SMED30033015

Overview
NameSMED30033015
Smed IDSMED30033015
Length (bp)1645
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30033015 (SMED30033015) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30033015 (SMED30033015) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30033015 (SMED30033015) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30033015 (SMED30033015) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033015

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033015SMESG000049533.1 dd_Smed_v4_2058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033015SMESG000049533.1 dd_Smed_v4_2058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30033015SMESG000049533.1 dd_Smed_v4_2058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033015SMESG000049533.1 dd_Smed_v4_2058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033015SMESG000049533.1 dd_Smed_v4_2058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033015SMESG000049533.1 dd_Smed_v4_2058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033015 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000002:102409..131410 +7544
Homology
BLAST of SMED30033015 vs. Ensembl Human
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:HGNC Symbol;Acc:HGNC:25836])

HSP 1 Score: 60.8474 bits (146), Expect = 5.143e-9
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  549 SKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            ++ + ++ES+LE   G+   ++  L    ++   DQYE+ ++     ++K R +IE +G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GTIKL + V W+  
Sbjct:  192 TESMCLLESELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQ-RWKLRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTIKLSLEVTWSPF 323          
BLAST of SMED30033015 vs. Ensembl Human
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:HGNC Symbol;Acc:HGNC:25836])

HSP 1 Score: 60.8474 bits (146), Expect = 5.183e-9
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  549 SKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            ++ + ++ES+LE   G+   ++  L    ++   DQYE+ ++     ++K R +IE +G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GTIKL + V W+  
Sbjct:  188 TESMCLLESELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQ-RWKLRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTIKLSLEVTWSPF 319          
BLAST of SMED30033015 vs. Ensembl Human
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:HGNC Symbol;Acc:HGNC:25836])

HSP 1 Score: 60.8474 bits (146), Expect = 5.663e-9
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  549 SKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            ++ + ++ES+LE   G+   ++  L    ++   DQYE+ ++     ++K R +IE +G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GTIKL + V W+  
Sbjct:  202 TESMCLLESELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQ-RWKLRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTIKLSLEVTWSPF 333          
BLAST of SMED30033015 vs. Ensembl Human
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:HGNC Symbol;Acc:HGNC:25836])

HSP 1 Score: 60.8474 bits (146), Expect = 5.670e-9
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  549 SKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            ++ + ++ES+LE   G+   ++  L    ++   DQYE+ ++     ++K R +IE +G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GTIKL + V W+  
Sbjct:  208 TESMCLLESELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQ-RWKLRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTIKLSLEVTWSPF 339          
BLAST of SMED30033015 vs. Ensembl Human
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:HGNC Symbol;Acc:HGNC:25836])

HSP 1 Score: 60.8474 bits (146), Expect = 5.767e-9
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  549 SKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            ++ + ++ES+LE   G+   ++  L    ++   DQYE+ ++     ++K R +IE +G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GTIKL + V W+  
Sbjct:  208 TESMCLLESELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQ-RWKLRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTIKLSLEVTWSPF 339          
BLAST of SMED30033015 vs. Ensembl Celegans
Match: Y37A1A.4 (pep chromosome:WBcel235:IV:13943672:13964001:1 gene:WBGene00045063.1 transcript:Y37A1A.4e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1A.4)

HSP 1 Score: 49.2914 bits (116), Expect = 7.162e-6
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  567 IESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAIL 953
            I+++L    G++   I  +    +I+  D +E+ IR + + K+K++ K  +   Q W+     +  + D  I +K SE + L KS  L ++      ++  S P + TM L  +GTIKL+++V W  +L
Sbjct:  150 IDAELANLMGRVVVDIKAIVGFARISPGDVFEVLIR-HGSQKWKTKGKTLQDRTQKWEKEQVVLTCVPDQSIDVKVSECR-LFKSKSLNDRSFDPC-QLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLL 275          
BLAST of SMED30033015 vs. Ensembl Celegans
Match: Y37A1A.4 (pep chromosome:WBcel235:IV:13938730:13964001:1 gene:WBGene00045063.1 transcript:Y37A1A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1A.4)

HSP 1 Score: 49.2914 bits (116), Expect = 7.679e-6
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  567 IESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAIL 953
            I+++L    G++   I  +    +I+  D +E+ IR + + K+K++ K  +   Q W+     +  + D  I +K SE + L KS  L ++      ++  S P + TM L  +GTIKL+++V W  +L
Sbjct:  220 IDAELANLMGRVVVDIKAIVGFARISPGDVFEVLIR-HGSQKWKTKGKTLQDRTQKWEKEQVVLTCVPDQSIDVKVSECR-LFKSKSLNDRSFDPC-QLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLL 345          
BLAST of SMED30033015 vs. Ensembl Celegans
Match: Y37A1A.4 (pep chromosome:WBcel235:IV:13938468:13964001:1 gene:WBGene00045063.1 transcript:Y37A1A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1A.4)

HSP 1 Score: 49.2914 bits (116), Expect = 8.077e-6
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  567 IESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAIL 953
            I+++L    G++   I  +    +I+  D +E+ IR + + K+K++ K  +   Q W+     +  + D  I +K SE + L KS  L ++      ++  S P + TM L  +GTIKL+++V W  +L
Sbjct:  253 IDAELANLMGRVVVDIKAIVGFARISPGDVFEVLIR-HGSQKWKTKGKTLQDRTQKWEKEQVVLTCVPDQSIDVKVSECR-LFKSKSLNDRSFDPC-QLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLL 378          
BLAST of SMED30033015 vs. Ensembl Celegans
Match: Y37A1A.4 (pep chromosome:WBcel235:IV:13936475:13964001:1 gene:WBGene00045063.1 transcript:Y37A1A.4d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1A.4)

