nou darake like-5

Overview
Namenou darake like-5 (AFJ24803.1)
Smed IDSMED30033019
Length (bp)2683
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nou darake like-5 (SMED30033019) t-SNE clustered cells

Violin plots show distribution of expression levels for nou darake like-5 (SMED30033019) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nou darake like-5 (SMED30033019) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nou darake like-5 (SMED30033019) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033019

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30033019SMESG000070953.1 SmedASXL_010328SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30033019SMESG000070953.1 dd_Smed_v6_5102_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30033019SMESG000070953.1 OX_Smed_1.0.02042ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30033019SMESG000070953.1 OX_Smed_1.0.14575ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30033019SMESG000070953.1 JX010560smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30033019SMESG000070953.1 dd_Smed_v4_5102_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nou darake like-5 vs. Ensembl Zebrafish
Match: l1camb (L1 cell adhesion molecule, paralog b [Source:NCBI gene;Acc:30656])

HSP 1 Score: 55.4546 bits (132), Expect = 3.464e-7
Identity = 67/306 (21.90%), Postives = 120/306 (39.22%), Query Frame = 3
Query:  648 ITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKPKWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYY--VNNLKLENIGKADLGTYICSVLTQSNSP-ETKYVYIDLKP 1556
            ++N E   + +Y+CEAVN +G       V  +++ ++    D +                 +++   GQ V  DCR     T     P  +W                        ++L+ +P +  ++I  +++ S     + +  V++E    Y CSVS T   IS +      E  + + I GP  QN+ V  GS  +L CK T           ++ N   P      ++W+   +KI   +            +N KY+    +LK+ ++   D+G Y C V T  +S   + Y+ +  KP
Sbjct:  459 LSNVEFSDTAVYQCEAVNKHGSILINTHVHVVELPAQILTPDER-----------------LYQATAGQTVMLDCR-----TFGSPLPKIHW------------------------EILDSIPALSNAKISQMTNGS-----LKISNVSEEDSNRYTCSVSETNKSISAEL-----EVLNRTKIVGP-PQNLHVIRGSDAILHCKYT-----------VDHNLKSPT-----VQWKKDGHKITAST------------SNDKYHEIEGSLKVWDVQMEDMGIYSCEVSTTLDSDTASGYITVQDKP 679          
BLAST of nou darake like-5 vs. TrEMBL
Match: I1ZIE9 (Nou darake like-5 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1132.09 bits (2927), Expect = 0.000e+0
Identity = 646/646 (100.00%), Postives = 646/646 (100.00%), Query Frame = 3
Query:  408 MSKNYQKXXXXXXXXXXXXXXXTVSQSPPTQTGDIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKPKWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKESSKFPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKNRSGRGPAIXXXXXXXXXXXXXXXXXXXXXXQHMLPTSTVSSKTFQTQYVSSNEYPTNPSSTAPYGSNYPAFAAGYTPAVMSYNYSGHGQFLPQTNTTPSSTEIDHPCSHHACLSHNSPNIPYXXXXXXXXXXXXXXXXXXXXXXNTGNPTMMQPYSMSGASMNSYSPNXXXXXXXXXXXXXXXXXXXXXXXTTNVPYVIQNNPLTSTQPVYPIGKMYSA 2345
