQCKRCSYCGMISRKDDDMLLCDACDQGFHIYCCDPPIKN--LPKGEWVCRICRPTGGR 297          
BLAST of Histone acetyltransferase KAT6A vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.624e-11
Identity = 35/95 (36.84%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPE-LTERARQSPWQCSACKTCCVCKDRS-SNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFR 2223
            E  + C DC    HP+CL  WP+ L ++ R   WQC  CK C  C   S  ++ + +CD CD+GFH  C +P I+        W+C  C   G R
Sbjct:  208 ENMINCWDCGTCAHPTCLQ-WPDSLFQKVRTIRWQCLQCKRCSYCGMISRKDDDMLLCDACDQGFHIYCCDPPIKN--LPKGEWVCRICRPTGGR 299          
BLAST of Histone acetyltransferase KAT6A vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.638e-11
Identity = 35/95 (36.84%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1945 EKFLFCKDCNVKVHPSCLHYWPE-LTERARQSPWQCSACKTCCVCKDRS-SNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCYKEGFR 2223
            E  + C DC    HP+CL  WP+ L ++ R   WQC  CK C  C   S  ++ + +CD CD+GFH  C +P I+        W+C  C   G R
Sbjct:  206 ENMINCWDCGTCAHPTCLQ-WPDSLFQKVRTIRWQCLQCKRCSYCGMISRKDDDMLLCDACDQGFHIYCCDPPIKN--LPKGEWVCRICRPTGGR 297          
The following BLAST results are available for this feature:
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAMD11.765e-1852.70sterile alpha motif domain containing 1 [Source:HG... [more]
KAT6A2.194e-1734.31lysine acetyltransferase 6A [Source:HGNC Symbol;Ac... [more]
KAT6A7.981e-1738.94lysine acetyltransferase 6A [Source:HGNC Symbol;Ac... [more]
KAT6A8.468e-1738.94lysine acetyltransferase 6A [Source:HGNC Symbol;Ac... [more]
KAT6A8.468e-1738.94lysine acetyltransferase 6A [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dpff-11.195e-1135.14Zinc finger protein dpff-1 [Source:UniProtKB/Swis... [more]
phf-106.100e-929.03PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
phf-101.600e-726.67PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
phf-101.600e-726.67PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
d41.165e-1231.58gene:FBgn0033015 transcript:FBtr0335258[more]
d41.189e-1231.58gene:FBgn0033015 transcript:FBtr0086082[more]
d41.288e-1231.58gene:FBgn0033015 transcript:FBtr0111115[more]
d41.312e-1231.58gene:FBgn0033015 transcript:FBtr0086083[more]
e(y)31.156e-1037.31gene:FBgn0087008 transcript:FBtr0334279[more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat6a2.970e-1740.71K(lysine) acetyltransferase 6A [Source:ZFIN;Acc:ZD... [more]
samd133.907e-1553.73sterile alpha motif domain containing 13 [Source:Z... [more]
samd133.907e-1553.73sterile alpha motif domain containing 13 [Source:Z... [more]
samd133.907e-1553.73sterile alpha motif domain containing 13 [Source:Z... [more]
kat6b2.236e-1438.66K(lysine) acetyltransferase 6B [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd131.302e-1857.14sterile alpha motif domain containing 13 [Source:N... [more]
samd132.799e-1857.14sterile alpha motif domain containing 13 [Source:N... [more]
samd134.052e-1857.14sterile alpha motif domain containing 13 [Source:N... [more]
phf101.773e-1336.78PHD finger protein 10 [Source:NCBI gene;Acc:595031... [more]