HSP 1 Score: 49.2914 bits (116), Expect = 8.187e-6
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  567 IESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAIL 953
            I+++L    G++   I  +    +I+  D +E+ IR + + K+K++ K  +   Q W+     +  + D  I +K SE + L KS  L ++      ++  S P + TM L  +GTIKL+++V W  +L
Sbjct:  237 IDAELANLMGRVVVDIKAIVGFARISPGDVFEVLIR-HGSQKWKTKGKTLQDRTQKWEKEQVVLTCVPDQSIDVKVSECR-LFKSKSLNDRSFDPC-QLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLL 362          
BLAST of SMED30033015 vs. Ensembl Celegans
Match: Y37A1A.4 (pep chromosome:WBcel235:IV:13952715:13964001:1 gene:WBGene00045063.1 transcript:Y37A1A.4g.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1A.4)

HSP 1 Score: 48.9062 bits (115), Expect = 8.440e-6
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  567 IESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAIL 953
            I+++L    G++   I  +    +I+  D +E+ IR + + K+K++ K  +   Q W+     +  + D  I +K SE + L KS  L ++      ++  S P + TM L  +GTIKL+++V W  +L
Sbjct:  124 IDAELANLMGRVVVDIKAIVGFARISPGDVFEVLIR-HGSQKWKTKGKTLQDRTQKWEKEQVVLTCVPDQSIDVKVSECR-LFKSKSLNDRSFDPC-QLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLL 249          
BLAST of SMED30033015 vs. Ensembl Zebrafish
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:ZFIN;Acc:ZDB-GENE-050420-32])

HSP 1 Score: 62.3882 bits (150), Expect = 9.837e-10
Identity = 46/186 (24.73%), Postives = 90/186 (48.39%), Query Frame = 3
Query:  558 LFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKLSINIENLFRSSRTENNI 1103
            + ++ES+LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P    + +  +GTIKL + V WN   DK +  S   +  + P  ++  ST ++   +  S+  +  +   R + ++
Sbjct:  188 MCMLESELENQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEINGKQVWDSEEMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQTVAVDINDLGTIKLSLEVTWNP-FDKDDQSSSASTVNKAPTVNKRFSTYNQSPPDTPSLREQAFYNMLRRQEDM 366          
BLAST of SMED30033015 vs. Ensembl Zebrafish
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:ZFIN;Acc:ZDB-GENE-050420-32])

HSP 1 Score: 62.3882 bits (150), Expect = 9.837e-10
Identity = 46/186 (24.73%), Postives = 90/186 (48.39%), Query Frame = 3
Query:  558 LFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKLSINIENLFRSSRTENNI 1103
            + ++ES+LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P    + +  +GTIKL + V WN   DK +  S   +  + P  ++  ST ++   +  S+  +  +   R + ++
Sbjct:  188 MCMLESELENQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEINGKQVWDSEEMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQTVAVDINDLGTIKLSLEVTWNP-FDKDDQSSSASTVNKAPTVNKRFSTYNQSPPDTPSLREQAFYNMLRRQEDM 366          
BLAST of SMED30033015 vs. Ensembl Zebrafish
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:ZFIN;Acc:ZDB-GENE-050420-32])

HSP 1 Score: 62.3882 bits (150), Expect = 1.124e-9
Identity = 46/186 (24.73%), Postives = 90/186 (48.39%), Query Frame = 3
Query:  558 LFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKLSINIENLFRSSRTENNI 1103
            + ++ES+LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P    + +  +GTIKL + V WN   DK +  S   +  + P  ++  ST ++   +  S+  +  +   R + ++
Sbjct:  203 MCMLESELENQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEINGKQVWDSEEMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQTVAVDINDLGTIKLSLEVTWNP-FDKDDQSSSASTVNKAPTVNKRFSTYNQSPPDTPSLREQAFYNMLRRQEDM 381          
BLAST of SMED30033015 vs. Ensembl Zebrafish
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:ZFIN;Acc:ZDB-GENE-050420-32])

HSP 1 Score: 62.3882 bits (150), Expect = 1.273e-9
Identity = 46/186 (24.73%), Postives = 90/186 (48.39%), Query Frame = 3
Query:  558 LFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKLSINIENLFRSSRTENNI 1103
            + ++ES+LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P    + +  +GTIKL + V WN   DK +  S   +  + P  ++  ST ++   +  S+  +  +   R + ++
Sbjct:  220 MCMLESELENQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEINGKQVWDSEEMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQTVAVDINDLGTIKLSLEVTWNP-FDKDDQSSSASTVNKAPTVNKRFSTYNQSPPDTPSLREQAFYNMLRRQEDM 398          
BLAST of SMED30033015 vs. Ensembl Zebrafish
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:ZFIN;Acc:ZDB-GENE-050420-32])

HSP 1 Score: 62.003 bits (149), Expect = 1.680e-9
Identity = 38/135 (28.15%), Postives = 68/135 (50.37%), Query Frame = 3
Query:  558 LFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            + ++ES+LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P    + +  +GTIKL + V WN  
Sbjct:  200 MCMLESELENQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEINGKQVWDSEEMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQTVAVDINDLGTIKLSLEVTWNPF 328          
BLAST of SMED30033015 vs. Ensembl Xenopus
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:100491386])

HSP 1 Score: 65.4698 bits (158), Expect = 1.606e-10
Identity = 46/186 (24.73%), Postives = 88/186 (47.31%), Query Frame = 3
Query:  405 TLKADYLKLLEMKKEEYDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
             LK      LE+ + E DK+   +      +NS++          + + K + ++E+ LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD  +    P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GT+KL + V WN  
Sbjct:   86 ALKRGLGAYLEVHQIELDKLTKQIKE--SKRNSRLGF-------LYDLDKNMCVLENDLESQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEVNGKQVWDSEDMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTVKLSLEVSWNPF 256          
BLAST of SMED30033015 vs. Ensembl Xenopus
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:100491386])

HSP 1 Score: 64.6994 bits (156), Expect = 2.969e-10
Identity = 38/145 (26.21%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  522 EESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWN 944
            E  + Y   ++ + ++E+ LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD  +    P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GT+KL + V WN
Sbjct:   20 EAGKGYKEYTENMCVLENDLESQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEVNGKQVWDSEDMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTVKLSLEVSWN 158          
BLAST of SMED30033015 vs. Ensembl Xenopus
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:100491386])