            MSKNYQKIIIINIILLVNLLNITVSQSPPTQTGDIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKPKWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKESSKFPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKNRSGRGPAIPTTNTSSANGSSSGSRNASNPRQHMLPTSTVSSKTFQTQYVSSNEYPTNPSSTAPYGSNYPAFAAGYTPAVMSYNYSGHGQFLPQTNTTPSSTEIDHPCSHHACLSHNSPNIPYDSDTTPSPPPPTSITDTVSTVPNTGNPTMMQPYSMSGASMNSYSPNQSSQVYSSHQPSQVSSNNSSSLSTTNVPYVIQNNPLTSTQPVYPIGKMYSA
Sbjct:    1 MSKNYQKIIIINIILLVNLLNITVSQSPPTQTGDIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKPKWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKESSKFPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKNRSGRGPAIPTTNTSSANGSSSGSRNASNPRQHMLPTSTVSSKTFQTQYVSSNEYPTNPSSTAPYGSNYPAFAAGYTPAVMSYNYSGHGQFLPQTNTTPSSTEIDHPCSHHACLSHNSPNIPYDSDTTPSPPPPTSITDTVSTVPNTGNPTMMQPYSMSGASMNSYSPNQSSQVYSSHQPSQVSSNNSSSLSTTNVPYVIQNNPLTSTQPVYPIGKMYSA 646          
BLAST of nou darake like-5 vs. TrEMBL
Match: A0A4Z2DX85 (Fibroblast growth factor receptor 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000957 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.637e-34
Identity = 130/478 (27.20%), Postives = 200/478 (41.84%), Query Frame = 3
Query:  510 IKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCK------SVE-DGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNK-NQPTYNWSKVKITQSYH------IKQSLTNTGYKKSN------QMLEMVPKI-----DKSQIDSISDMSQWG-SMVTLDKVTKEMDGLYRCSVST----------------TEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKAT---NSLSKPKWGKKIEKNELGPVDLTG--IIKWENSQYKIL---QGSLDIEHMNN-------------------------GGMMNNAKY-YVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPG---------GVKESSKFPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKN 1688
            I+  +L RV   +NLTCP   V FY+WN +  PSQ L E + Y +K    +   S  Y C AV+GYGK +    V+ ID +      +C       SV  +GPCFL S  D +       G ++ FDC A++       +   Y W  +    + +      + Q  + +G   SN      ++L   P +       +  +   D+SQ+  S + +DK+T + +G YRC+V T                  P I+RQ+RL VK     S I+GP + N +V  G   +  C+     +  S  +WGK I+ NE    +  G  +I+W    + +L     SL + H +N                         G +         + L L    ++D G Y+CSVLT++   + K+V I +  G         G   + +  LY   P  VF IC+  V YCLI R+        N
Sbjct:   66 IRMGYLIRVGQSLNLTCPGDAV-FYQWNLIDQPSQILSEEQFYTIKSATLKD--SNRYVCHAVHGYGKSSVEMSVRVIDSSLITTQHECAINPKTGSVNINGPCFLTSLTDKELNPTKSWGDQIVFDCDAVMAGIDGSLDSLIYQWEFISNANNNNNNNLRSVNQG-SGSGSDTSNIVIHRQRLLVRTPSVVGVISHSTDNNKKIDLSQFHESQLRIDKLTLDHNGEYRCAVRTRLPTTGGAVTANNNQQVPPLITRQFRLTVKSRVDGSIIQGPHITNGTVEAGQDAIFHCQVNPEEHRSSTIRWGKSIDINERLAYEAEGREVIQWAGGTFVVLPSVPASLALNHNSNILSDTSSSSLSSSASSSSVATALASGAVATEVSAGQSSQLVLRRASQSDSGRYVCSVLTEAGRDDHKFVQITVTGGSLIQGHKLTGSNGTHRLTLYIAIPTTVFFICLCVVTYCLISRRTAHNRRISN 539          
BLAST of nou darake like-5 vs. TrEMBL
Match: A0A068YED8 (Fibroblast growth factor receptor 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000816800 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.542e-31
Identity = 115/427 (26.93%), Postives = 193/427 (45.20%), Query Frame = 3