phf101.818e-1336.78PHD finger protein 10 [Source:NCBI gene;Acc:595031... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kat6a1.188e-1738.94K(lysine) acetyltransferase 6A [Source:MGI Symbol;... [more]
Kat6a1.188e-1738.94K(lysine) acetyltransferase 6A [Source:MGI Symbol;... [more]
Kat6a1.529e-1738.94K(lysine) acetyltransferase 6A [Source:MGI Symbol;... [more]
Samd131.432e-1650.63sterile alpha motif domain containing 13 [Source:M... [more]
Samd131.625e-1650.63sterile alpha motif domain containing 13 [Source:M... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5TKR9|KAT6A_RAT3.836e-1739.82Histone acetyltransferase KAT6A OS=Rattus norvegic... [more]
sp|Q92794|KAT6A_HUMAN4.067e-1638.94Histone acetyltransferase KAT6A OS=Homo sapiens OX... [more]
sp|Q8BZ21|KAT6A_MOUSE5.245e-1638.94Histone acetyltransferase KAT6A OS=Mus musculus OX... [more]
sp|Q5VXD3|SAM13_HUMAN9.195e-1655.71Sterile alpha motif domain-containing protein 13 O... [more]
sp|D3YUG0|SAM13_MOUSE1.137e-1550.63Sterile alpha motif domain-containing protein 13 O... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DJ501.051e-4844.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EAI32.135e-4844.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DCC54.729e-4844.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I8E01.807e-4640.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267ET357.433e-4640.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000015644.24.932e-1739.37pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
samd131.675e-1553.73sterile alpha motif domain containing 13 [Source:N... [more]
ENSAMXT00000045561.14.876e-1547.67pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000029811.17.366e-1550.00atherin-like [Source:NCBI gene;Acc:103043625][more]
kat6b5.135e-1441.11lysine acetyltransferase 6B [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd132.206e-1656.25sterile alpha motif domain containing 13 [Source:Z... [more]
dpf22.687e-1233.33D4, zinc and double PHD fingers family 2 [Source:Z... [more]
ENSPMAT00000002602.11.383e-1036.73pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 g... [more]
l3mbtl1b1.124e-737.14L3MBTL histone methyl-lysine binding protein 1b [S... [more]
ENSPMAT00000003495.11.947e-638.10pep scaffold:Pmarinus_7.0:GL478114:2294:5331:1 gen... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397414.521e-2145.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439067.593e-1856.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439048.996e-1856.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412382.037e-1537.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317642.975e-1335.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat6b9.518e-1741.28lysine acetyltransferase 6B [Source:NCBI gene;Acc:... [more]
kat6b1.396e-1641.28lysine acetyltransferase 6B [Source:NCBI gene;Acc:... [more]
kat6a1.701e-1640.71lysine acetyltransferase 6A [Source:NCBI gene;Acc:... [more]
samd131.881e-1452.24sterile alpha motif domain containing 13 [Source:N... [more]