HSP 1 Score: 64.3142 bits (155), Expect = 3.502e-10
Identity = 38/145 (26.21%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  522 EESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWN 944
            E  + Y   ++ + ++E+ LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD  +    P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GT+KL + V WN
Sbjct:  163 EAGKGYKEYTENMCVLENDLESQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEVNGKQVWDSEDMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTVKLSLEVSWN 301          
BLAST of SMED30033015 vs. Ensembl Xenopus
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:100491386])

HSP 1 Score: 64.3142 bits (155), Expect = 3.731e-10
Identity = 38/145 (26.21%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  522 EESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWN 944
            E  + Y   ++ + ++E+ LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD  +    P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GT+KL + V WN
Sbjct:  182 EAGKGYKEYTENMCVLENDLESQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEVNGKQVWDSEDMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTVKLSLEVSWN 320          
BLAST of SMED30033015 vs. Ensembl Xenopus
Match: RIPOR1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:100491386])

HSP 1 Score: 64.3142 bits (155), Expect = 3.957e-10
Identity = 38/145 (26.21%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  522 EESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWN 944
            E  + Y   ++ + ++E+ LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD  +    P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GT+KL + V WN
Sbjct:  176 EAGKGYKEYTENMCVLENDLESQLGEFHIKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEVNGKQVWDSEDMVFLPLITEFLSIKVTELKSLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTVKLSLEVSWN 314          
BLAST of SMED30033015 vs. Ensembl Mouse
Match: Ripor2 (RHO family interacting cell polarization regulator 2 [Source:MGI Symbol;Acc:MGI:2444879])

HSP 1 Score: 60.4622 bits (145), Expect = 4.427e-9
Identity = 36/135 (26.67%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +  IE++LE   G+   ++  L    ++   DQYE+ ++     ++K + KIE  G Q WD       P++  +I IK +ELK L  + +L+        E+  + P +  + +  +GTIKL + + W
Sbjct:  217 YKEYTENMCAIEAELESLLGEFSIKMKGLAGFARLCPGDQYEIFMKYG-RQRWKLKGKIEVNGKQSWDGAETVFLPLIVGFISIKVTELKGL-ATHILVGSVTCETKELFAARPQVVAVDINDLGTIKLNLEITW 349          
BLAST of SMED30033015 vs. Ensembl Mouse
Match: Ripor2 (RHO family interacting cell polarization regulator 2 [Source:MGI Symbol;Acc:MGI:2444879])

HSP 1 Score: 60.077 bits (144), Expect = 4.520e-9
Identity = 36/135 (26.67%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +  IE++LE   G+   ++  L    ++   DQYE+ ++     ++K + KIE  G Q WD       P++  +I IK +ELK L  + +L+        E+  + P +  + +  +GTIKL + + W
Sbjct:  211 YKEYTENMCAIEAELESLLGEFSIKMKGLAGFARLCPGDQYEIFMKYG-RQRWKLKGKIEVNGKQSWDGAETVFLPLIVGFISIKVTELKGL-ATHILVGSVTCETKELFAARPQVVAVDINDLGTIKLNLEITW 343          
BLAST of SMED30033015 vs. Ensembl Mouse
Match: Ripor2 (RHO family interacting cell polarization regulator 2 [Source:MGI Symbol;Acc:MGI:2444879])

HSP 1 Score: 60.077 bits (144), Expect = 5.552e-9
Identity = 36/135 (26.67%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +  IE++LE   G+   ++  L    ++   DQYE+ ++     ++K + KIE  G Q WD       P++  +I IK +ELK L  + +L+        E+  + P +  + +  +GTIKL + + W
Sbjct:  208 YKEYTENMCAIEAELESLLGEFSIKMKGLAGFARLCPGDQYEIFMKYG-RQRWKLKGKIEVNGKQSWDGAETVFLPLIVGFISIKVTELKGL-ATHILVGSVTCETKELFAARPQVVAVDINDLGTIKLNLEITW 340          
BLAST of SMED30033015 vs. Ensembl Mouse
Match: Ripor2 (RHO family interacting cell polarization regulator 2 [Source:MGI Symbol;Acc:MGI:2444879])

HSP 1 Score: 60.077 bits (144), Expect = 6.878e-9
Identity = 36/135 (26.67%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +  IE++LE   G+   ++  L    ++   DQYE+ ++     ++K + KIE  G Q WD       P++  +I IK +ELK L  + +L+        E+  + P +  + +  +GTIKL + + W
Sbjct:  183 YKEYTENMCAIEAELESLLGEFSIKMKGLAGFARLCPGDQYEIFMKYG-RQRWKLKGKIEVNGKQSWDGAETVFLPLIVGFISIKVTELKGL-ATHILVGSVTCETKELFAARPQVVAVDINDLGTIKLNLEITW 315          
BLAST of SMED30033015 vs. Ensembl Mouse
Match: Ripor2 (RHO family interacting cell polarization regulator 2 [Source:MGI Symbol;Acc:MGI:2444879])