Query:  507 DIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDC------KSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAI-VNSTTNKNQPTYNWSKVK-ITQSYHIKQSLTNTGYKKSNQML--EMVPKIDKSQIDSISDMSQW-GSMVTLDKVTKEMDGLYRCSV-----------STTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKP---KWGKKIEKNELGPVD--LTGIIKWENSQYKILQGSL--DIEHMNN---GGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKP--------GGVKESS--KFPLYAIGPIAVFVICVATVLYCLIRRK 1661
            D ++ +L  +   INLTCP+T   FYKW      S  L E ++Y +K  ++  V  + Y C AVNG+G   A F +K ID  S   +  C      +  + GPCFL    + +       G+ V  DC ++ V     +   T+ +  +  I  S H+ +  T      S++     M  K + + +     ++++ GS + + K+T    G YRCSV           + T  ++ R +R+RV+       I+GP     +V +GS     C+      +    +WGK I  +E G  D     ++ W    Y +L   L  D++   +      ++N     + L L +    D G YICSV+T+S   + K+V+I LK         G V+E++     +Y + PI VF++C+ TV + +IR +
Sbjct:   52 DYRRGYLVNLGDTINLTCPYT-APFYKWTPAAQASWILSEDQMYSLK-ADSLSVTGK-YICSAVNGFGHNAAEFNIKVIDKFSPAVEQSCALLSNGRVSDSGPCFLNIYTEAELSQLQAWGEDVNLDCESVAVEGLAERVAYTWIFHPLNPIDTSSHLDEPDTYPPLYPSDRERPPRMTAKKESTDLTPAEAVARFTGSTLRIRKITLAHAGEYRCSVYVDAKLGNLSGALTIGKLLRTFRIRVQPRSEGEIIQGPHNITTTVELGSDAAFPCEINEEEHRSATIRWGKYISLDESGTTDSRTNEVLHWSGGTYVVLPTILPQDLQQFFDIPKPLAVSNPGSRRSRLVLRSASPRDAGLYICSVITESGRDDHKFVHISLKDGDKIIEGLGDVRETTPRHLTIYIVVPICVFLVCICTVAWVIIRNR 475          
BLAST of nou darake like-5 vs. TrEMBL
Match: A0A0R3W868 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6537 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.915e-31
Identity = 112/442 (25.34%), Postives = 197/442 (44.57%), Query Frame = 3
Query:  507 DIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDC------KSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAI-VNSTTNKNQPTYNWSKVKITQ-SYHIKQSLT-----NTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTE-----------PRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKP---KWGKKIEKNELGPVDL--TGIIKWENSQYKILQGSL--DIEHMNNGG---MMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPG-----GVKESSK-----FPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKNRSGR 1700
            D ++ +L  +   INLTCP+T   FYKW      S  L E ++Y +K  ++  V  + Y C AVNG+G   A F +K ID  S     +C      +  + GPCFL    + +    +  G+ V FDC ++ V     +   T+ +  +  T  S H+ +  T      T  ++   ++ M    D +  ++++  +  GS + + K+T    G Y+CSV+               ++SR +R+RV+       I+GP     ++ +GS     C+      +    +WGK +  +E G  D   + ++ W    Y +L   L  D++   +      ++N     + L L +    D G YICSV+T++   + K+V+I LK G     G+ ++         +Y   PI VF++C+  V   +IR +         R+G+
Sbjct:   32 DYRRGYLVNLGDTINLTCPYT-APFYKWTPAAQASWILSEDQMYSLK-ADSLSVTGK-YICSAVNGFGHNAAEFNIKVIDKFSPALKQNCALLSNGRVSDSGPCFLNIYSEAELSQLLPWGEDVNFDCESVAVEGLAERVAYTWTFHPLNPTDVSPHLDEPDTYPPFYPTDRERPPHIVAMKESTDLTPTEAVARFT--GSTLRIRKITLAHAGEYQCSVNVDAKLGNLSGALAISKLSRTFRIRVQPRSEGEIIQGPHNITTTIELGSDATFPCEINEEEHRSATIRWGKYVSLDESGTTDFRKSEVLHWSGGTYVVLPTILPQDLQQFFDVPKPLAVSNPGSRRSRLVLRSASPRDAGLYICSVITETGRDDHKFVHISLKDGNKVIEGLSDARDATPRHLTIYIAIPICVFLVCICAVASVIIRNRSRPNRQRTQRNGQ 468          