ENSORLT00000008811.23.823e-1450.00atherin [Source:NCBI gene;Acc:101167122][more]
back to top
BLAST of Histone acetyltransferase KAT6A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038926.10.000e+099.76SMESG000038926.1[more]
SMESG000031948.15.380e-1331.73SMESG000031948.1[more]
SMESG000062900.11.610e-1136.84SMESG000062900.1[more]
SMESG000062900.11.624e-1136.84SMESG000062900.1[more]
SMESG000062900.11.638e-1136.84SMESG000062900.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033020 ID=SMED30033020|Name=Histone acetyltransferase KAT6A|organism=Schmidtea mediterranea sexual|type=transcript|length=2755bp
CAGTTGTGTATTTGCGCTACTTTACAATTTCGTTAATTATTGTTTTAGAT
TCAATTGGATCTTATTCGACGCAGATATTTAATGCATTATTGATTAAATT
TTTTCGATATGTCAAAACCAATCAATTCTCTGCCGATACAAAAAAATTGC
CATGTTTCAAATAACAGTTCAAACTCAATTACAACTACAATGTGTTCAAC
ATCCATTCAAAATGCTCCACTACAGATCCAGCCAAAACCTGTCGTAACGT
TTTTACAGACAACAAATCAGTCAAGAATAATATCATCACAGCCGGCTTTT
GCAATTCAACCCAACAATCAATACTTGGCAAATATTCAACCGAATTTTTC
GCATAATAATGCTACAAGACCTCAAGCGTATAATATTCCACCAGCAAACT
CATTCACGTTCACTCTAGCTCCAATAGCGGCTAAACCAATGGATAATTCA
AATAATACTGTAAATAATAATAATAACGTTAATAATATTAATAATAGCAA
TAATAATAATATTAACAATAATAATCACGTTACTGGATTGCCTTCCAATT
TCCAACCAATACAAATGCGTCCATCCAACAGTAATACTTCCAAACAGCCA
CCAGTTACTATGCCTCAGTCGTCTGCCAATATATCATCAGCTGCTGCGGG
AGGTTATTATCGAGAATGGATTCTAGAAGCTATAGATAAATTACGAGAGA
GAAAAGCCAGACCTGATGCTGAAAGAATATCGACATTAATGAAGCGTTAC
CACAACATTCCATTAGAAGATACAGTCATGTGTTTAAATAAATTAGCCGA
TTCTGGAGCAGTGGTTTGTGTGGATTACAAGGGTAATATCAGTTATCGAA
ATCCATACAAATGGAGAAAAAACAGTGCCAATGGTGGAGGAATTATGAAT
CCTCCAAGTATAACCAATCGAATTTTGGAATCATTTAGGCACATGGATAA
AACTCGTAGCACTGATTCTCAGAATCCTCATAAAGTCGGTTACTCGATCA
ATGAAATTGAACAAGCTATTATAGCCACTCAAACATCAGGTTCTATTGAA
TTATCTAAAACTCAACTGAGGCATTGTCTTGAAAGAGAAGCAGCTTATGG
AAAATTAATGCGCCGTGCTGATTGCACATATGTAATTGATGAAAATGGTG
AAAAGAAAATTCGAAAGGCTGCGGCAATCCAAGCAAAAAAAACTGCATTT
AGCCATAAACCTGCCCCAAACAAAACGATAGCAGCAGCACCCCATCCAAT
CACAATAGCAACCACAACACAAATGCTAACAAACATTCAAAATCCAATAG
TCAGTAATAATTCATTCACCACATTTTCATTGCAGCAGATTCCATCCTAT
AATCCACAATTTTTATCCCAAAATGACAGACAAATCGTACCAATGCTAAC
CTCAAACAATCCATTTGCATCAATATCTCTCGCATCAGTCAGTCAGCCTA
GTCCGATATTACCAAAGCAAACTCCTCCTCATGTGGCATTTGTAAAGTGT
GAAGCATCTCTAGCGCCGGAAATCAATTCGATTCCACAGCTACCAATCGT
CGTTACGAAAACTACTCACAATAATTTTACAGCTGAAAATGAAATGAAAG
AAGCGCAAATTTCATCTAATATTTCATCTACGACAATGCCATCAATTTCA
TCGGCAATTATATCAACCCCAACAATGGGAAATACAGCAAGTGTTGAATT
AAAAGTCACTACTAAAACCAGCAGGCGTGGAAGACCACCTGGTTCGAAAA
ATAAACGCTATCAAGAATCTGAGATTACTTCAACTAACAAGAAACAGAAA
ATTGATGTAGAAAATCACGCTACTAATGTTTCTGCTCCGTCATCATGCTC
AGCATTGAGTGTTAGCAATTCCGATCAAACAGTTCCAGCAGTGGGAGCAG
TAATTGAGTTGTGTTCTGAGTGTAAATCTCCGCAAACAGACTATGAAAAA
TTTCTGTTTTGTAAGGACTGCAATGTGAAAGTTCATCCTTCTTGTTTGCA
TTACTGGCCGGAATTAACTGAAAGAGCTCGACAATCTCCTTGGCAATGTA
GTGCTTGTAAAACTTGTTGTGTTTGCAAAGATCGAAGCTCAAACGAATCC
GTGTATATTTGTGATGGATGCGACAAAGGATTCCATTCTGCGTGTCATGA
ACCTAAAATTCAAGAACCGATTTCTCGGAATGCGGCATGGATTTGTTCGA
ATTGTTACAAAGAAGGCTTTCGAATTCGATCGGAAGAATCAATGAAAAAT
TCGTCGGATTCAATAACGAAAACTTACAAAGAAAATTCTAGTGACAAATT
GGAAAATAAAACTGGAATTGAAAAAATATCGATTACTGAAATAAAAAAAG