HSP 1 Score: 59.6918 bits (143), Expect = 8.082e-9
Identity = 36/135 (26.67%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +  IE++LE   G+   ++  L    ++   DQYE+ ++     ++K + KIE  G Q WD       P++  +I IK +ELK L  + +L+        E+  + P +  + +  +GTIKL + + W
Sbjct:  208 YKEYTENMCAIEAELESLLGEFSIKMKGLAGFARLCPGDQYEIFMKYG-RQRWKLKGKIEVNGKQSWDGAETVFLPLIVGFISIKVTELKGL-ATHILVGSVTCETKELFAARPQVVAVDINDLGTIKLNLEITW 340          
BLAST of SMED30033015 vs. UniProt/SwissProt
Match: sp|Q6ZS17|RIPR1_HUMAN (Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.470e-8
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  549 SKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            ++ + ++ES+LE   G+   ++  L    ++   DQYE+ ++     ++K R +IE +G Q+WD       P++ +++ IK +ELK L       SV  E K     ++  + P +  + +  +GTIKL + V W+  
Sbjct:  192 TESMCLLESELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQ-RWKLRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLANHVVVGSVSCETK-----DLFAALPQVVAVDINDLGTIKLSLEVTWSPF 323          
BLAST of SMED30033015 vs. UniProt/SwissProt
Match: sp|Q3B7M3|RIPR2_BOVIN (Rho family-interacting cell polarization regulator 2 OS=Bos taurus OX=9913 GN=RIPOR2 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.585e-8
Identity = 39/139 (28.06%), Postives = 68/139 (48.92%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +  IE++LEK  G+   ++  L    ++   DQYE+ ++     ++K + +IE  G Q WD       P++  +I IK +ELK L       SV  E K     E+  + P +  + +  +GTIKL + + W
Sbjct:  183 YKEYTENMCAIEAELEKQLGEFSIKMKGLAGFARLCPGDQYEIFMKYG-RQRWKLKGRIEVNGKQSWDGEEMVFLPLIVGFISIKVTELKGLATHLLVGSVTCETK-----ELFAARPQVVAVDINDLGTIKLNLEITW 315          
BLAST of SMED30033015 vs. UniProt/SwissProt
Match: sp|Q5EB20|RIPR3_DANRE (RIPOR family member 3 OS=Danio rerio OX=7955 GN=ripor3 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.669e-8
Identity = 42/152 (27.63%), Postives = 74/152 (48.68%), Query Frame = 3
Query:  567 IESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASS 1022
            +E++LE   G+L  ++  L    ++   DQYE+ IRL    +++ R +I+    Q+WD       P +     IK +E+K L  SS+L+        +   + P +  + +T +GTIKL++ V WN   D + +     S+    + SR  S
Sbjct:  190 MEAELEILLGELHVKMKGLIGFARLCPGDQYEVLIRLG-RQRWRIRGRIQTDDRQMWDEEEMVFLPHIHGNFEIKVTEVKGL--SSILVGMVTCRSADFFTARPQMMVVDITELGTIKLQLEVVWNP-FDSTEVRPLTASASRQSIHSRKGS 337          
BLAST of SMED30033015 vs. UniProt/SwissProt
Match: sp|Q80U16|RIPR2_MOUSE (Rho family-interacting cell polarization regulator 2 OS=Mus musculus OX=10090 GN=Ripor2 PE=1 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 5.653e-8
Identity = 36/135 (26.67%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +  IE++LE   G+   ++  L    ++   DQYE+ ++     ++K + KIE  G Q WD       P++  +I IK +ELK L  + +L+        E+  + P +  + +  +GTIKL + + W
Sbjct:  208 YKEYTENMCAIEAELESLLGEFSIKMKGLAGFARLCPGDQYEIFMKYG-RQRWKLKGKIEVNGKQSWDGAETVFLPLIVGFISIKVTELKGL-ATHILVGSVTCETKELFAARPQVVAVDINDLGTIKLNLEITW 340          
BLAST of SMED30033015 vs. UniProt/SwissProt
Match: sp|Q1LU99|RIPR2_DANRE (Rho family-interacting cell polarization regulator 2 OS=Danio rerio OX=7955 GN=ripor2 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 9.321e-8
Identity = 37/135 (27.41%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +   E +LE   G+   ++  L    ++   DQYE+ +R     ++K + KIE    Q WD       P++ D I IK +ELK L  + VL+   +    ++  + P +  + +  +GTIKL + V W
Sbjct:  219 YKEYTENMSTFEGELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYG-RQRWKLKGKIEGNSKQSWDGEEMIFMPLISDLINIKVTELKGL-ATHVLVGSVICETKDLFTAMPQVVAVDVNDLGTIKLNLEVAW 351          
BLAST of SMED30033015 vs. TrEMBL
Match: A0A4D5RR59 (Protein kinase pkn/prk1 effector (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.421e-15
Identity = 70/270 (25.93%), Postives = 131/270 (48.52%), Query Frame = 3
Query:  246 PRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDD-RMMLVQTLKAD--YLKLLEMK-------KEEY-------DKIQS-NLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVP 1001
            PRP + L++F+ V  GL E            G+  +D   + + +D+  +   Q LK    YLK LE +       +E+Y       D ++S     +L     K N        Y      L ++E+ LE+  G LQFQ+  +    ++ + D +E+S++ +   K+KSR +++K G Q+WD +   +  ++ ++++IK  E++ L K +VL+  K   + E+  S   + T+ L   G++KL +I+ WN +     L   + +S++ P
Sbjct:  209 PRPARTLLIFNAVERGLRECV----------GLAQEDILSLRSSVDNLSLSSSQQLKTAERYLKRLEFQLSKVEELREQYEVQQRMRDGVRSMAYAYVLSPGCEKDNALHGVRSGYRECVDTLCVLEAHLEQLMGTLQFQMKGIQGFARLCAGDNFEISVK-HGEQKWKSRGRVQKNGQQVWDNQQIIVKALLGEFLFIKAVEVRGLGK-NVLLGNKSCEIKELFSSHSQLMTVNLNSSGSLKLNLIITWNPL--HGCLEDSVAASKQSP 464          
BLAST of SMED30033015 vs. TrEMBL
Match: A0A131XAL1 (Protein kinase pkn/prk1 effector (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.238e-14
Identity = 67/253 (26.48%), Postives = 123/253 (48.62%), Query Frame = 3
Query:  246 PRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDD-RMMLVQTLKAD--YLKLLEMK-------KEEY-------DKIQS-NLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            PRP + L++F+ V  GL E             +  +D   + + +D+  +   Q LKA   YLK +E +       +E Y       D ++S     +L     K N        Y      L I+E+ LE+  G LQFQ+  +    ++ + D +E+S++  D  K+KSR +++K G Q+WD +   +  ++ ++++IK  E++ L K +VL+  K   + E+  S   + T+ L   G++KL +++ WN +
Sbjct:   58 PRPARTLLIFNAVERGLRECVS----------LAQEDILSLRSSVDNLSLSSSQQLKAAERYLKRIEFQLSKVEELREHYEVQQRMRDGVRSMAYAYVLSPGCEKDNALHGVRSGYRECVDTLCILEAHLEQLMGTLQFQMRGIQGFARLCAGDVFEISVKHGDQ-KWKSRGRVQKNGQQVWDNQQVIMKALLGEFLFIKAVEVRGLGK-NVLLGNKSCEIKELFSSHSQLMTINLNSSGSLKLNLVITWNPL 298          
BLAST of SMED30033015 vs. TrEMBL
Match: A0A1E1X4S2 (Protein kinase pkn/prk1 effector OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.372e-14
Identity = 68/253 (26.88%), Postives = 121/253 (47.83%), Query Frame = 3
Query:  246 PRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDD-RMMLVQTLKAD--YLKLLEMK-------KEEY-------DKIQS-NLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            PRP + L++F+ V  GL E             +  +D   + + +D+  +   Q LKA   YLK +E +       +E Y       D ++S     +L     K N        Y      L ++E+ LE+  G LQFQ+  +    ++   D +E+S++  D  K+KSR ++ K G Q+WD +   I  ++ +++YIK  E++ L K +VL+  K   + E+  S   + T+ L   G++KL +++ WN +
Sbjct:  106 PRPARTLLIFNAVERGLRECVS----------LAQEDILSLRSSVDNLSLSSSQQLKAAERYLKRIEFQLSKVEELREHYEVQQRMRDGVRSMAYAYVLSPGCEKDNALHGVRSGYRECVDTLCVLEAHLEQLMGTLQFQMRGIQGFARLCPGDNFEISVKHGDQ-KWKSRGRVLKDGQQVWDNQQVIIKALLGEFLYIKAVEVRGLGK-NVLLGNKSCEIKELFSSHSQLMTINLNSSGSLKLNLVITWNPL 346          
BLAST of SMED30033015 vs. TrEMBL
Match: A0A131YWN3 (Protein kinase pkn/prk1 effector OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.554e-14
Identity = 65/253 (25.69%), Postives = 122/253 (48.22%), Query Frame = 3
Query:  246 PRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDD-RMMLVQTLKAD--YLKLLEMK-------KEEY-------DKIQS-NLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            PRP + L++F+ V  GL E             +  +D   + + +D+  +   Q LKA   YLK +E +       +E Y       D ++S     +L     K N        Y      L ++E+ LE+  G LQFQ+  +    ++ + D +E+S++  D  K+KSR +++K G Q+WD +   +  ++ ++++IK  E++ L K+ +L  K    + E+  S   + T+ L   G++KL +++ WN +
Sbjct:  108 PRPARTLLIFNAVERGLRECVS----------LAQEDILSLRSSVDNLSLSSSQQLKAAERYLKRIEFQLSKVEELREHYEVQQRMRDGVRSMAYAYVLSPGCEKDNALHGVRSGYRECVDTLCVLEAHLEQLMGTLQFQMRGIQGFARLCAGDVFEISVKHGDQ-KWKSRGRVQKNGQQVWDNQQVIMKALLGEFLFIKAVEVRGLGKNMLLGNKSCE-IKELFSSHSQLMTINLNSSGSLKLNLVITWNPL 348          
BLAST of SMED30033015 vs. TrEMBL
Match: A0A224YNG8 (Protein kinase pkn/prk1 effector OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.956e-14
Identity = 65/253 (25.69%), Postives = 122/253 (48.22%), Query Frame = 3
Query:  246 PRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDD-RMMLVQTLKAD--YLKLLEMK-------KEEY-------DKIQS-NLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            PRP + L++F+ V  GL E             +  +D   + + +D+  +   Q LKA   YLK +E +       +E Y       D ++S     +L     K N        Y      L ++E+ LE+  G LQFQ+  +    ++ + D +E+S++  D  K+KSR +++K G Q+WD +   +  ++ ++++IK  E++ L K+ +L  K    + E+  S   + T+ L   G++KL +++ WN +
Sbjct:  108 PRPARTLLIFNAVERGLRECVS----------LAQEDILSLRSSVDNLSLSSSQQLKAAERYLKRIEFQLSKVEELREHYEVQQRMRDGVRSMAYAYVLSPGCEKDNALHGVRSGYRECVDTLCVLEAHLEQLMGTLQFQMRGIQGFARLCAGDVFEISVKHGDQ-KWKSRGRVQKNGQQVWDNQQVIMKALLGEFLFIKAVEVRGLGKNMLLGNKSCE-IKELFSSHSQLMTINLNSSGSLKLNLVITWNPL 348          
BLAST of SMED30033015 vs. Ensembl Cavefish
Match: ripor3 (RIPOR family member 3 [Source:NCBI gene;Acc:503535])