BLAST of nou darake like-5 vs. TrEMBL
Match: A0A068W8D2 (Fibroblast growth factor receptor 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000816800 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.700e-30
Identity = 114/427 (26.70%), Postives = 192/427 (44.96%), Query Frame = 3
Query:  507 DIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDC------KSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAI-VNSTTNKNQPTYNWSKV-KITQSYHIKQSLTNTGYKKSNQML--EMVPKIDKSQIDSISDMSQW-GSMVTLDKVTKEMDGLYRCSV-----------STTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKP---KWGKKIEKNELGPVD--LTGIIKWENSQYKILQGSL--DIEHMNN---GGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKP--------GGVKESS--KFPLYAIGPIAVFVICVATVLYCLIRRK 1661
            D ++ +L  +   INLTCP+T   FYKW      S  L E ++Y +K  ++  V  + Y C AVNG+G   A F +K ID  S   +  C      +  + GPCFL +  + +       G+ V  DC ++ V     +   T+ +  +  I  S H+ +  T      S++     M  K + + +     ++++ GS + + K+T    G YRCSV           + T  ++ R +R+RV+       I+GP     +V +GS     C+      +    +WGK I  +E G  D     ++ W    Y +L   L  D++   +      ++N     + L L +    D G YICSV+T+S   + K+V+I LK         G V+E++     +Y + PI VF++C+  V   +IR +
Sbjct:   52 DYRRGYLVNLGDTINLTCPYT-APFYKWTPAAQASWILSEDQMYSLK-ADSLSVTGK-YICSAVNGFGHNAAEFNIKVIDKFSPAVEQSCALLSNGRVSDSGPCFLNTYSEAELSQLQAWGEDVNLDCESVAVEGLAERVAYTWIFHPLNSIDISSHLDEPDTYPPLYPSDRERPPRMTAKKESTDLTPAEAVARFTGSTLRIRKITLAHAGEYRCSVYVDAKLGNLSGALTIGKLLRTFRIRVQPRSEGEIIQGPHNITTTVELGSDAAFPCEINEEEHRSATIRWGKYISLDESGTTDSRTNEVLHWSGGTYVVLPTILPQDLQQFFDIPKPLAVSNPGSRRSRLVLRSASPRDAGLYICSVITESGRDDHKFVHISLKDGDKIIEGLGDVRETTPRHLTIYIVVPICVFLVCICAVASVIIRNR 475          
BLAST of nou darake like-5 vs. Planmine SMEST
Match: SMESG000070953.1 (SMESG000070953.1)

HSP 1 Score: 1130.93 bits (2924), Expect = 0.000e+0
Identity = 645/646 (99.85%), Postives = 645/646 (99.85%), Query Frame = 3
Query:  408 MSKNYQKXXXXXXXXXXXXXXXTVSQSPPTQTGDIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKPKWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKESSKFPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKNRSGRGPAIXXXXXXXXXXXXXXXXXXXXXXQHMLPTSTVSSKTFQTQYVSSNEYPTNPSSTAPYGSNYPAFAAGYTPAVMSYNYSGHGQFLPQTNTTPSSTEIDHPCSHHACLSHNSPNIPYXXXXXXXXXXXXXXXXXXXXXXNTGNPTMMQPYSMSGASMNSYSPNXXXXXXXXXXXXXXXXXXXXXXXTTNVPYVIQNNPLTSTQPVYPIGKMYSA 2345
            MSKNYQKIIIINIILLVNLLNITVSQSPPTQTGDIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMG SHLLTCKATNSLSKPKWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKESSKFPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKNRSGRGPAIPTTNTSSANGSSSGSRNASNPRQHMLPTSTVSSKTFQTQYVSSNEYPTNPSSTAPYGSNYPAFAAGYTPAVMSYNYSGHGQFLPQTNTTPSSTEIDHPCSHHACLSHNSPNIPYDSDTTPSPPPPTSITDTVSTVPNTGNPTMMQPYSMSGASMNSYSPNQSSQVYSSHQPSQVSSNNSSSLSTTNVPYVIQNNPLTSTQPVYPIGKMYSA