AAAATGTACTAGTGACAAATGAAGAGAGTAGAAAAGAGAATACTTTTTCC
GGTAAAATTCGACCGGAAGATGTGACGAAATGGTCGACAGATGATGTTTG
TGATTGGTTGACCGAGGAAGGATTCGGACTTCAATCGAATTTGTTTCGAG
AACAAGAAATCGACGGCGGTTCTCTTCTACTAATGAAACGAATGGACGTA
CTGACGGAATTGAATTTAAAATTGGGGCCGGCTGTGAAAATTTATGAGAA
AATTAAAAAAATTCAAAATGACGGCTCAATTTGGAAGTACGATGATTGTT
TTTGAATTTACACTTACAGAAATGCACATTTGTATATAGATGATAACCAA
TAATTATTACAACGGATATATTTACAATAAATTATTTTTCGACTTTAAAA
AAAAA
back to top

protein sequence of SMED30033020-orf-1

>SMED30033020-orf-1 ID=SMED30033020-orf-1|Name=SMED30033020-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=849bp
MSKPINSLPIQKNCHVSNNSSNSITTTMCSTSIQNAPLQIQPKPVVTFLQ
TTNQSRIISSQPAFAIQPNNQYLANIQPNFSHNNATRPQAYNIPPANSFT
FTLAPIAAKPMDNSNNTVNNNNNVNNINNSNNNNINNNNHVTGLPSNFQP
IQMRPSNSNTSKQPPVTMPQSSANISSAAAGGYYREWILEAIDKLRERKA
RPDAERISTLMKRYHNIPLEDTVMCLNKLADSGAVVCVDYKGNISYRNPY
KWRKNSANGGGIMNPPSITNRILESFRHMDKTRSTDSQNPHKVGYSINEI
EQAIIATQTSGSIELSKTQLRHCLEREAAYGKLMRRADCTYVIDENGEKK
IRKAAAIQAKKTAFSHKPAPNKTIAAAPHPITIATTTQMLTNIQNPIVSN
NSFTTFSLQQIPSYNPQFLSQNDRQIVPMLTSNNPFASISLASVSQPSPI
LPKQTPPHVAFVKCEASLAPEINSIPQLPIVVTKTTHNNFTAENEMKEAQ
ISSNISSTTMPSISSAIISTPTMGNTASVELKVTTKTSRRGRPPGSKNKR
YQESEITSTNKKQKIDVENHATNVSAPSSCSALSVSNSDQTVPAVGAVIE
LCSECKSPQTDYEKFLFCKDCNVKVHPSCLHYWPELTERARQSPWQCSAC
KTCCVCKDRSSNESVYICDGCDKGFHSACHEPKIQEPISRNAAWICSNCY
KEGFRIRSEESMKNSSDSITKTYKENSSDKLENKTGIEKISITEIKKENV
LVTNEESRKENTFSGKIRPEDVTKWSTDDVCDWLTEEGFGLQSNLFREQE
IDGGSLLLMKRMDVLTELNLKLGPAVKIYEKIKKIQNDGSIWKYDDCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001660SAM
IPR001965Znf_PHD
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger
IPR013761SAM/pointed_sf
IPR011011Znf_FYVE_PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 601..651
e-value: 0.0053
score: 26.0
coord: 652..700
e-value: 4.7E-6
score: 36.1
IPR001660Sterile alpha motif domainSMARTSM00454SAM_4coord: 772..838
e-value: 2.4E-10
score: 50.4
IPR001660Sterile alpha motif domainPFAMPF00536SAM_1coord: 774..834
e-value: 2.2E-10
score: 40.8
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 775..838
score: 10.359
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 760..840
e-value: 4.6E-22
score: 79.4
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 767..837
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 653..701
e-value: 3.9E-8
score: 33.0
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 650..702
score: 9.828
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 599..653
score: 9.143
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 595..704
e-value: 7.7E-21
score: 76.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 532..567
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 546..567
NoneNo IPR availablePANTHERPTHR12247LETHAL 3 MALIGNANT BRAIN TUMOR-RELATEDcoord: 183..835
NoneNo IPR availablePANTHERPTHR12247:SF134SAM-MOTIF UBIQUITOUSLY EXPRESSED PUNCTATEDLY LOCALIZED PROTEIN, ISOFORM Acoord: 183..835
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 642..702
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 599..651