HSP 1 Score: 63.1586 bits (152), Expect = 5.612e-10
Identity = 54/195 (27.69%), Postives = 88/195 (45.13%), Query Frame = 3
Query:  552 KELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKLSINIENLFRSSRTENNIHSISNILEDVD 1136
            +++  +E +LE   G+LQ ++  L    ++   DQYE+ IRL    +++ R +I+    QLWD       P + +   IK +E+K L  SS+L+        +     P +  + +T +GTIKL++ V WN   D   +   + S+    V SR  S       N  S           TE    S+   L+DVD
Sbjct:  182 QDMCAMEGELEILLGELQIKMKGLIGFARLCPGDQYEVLIRLG-RQRWRIRGRIQTDDRQLWDEEEMAFLPHIHENFEIKVTEVKGL--SSILVGMVTCKSADFFMLRPQLMVVDITELGTIKLQLEVVWNP-FDSGEVKPVMSSTSRQSVHSRKGSVYSWTPPNTPSF----------TEKYFLSMMRQLQDVD 362          
BLAST of SMED30033015 vs. Ensembl Cavefish
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:103029961])

HSP 1 Score: 60.8474 bits (146), Expect = 2.946e-9
Identity = 41/156 (26.28%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  558 LFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASST 1025
            + ++ES+LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD       P++ +++ IK +ELK L  + V++        ++  + P    + +  +GTIKL + V WN   DK +  S   +  + P  ++  ST
Sbjct:  188 MCMLESELENQLGEFHVKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEINGKQVWDSEEMVFLPLITEFLSIKVTELKSL-ANHVVVGNVSCETKDLFAALPQTVAVDINDLGTIKLSLEVTWNP-FDKDDQASTASTVNKAPTVNKRFST 340          
BLAST of SMED30033015 vs. Ensembl Cavefish
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:103029961])