Sbjct:    1 MSKNYQKIIIINIILLVNLLNITVSQSPPTQTGDIKQYFLTRVNTPINLTCPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQYRLRVKEAKSSSSIEGPLVQNISVTMGGSHLLTCKATNSLSKPKWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKESSKFPLYAIGPIAVFVICVATVLYCLIRRKVHQGNNFKNRSGRGPAIPTTNTSSANGSSSGSRNASNPRQHMLPTSTVSSKTFQTQYVSSNEYPTNPSSTAPYGSNYPAFAAGYTPAVMSYNYSGHGQFLPQTNTTPSSTEIDHPCSHHACLSHNSPNIPYDSDTTPSPPPPTSITDTVSTVPNTGNPTMMQPYSMSGASMNSYSPNQSSQVYSSHQPSQVSSNNSSSLSTTNVPYVIQNNPLTSTQPVYPIGKMYSA 646          
BLAST of nou darake like-5 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.756e-11
Identity = 94/416 (22.60%), Postives = 169/416 (40.62%), Query Frame = 3
Query:  525 LTRVNTPINLTCPFTEVDFYKW----NNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDC-----------KSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTE-PRISRQYRLRVKEAKSSS-----SIEGPLVQNISVTMGSSHLLTCKATNSLSKP----KWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKES---SKFPLYAIGPIAVFVICVATVLYCLI-RRKVHQGNNFK 1685
            L  + + + + CP  +  FY+W    NN ++   ++ +    ++ ++   +    IYEC A +G+ +++    V  ID  SK     C           K     PCF+      +  F + +G  V FDC +      + +  TY W  +  + + + K  LTN                               S + LD V  +  G Y C V T    ++ R + L V   +++      SIE     NI++       L C+    + +     KWGKK++   +   D +  I WE + YK+L  +  +   + G  + ++ YY  ++ LE  G+     Y+C+++T S + + K   + +    V+E    S F LY + P  +  IC    +Y  I RR   + +NF+
Sbjct:   11 LFFIGSNMEIICPL-DASFYQWKKYHNNKVT---NIFQDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVRE--QKEATFRMAKGLSVEFDCES------SGSNVTYAW--LFASSANNRKTILTNNK----------------------------SSTLKLD-VNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDL-AMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSS-YYFKDVSLEMAGE-----YMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQ 376          
BLAST of nou darake like-5 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.942e-11
Identity = 94/416 (22.60%), Postives = 169/416 (40.62%), Query Frame = 3
Query:  525 LTRVNTPINLTCPFTEVDFYKW----NNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDC-----------KSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTE-PRISRQYRLRVKEAKSSS-----SIEGPLVQNISVTMGSSHLLTCKATNSLSKP----KWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKES---SKFPLYAIGPIAVFVICVATVLYCLI-RRKVHQGNNFK 1685
            L  + + + + CP  +  FY+W    NN ++   ++ +    ++ ++   +    IYEC A +G+ +++    V  ID  SK     C           K     PCF+      +  F + +G  V FDC +      + +  TY W  +  + + + K  LTN                               S + LD V  +  G Y C V T    ++ R + L V   +++      SIE     NI++       L C+    + +     KWGKK++   +   D +  I WE + YK+L  +  +   + G  + ++ YY  ++ LE  G+     Y+C+++T S + + K   + +    V+E    S F LY + P  +  IC    +Y  I RR   + +NF+
Sbjct:   12 LFFIGSNMEIICPL-DASFYQWKKYHNNKVT---NIFQDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVRE--QKEATFRMAKGLSVEFDCES------SGSNVTYAW--LFASSANNRKTILTNNK----------------------------SSTLKLD-VNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDL-AMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSS-YYFKDVSLEMAGE-----YMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQ 377          