HSP 1 Score: 60.8474 bits (146), Expect = 3.087e-9
Identity = 41/156 (26.28%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  558 LFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASST 1025
            + ++ES+LE   G+   ++  L    ++ + DQYE+ ++     ++K R +IE  G Q+WD       P++ +++ IK +ELK L  + V++        ++  + P    + +  +GTIKL + V WN   DK +  S   +  + P  ++  ST
Sbjct:  203 MCMLESELENQLGEFHVKMKGLAGFARLCAGDQYEIFMKYG-RQRWKLRGRIEINGKQVWDSEEMVFLPLITEFLSIKVTELKSL-ANHVVVGNVSCETKDLFAALPQTVAVDINDLGTIKLSLEVTWNP-FDKDDQASTASTVNKAPTVNKRFST 355          
BLAST of SMED30033015 vs. Ensembl Cavefish
Match: ripor2 (RHO family interacting cell polarization regulator 2 [Source:NCBI gene;Acc:103043621])

HSP 1 Score: 58.151 bits (139), Expect = 1.910e-8
Identity = 37/135 (27.41%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +   E +LE   G+   ++  L    ++   DQYE+ +R     ++K + KIE    Q WD       P++ D I IK +ELK L  + VL+   +    ++  + P +  + +  +GTIKL + V W
Sbjct:  216 YKEYTENMSTFEWELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYG-RQRWKLKGKIEANSRQSWDGEEMIFMPLITDLISIKVTELKGL-ATHVLVGSVICETKDLFTAMPQVVAVDVNDLGTIKLNLEVTW 348          
BLAST of SMED30033015 vs. Ensembl Cavefish
Match: ripor2 (RHO family interacting cell polarization regulator 2 [Source:NCBI gene;Acc:103043621])

HSP 1 Score: 58.151 bits (139), Expect = 1.920e-8
Identity = 37/135 (27.41%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +   E +LE   G+   ++  L    ++   DQYE+ +R     ++K + KIE    Q WD       P++ D I IK +ELK L  + VL+   +    ++  + P +  + +  +GTIKL + V W
Sbjct:  216 YKEYTENMSTFEWELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYG-RQRWKLKGKIEANSRQSWDGEEMIFMPLITDLISIKVTELKGL-ATHVLVGSVICETKDLFTAMPQVVAVDVNDLGTIKLNLEVTW 348          
BLAST of SMED30033015 vs. Ensembl Nematostella
Match: EDO42356 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N8])

HSP 1 Score: 60.077 bits (144), Expect = 1.852e-9
Identity = 38/135 (28.15%), Postives = 73/135 (54.07%), Query Frame = 3
Query:  549 SKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNK----SSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            S  L  +E +LE   G  +F+I  L   G++ S D Y++ I+   + K+KSR K+++ G Q W    F + P ++D + ++  E++ +       SV+++ +       I++ P  F++ L   G++KLK+ V+W
Sbjct:  269 SMRLCSLEEELESKLGIFRFKIEGLVGFGRLCSGDTYDVFIKHGFSFKWKSRCKVDREG-QKWIDGEFTLPPGINDELSMRVIEMRKIQANVSVGSVVLKSR-----NYIKARPQSFSVPLNRTGSMKLKLTVEW 397          
BLAST of SMED30033015 vs. Ensembl Nematostella
Match: EDO26323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCB2])

HSP 1 Score: 54.299 bits (129), Expect = 2.398e-9
Identity = 23/63 (36.51%), Postives = 32/63 (50.79%), Query Frame = -2
Query: 1453 SLFHLPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQ 1641
             L  +PQ  L+  PQ  L  +PQ  L  +PQ  L+  PQ  +  +PQ  L  +PQ  L+  PQ
Sbjct:   21 CLTSIPQTCLASIPQTCLTSIPQTCLTSIPQTCLASIPQTCVKSIPQTCLTSIPQTCLASIPQ 83          

HSP 2 Score: 53.1434 bits (126), Expect = 6.047e-9
Identity = 22/59 (37.29%), Postives = 31/59 (52.54%), Query Frame = -2
Query: 1453 LPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQ 1629
            +PQ  L+  PQ  L  +PQ  L  +PQ  L+  PQ  L  +PQ  +  +PQ  L+  PQ
Sbjct:   17 IPQTCLTSIPQTCLASIPQTCLTSIPQTCLTSIPQTCLASIPQTCVKSIPQTCLTSIPQ 75          

HSP 3 Score: 52.7582 bits (125), Expect = 8.257e-9
Identity = 23/63 (36.51%), Postives = 32/63 (50.79%), Query Frame = -2
Query: 1453 SLFHLPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQ 1641
             L  +PQ  L+  PQ  L  +PQ  +  +PQ  L+  PQ  L  +PQ  L  +PQ  L+  PQ
Sbjct:   37 CLTSIPQTCLTSIPQTCLASIPQTCVKSIPQTCLTSIPQTCLASIPQTCLTFIPQTCLTSIPQ 99          

HSP 4 Score: 52.373 bits (124), Expect = 1.095e-8
Identity = 23/63 (36.51%), Postives = 31/63 (49.21%), Query Frame = -2
Query: 1453 SLFHLPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQFSLFRLPQFSLFHLPQFSLSHFPQ 1641
             L  +PQ  L+  PQ  L  +PQ  L  +PQ  +   PQ  L  +PQ  L  +PQ  L+  PQ
Sbjct:   29 CLASIPQTCLTSIPQTCLTSIPQTCLASIPQTCVKSIPQTCLTSIPQTCLASIPQTCLTFIPQ 91          
BLAST of SMED30033015 vs. Ensembl Medaka
Match: ripor2 (RHO family interacting cell polarization regulator 2 [Source:NCBI gene;Acc:101162143])