BLAST of nou darake like-5 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.961e-11
Identity = 94/416 (22.60%), Postives = 169/416 (40.62%), Query Frame = 3
Query:  525 LTRVNTPINLTCPFTEVDFYKW----NNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDC-----------KSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTE-PRISRQYRLRVKEAKSSS-----SIEGPLVQNISVTMGSSHLLTCKATNSLSKP----KWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKES---SKFPLYAIGPIAVFVICVATVLYCLI-RRKVHQGNNFK 1685
            L  + + + + CP  +  FY+W    NN ++   ++ +    ++ ++   +    IYEC A +G+ +++    V  ID  SK     C           K     PCF+      +  F + +G  V FDC +      + +  TY W  +  + + + K  LTN                               S + LD V  +  G Y C V T    ++ R + L V   +++      SIE     NI++       L C+    + +     KWGKK++   +   D +  I WE + YK+L  +  +   + G  + ++ YY  ++ LE  G+     Y+C+++T S + + K   + +    V+E    S F LY + P  +  IC    +Y  I RR   + +NF+
Sbjct:   16 LFFIGSNMEIICPL-DASFYQWKKYHNNKVT---NIFQDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVRE--QKEATFRMAKGLSVEFDCES------SGSNVTYAW--LFASSANNRKTILTNNK----------------------------SSTLKLD-VNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDL-AMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSS-YYFKDVSLEMAGE-----YMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQ 381          
BLAST of nou darake like-5 vs. Planmine SMEST
Match: SMESG000046208.1 (SMESG000046208.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.236e-10
Identity = 93/416 (22.36%), Postives = 170/416 (40.87%), Query Frame = 3
Query:  525 LTRVNTPINLTCPFTEVDFYKW----NNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGYGKKTATFIVKAIDVTSKQFDLDC-----------KSVEDGPCFLVSSIDNDFIFEVDEGQKVTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLEMVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTE-PRISRQYRLRVKEAKSSS-----SIEGPLVQNISVTMGSSHLLTCKATNSLSKP----KWGKKIEKNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKLENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKES---SKFPLYAIGPIAVFVICVATVLYCLI-RRKVHQGNNFK 1685
            L  + + + + CP  +  FY+W    NN ++   ++ +    ++ ++   +    IYEC A +G+G+++    V  ID  SK     C           K     PCF+      +  F + +G  V FDC +      + +  TY W  +  + + + K  LTN                               S + LD V  +  G Y C V T    ++ R + L V   +++      SIE     NI++       L C+    + +     KWGKK++   +   D + +I WE + YK+L  +  +   +    + ++ YY  ++ LE  G+     Y+C+++T + + + K   + +    V+E    S F LY + P  +  IC    +Y  I RR   + +NF+
Sbjct:   21 LFFIGSNMEIICPL-DATFYQWKKYHNNKVT---NIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVRE--QKEATFRMAKGLSVEFDCES------SGSNVTYAW--LFASSANNRKTILTNNK----------------------------SSTLKLD-VNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRKNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDL-AMKNFDKSQMIPWEGNLYKLLPENQIVTPPDPENRIVSS-YYFKDVSLEMAGE-----YMCAIITNTGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQ 386          
The following BLAST results are available for this feature:
BLAST of nou darake like-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l1camb3.464e-721.90L1 cell adhesion molecule, paralog b [Source:NCBI ... [more]
back to top
BLAST of nou darake like-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIE90.000e+0100.00Nou darake like-5 OS=Schmidtea mediterranea OX=793... [more]
A0A4Z2DX851.637e-3427.20Fibroblast growth factor receptor 1 OS=Schistosoma... [more]
A0A068YED83.542e-3126.93Fibroblast growth factor receptor 1 OS=Echinococcu... [more]
A0A0R3W8683.915e-3125.34Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068W8D23.700e-3026.70Fibroblast growth factor receptor 1 OS=Echinococcu... [more]
back to top
BLAST of nou darake like-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nou darake like-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070953.10.000e+099.85SMESG000070953.1[more]
SMESG000046244.12.756e-1122.60SMESG000046244.1[more]
SMESG000046244.12.942e-1122.60SMESG000046244.1[more]
SMESG000046244.12.961e-1122.60SMESG000046244.1[more]
SMESG000046208.11.236e-1022.36SMESG000046208.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033019
GenBankAFJ24803.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033019 ID=SMED30033019|Name=nou darake like-5|organism=Schmidtea mediterranea sexual|type=transcript|length=2683bp
ATTCACCAAAACTCAAGCTTAACAAATATACTGCAGAAAACTGTAGGACC
GTCAGAAATTTTGTCATAAAAAAAATGATTGCGCAGTACACTTGTCTTGG
TATTGAACTTCGTTTGTCTCTCCGGGTTTGTGTGTGAGCCAGTTACAGTA
GTATGTGTTAGTATGACAGACTAACTCACCAATACCCAAATAACAACCAA
TGTGCATCAATTCTAATAAGAAACCAGCTAATCGTAGTTAAAATAGCTTG
TATTCAATTATATAGAATTTGGTTTGTTAGAACAACGGATAAACAATAAG
CTCCCATTTCCCTTATTATCGAAATTGCCTTTAAGTAAGTGATAAACTGG
CATCAAATTAGTTTTACGGCTTTCCTGATGTAACCAGTGTTTTGTTATCC
AAGCAGAATGTCAAAGAATTATCAAAAGATAATCATCATCAATATTATTC
TACTGGTCAATTTGCTCAATATCACGGTCAGCCAAAGTCCCCCAACACAA
ACTGGAGATATCAAACAGTATTTCTTAACACGGGTCAACACTCCAATCAA
TCTCACTTGTCCATTTACGGAAGTTGATTTTTACAAATGGAACAATTTAA
TCAGCCCCAGTCAATCATTGGGAGAATCAAAGGTTTATCAGGTGAAAATA
ACAAACAACGAGAAAGTCAAATCAGAAATCTACGAATGCGAAGCTGTCAA
TGGATATGGCAAAAAAACGGCAACATTCATAGTTAAGGCCATTGATGTAA
CCTCGAAACAGTTTGATTTGGACTGCAAATCAGTTGAAGATGGCCCATGC
TTCCTGGTATCAAGCATCGACAATGATTTCATCTTTGAAGTGGATGAAGG
TCAAAAAGTGACTTTTGACTGTAGGGCTATTGTCAATTCGACAACAAATA
AAAACCAACCAACTTACAATTGGAGCAAAGTTAAAATAACACAATCCTAT
CACATAAAGCAGTCTCTGACAAATACCGGCTATAAAAAGTCTAACCAAAT
GTTGGAAATGGTTCCAAAAATTGACAAATCCCAAATTGACAGCATCAGTG
ATATGTCCCAATGGGGATCCATGGTCACCTTGGACAAAGTCACTAAAGAA
ATGGATGGTTTGTATAGGTGCTCGGTTTCTACTACTGAACCACGAATCAG
CAGACAATATAGACTACGCGTTAAAGAAGCCAAATCGAGCAGTTCCATTG
AAGGTCCACTGGTTCAGAATATATCCGTTACAATGGGCAGTTCTCATTTG
CTAACTTGTAAAGCTACGAATTCTCTCTCAAAACCGAAGTGGGGCAAAAA
AATAGAAAAGAACGAGCTGGGTCCGGTGGATTTGACGGGAATCATTAAAT
GGGAAAATAGCCAGTATAAAATCTTACAGGGATCATTGGATATTGAGCAC
ATGAATAACGGTGGGATGATGAATAACGCAAAATATTATGTCAACAATCT
GAAACTGGAAAATATCGGCAAAGCTGATCTCGGCACCTACATCTGTTCCG
TATTGACTCAATCAAATTCACCAGAAACGAAATATGTCTACATAGACTTG
AAACCCGGCGGAGTTAAAGAAAGCAGCAAATTTCCATTATATGCCATTGG