HSP 1 Score: 57.3806 bits (137), Expect = 2.940e-8
Identity = 43/178 (24.16%), Postives = 78/178 (43.82%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW------NAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKL 1052
            Y   ++ +   E +LE   G+   ++  L    ++   DQYE+ +R     ++K + +IE    Q WD       P++ D I IK +ELK L  + +L+   +    E+  + P +  + +  +GTIKL + V W      +  L   NL         V V S+ +  +  + +N  
Sbjct:  216 YKEYTENMSTFEVELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYG-RQRWKLKGRIEVNSRQSWDGDEMIFMPLISDLINIKVTELKGL-ATHMLVGSVICETKELFTAMPQVVAVDVNDLGTIKLNLEVTWYPFDVEDLTLSSGNLSKATALQRRVSVYSQGTPETPTFQDNSF 391          
BLAST of SMED30033015 vs. Ensembl Medaka
Match: ripor2 (RHO family interacting cell polarization regulator 2 [Source:NCBI gene;Acc:101162143])

HSP 1 Score: 57.3806 bits (137), Expect = 3.613e-8
Identity = 36/135 (26.67%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +   E +LE   G+   ++  L    ++   DQYE+ +R     ++K + +IE    Q WD       P++ D I IK +ELK L  + +L+   +    E+  + P +  + +  +GTIKL + V W
Sbjct:  181 YKEYTENMSTFEVELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYG-RQRWKLKGRIEVNSRQSWDGDEMIFMPLISDLINIKVTELKGL-ATHMLVGSVICETKELFTAMPQVVAVDVNDLGTIKLNLEVTW 313          
BLAST of SMED30033015 vs. Ensembl Medaka
Match: ripor2 (RHO family interacting cell polarization regulator 2 [Source:NCBI gene;Acc:101162143])

HSP 1 Score: 57.3806 bits (137), Expect = 3.878e-8
Identity = 43/178 (24.16%), Postives = 78/178 (43.82%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW------NAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKL 1052
            Y   ++ +   E +LE   G+   ++  L    ++   DQYE+ +R     ++K + +IE    Q WD       P++ D I IK +ELK L  + +L+   +    E+  + P +  + +  +GTIKL + V W      +  L   NL         V V S+ +  +  + +N  
Sbjct:  216 YKEYTENMSTFEVELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYG-RQRWKLKGRIEVNSRQSWDGDEMIFMPLISDLINIKVTELKGL-ATHMLVGSVICETKELFTAMPQVVAVDVNDLGTIKLNLEVTWYPFDVEDLTLSSGNLSKATALQRRVSVYSQGTPETPTFQDNSF 391          
BLAST of SMED30033015 vs. Ensembl Medaka
Match: ripor2 (RHO family interacting cell polarization regulator 2 [Source:NCBI gene;Acc:101162143])

HSP 1 Score: 56.9954 bits (136), Expect = 3.930e-8
Identity = 36/135 (26.67%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  537 YWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQW 941
            Y   ++ +   E +LE   G+   ++  L    ++   DQYE+ +R     ++K + +IE    Q WD       P++ D I IK +ELK L  + +L+   +    E+  + P +  + +  +GTIKL + V W
Sbjct:  208 YKEYTENMSTFEVELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYG-RQRWKLKGRIEVNSRQSWDGDEMIFMPLISDLINIKVTELKGL-ATHMLVGSVICETKELFTAMPQVVAVDVNDLGTIKLNLEVTW 340          
BLAST of SMED30033015 vs. Ensembl Medaka
Match: ripor1 (RHO family interacting cell polarization regulator 1 [Source:NCBI gene;Acc:101166201])

HSP 1 Score: 56.225 bits (134), Expect = 6.782e-8
Identity = 33/143 (23.08%), Postives = 74/143 (51.75%), Query Frame = 3
Query:  522 EESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAI 950
            E ++ Y   ++ + ++E++LE   G+   ++  L    ++ + DQYE+ ++     ++K R ++E    Q+WD       P++ +++ +K +ELK L  + V++      + ++    P +  + +  +GTIKL + V WN  
Sbjct:  191 EANKSYKEYTERMCVLENELESQLGEFHIRMKGLAGFARLCTGDQYEVLLKYG-RQRWKLRGQMEMNDKQVWDGEKMLFVPLIGEFLSVKVTELKSL-ANHVVVGNVSCDMKDLFAPLPQMVAVDINDLGTIKLSLEVNWNPF 331          
BLAST of SMED30033015 vs. Planmine SMEST
Match: SMESG000049533.1 (SMESG000049533.1)

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 449/467 (96.15%), Postives = 450/467 (96.36%), Query Frame = 3
Query:   30 MNRLSVMVESSDYLKSQNDSETRKPHSGSLSDLTQKSIGREDXXXXXXXXXXXXXXXVEGSWSNGSISTSHFPRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDDRMMLVQTLKADYLKLLEMKKEEYDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKLSINIENLFRSSRTENNIHSISNILEDVDEEKKSKEAFQNIPTEIKLCEESAQKTDNDVENINKDLNIDIVPENLSNVQINVSNETTNLSAEKLELNSTIVLLRKEKIDLSFHNEDSPNEKIVESIS 1430
            MNRLSVMVESSDYLKSQNDSETRKPHSGSLSDLTQKSIGREDSIISKSSLSLFFKKSVEGSWSNGSISTSHFPRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDDRMMLVQTLKADYLKLLEMKKEEYDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSH                 +RTENNIHSISNILEDVDEEKKSKEAFQNIPTEIKLCEESAQKTDNDVENINKDLNIDIVPENLSNVQINVSNETTNLSAEKLELNSTIVLLRKEKIDLSFHNEDSPNEKIVESIS
Sbjct:    1 MNRLSVMVESSDYLKSQNDSETRKPHSGSLSDLTQKSIGREDSIISKSSLSLFFKKSVEGSWSNGSISTSHFPRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDDRMMLVQTLKADYLKLLEMKKEEYDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSH-----------------NRTENNIHSISNILEDVDEEKKSKEAFQNIPTEIKLCEESAQKTDNDVENINKDLNIDIVPENLSNVQINVSNETTNLSAEKLELNSTIVLLRKEKIDLSFHNEDSPNEKIVESIS 450          
BLAST of SMED30033015 vs. Planmine SMEST
Match: SMESG000049533.1 (SMESG000049533.1)