ACCGATAGCTGTATTCGTGATTTGCGTCGCAACGGTTCTTTACTGTCTTA
TTCGTCGAAAAGTTCACCAAGGAAATAATTTCAAAAATCGATCAGGTCGA
GGTCCAGCTATTCCGACAACGAACACATCTAGTGCAAACGGAAGCTCTTC
GGGTTCTAGAAACGCATCCAATCCTCGACAGCATATGCTGCCGACAAGTA
CAGTCAGTTCGAAAACATTTCAGACTCAATATGTGTCCAGTAACGAATAT
CCAACGAATCCGTCGTCTACCGCTCCGTATGGTTCAAATTATCCTGCATT
TGCAGCCGGTTATACACCAGCAGTTATGAGTTATAATTATTCTGGTCATG
GTCAATTTTTGCCGCAAACAAACACTACACCAAGCAGCACTGAAATCGAT
CATCCGTGCTCACATCATGCTTGCCTGTCTCACAATAGTCCGAATATTCC
ATATGATTCAGACACGACTCCGTCACCGCCTCCGCCAACAAGTATAACGG
ACACAGTCTCAACTGTGCCTAATACAGGCAATCCAACGATGATGCAACCG
TATTCAATGAGTGGGGCATCTATGAATTCGTATTCTCCCAATCAATCTAG
TCAAGTTTATTCATCTCATCAACCATCTCAAGTGTCGTCAAACAATTCGT
CTTCTCTATCAACAACAAATGTCCCATACGTAATACAGAACAATCCTTTA
ACATCAACACAGCCGGTATACCCAATTGGTAAGATGTACTCCGCCTAGAA
GACACGTGAAAATCTTATTCTGCTTGTTTCTTTTTATGAATTACTTTTTA
TAGTTTTATTAGTTCGTCAATTTTTGCTAACTTTTATATTTGGCTGCTAC
CCTAGATTAATTTTTTTCCGATAGTTTGTTGTAAAACGATTACTTTATAG
GGTAATGATTTGTATTTGGCTAACAGGGTGTTACAATAGAGATTACAGCG
ACCTCAAGATCTTTTCTCTAACAGGGTACAACCAATTGCTGGATCTAGGA
AGGGTATAATGTTTATATAATAATATCTCATCTTGAACTATTTTCATCTG
GTATTATCTATTTGGAGTCTGAGAGATCGGAAG
back to top

protein sequence of SMED30033019-orf-1

>SMED30033019-orf-1 ID=SMED30033019-orf-1|Name=SMED30033019-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=647bp
MSKNYQKIIIINIILLVNLLNITVSQSPPTQTGDIKQYFLTRVNTPINLT
CPFTEVDFYKWNNLISPSQSLGESKVYQVKITNNEKVKSEIYECEAVNGY
GKKTATFIVKAIDVTSKQFDLDCKSVEDGPCFLVSSIDNDFIFEVDEGQK
VTFDCRAIVNSTTNKNQPTYNWSKVKITQSYHIKQSLTNTGYKKSNQMLE
MVPKIDKSQIDSISDMSQWGSMVTLDKVTKEMDGLYRCSVSTTEPRISRQ
YRLRVKEAKSSSSIEGPLVQNISVTMGSSHLLTCKATNSLSKPKWGKKIE
KNELGPVDLTGIIKWENSQYKILQGSLDIEHMNNGGMMNNAKYYVNNLKL
ENIGKADLGTYICSVLTQSNSPETKYVYIDLKPGGVKESSKFPLYAIGPI
AVFVICVATVLYCLIRRKVHQGNNFKNRSGRGPAIPTTNTSSANGSSSGS
RNASNPRQHMLPTSTVSSKTFQTQYVSSNEYPTNPSSTAPYGSNYPAFAA
GYTPAVMSYNYSGHGQFLPQTNTTPSSTEIDHPCSHHACLSHNSPNIPYD
SDTTPSPPPPTSITDTVSTVPNTGNPTMMQPYSMSGASMNSYSPNQSSQV
YSSHQPSQVSSNNSSSLSTTNVPYVIQNNPLTSTQPVYPIGKMYSA*
back to top
Aliases
The feature 'nou darake like-5' has the following synonyms
Synonym
ndl-5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 36..110
e-value: 17.0
score: 9.4
coord: 269..382
e-value: 0.034
score: 23.3
coord: 140..256
e-value: 6.0E-5
score: 32.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 267..385
e-value: 5.6E-6
score: 28.2
coord: 137..266
e-value: 3.1E-9
score: 38.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 549..574
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 591..618
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 426..469
NoneNo IPR availablePANTHERPTHR19890FIBROBLAST GROWTH FACTOR RECEPTORcoord: 224..557
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.755
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 267..380
score: 7.395
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 130..248
score: 9.41
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 269..370
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 145..256