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 443/461 (96.10%), Postives = 444/461 (96.31%), Query Frame = 3
Query:   48 MVESSDYLKSQNDSETRKPHSGSLSDLTQKSIGREDXXXXXXXXXXXXXXXVEGSWSNGSISTSHFPRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDDRMMLVQTLKADYLKLLEMKKEEYDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKLSINIENLFRSSRTENNIHSISNILEDVDEEKKSKEAFQNIPTEIKLCEESAQKTDNDVENINKDLNIDIVPENLSNVQINVSNETTNLSAEKLELNSTIVLLRKEKIDLSFHNEDSPNEKIVESIS 1430
            MVESSDYLKSQNDSETRKPHSGSLSDLTQKSIGREDSIISKSSLSLFFKKSVEGSWSNGSISTSHFPRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDDRMMLVQTLKADYLKLLEMKKEEYDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSH                 +RTENNIHSISNILEDVDEEKKSKEAFQNIPTEIKLCEESAQKTDNDVENINKDLNIDIVPENLSNVQINVSNETTNLSAEKLELNSTIVLLRKEKIDLSFHNEDSPNEKIVESIS
Sbjct:    1 MVESSDYLKSQNDSETRKPHSGSLSDLTQKSIGREDSIISKSSLSLFFKKSVEGSWSNGSISTSHFPRPDKALVLFDKVLSGLNEMFEKYSQLTTEDGIEHQDYNEICTKIDDRMMLVQTLKADYLKLLEMKKEEYDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKLQFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNFEIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLTPVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSH-----------------NRTENNIHSISNILEDVDEEKKSKEAFQNIPTEIKLCEESAQKTDNDVENINKDLNIDIVPENLSNVQINVSNETTNLSAEKLELNSTIVLLRKEKIDLSFHNEDSPNEKIVESIS 444          
The following BLAST results are available for this feature:
BLAST of SMED30033015 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIPOR15.143e-926.81RHO family interacting cell polarization regulator... [more]
RIPOR15.183e-926.81RHO family interacting cell polarization regulator... [more]
RIPOR15.663e-926.81RHO family interacting cell polarization regulator... [more]
RIPOR15.670e-926.81RHO family interacting cell polarization regulator... [more]
RIPOR15.767e-926.81RHO family interacting cell polarization regulator... [more]
back to top
BLAST of SMED30033015 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y37A1A.47.162e-627.91pep chromosome:WBcel235:IV:13943672:13964001:1 gen... [more]
Y37A1A.47.679e-627.91pep chromosome:WBcel235:IV:13938730:13964001:1 gen... [more]
Y37A1A.48.077e-627.91pep chromosome:WBcel235:IV:13938468:13964001:1 gen... [more]
Y37A1A.48.187e-627.91pep chromosome:WBcel235:IV:13936475:13964001:1 gen... [more]
Y37A1A.48.440e-627.91pep chromosome:WBcel235:IV:13952715:13964001:1 gen... [more]
back to top
BLAST of SMED30033015 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033015 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripor19.837e-1024.73RHO family interacting cell polarization regulator... [more]
ripor19.837e-1024.73RHO family interacting cell polarization regulator... [more]
ripor11.124e-924.73RHO family interacting cell polarization regulator... [more]
ripor11.273e-924.73RHO family interacting cell polarization regulator... [more]
ripor11.680e-928.15RHO family interacting cell polarization regulator... [more]
back to top
BLAST of SMED30033015 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIPOR11.606e-1024.73RHO family interacting cell polarization regulator... [more]
RIPOR12.969e-1026.21RHO family interacting cell polarization regulator... [more]
RIPOR13.502e-1026.21RHO family interacting cell polarization regulator... [more]
RIPOR13.731e-1026.21RHO family interacting cell polarization regulator... [more]
RIPOR13.957e-1026.21RHO family interacting cell polarization regulator... [more]
back to top
BLAST of SMED30033015 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ripor24.427e-926.67RHO family interacting cell polarization regulator... [more]
Ripor24.520e-926.67RHO family interacting cell polarization regulator... [more]
Ripor25.552e-926.67RHO family interacting cell polarization regulator... [more]
Ripor26.878e-926.67RHO family interacting cell polarization regulator... [more]
Ripor28.082e-926.67RHO family interacting cell polarization regulator... [more]
back to top
BLAST of SMED30033015 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZS17|RIPR1_HUMAN2.470e-826.81Rho family-interacting cell polarization regulator... [more]
sp|Q3B7M3|RIPR2_BOVIN2.585e-828.06Rho family-interacting cell polarization regulator... [more]
sp|Q5EB20|RIPR3_DANRE4.669e-827.63RIPOR family member 3 OS=Danio rerio OX=7955 GN=ri... [more]
sp|Q80U16|RIPR2_MOUSE5.653e-826.67Rho family-interacting cell polarization regulator... [more]
sp|Q1LU99|RIPR2_DANRE9.321e-827.41Rho family-interacting cell polarization regulator... [more]
back to top
BLAST of SMED30033015 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5RR593.421e-1525.93Protein kinase pkn/prk1 effector (Fragment) OS=Ixo... [more]
A0A131XAL11.238e-1426.48Protein kinase pkn/prk1 effector (Fragment) OS=Hya... [more]
A0A1E1X4S23.372e-1426.88Protein kinase pkn/prk1 effector OS=Amblyomma aure... [more]
A0A131YWN35.554e-1425.69Protein kinase pkn/prk1 effector OS=Rhipicephalus ... [more]
A0A224YNG85.956e-1425.69Protein kinase pkn/prk1 effector OS=Rhipicephalus ... [more]
back to top
BLAST of SMED30033015 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripor35.612e-1027.69RIPOR family member 3 [Source:NCBI gene;Acc:503535... [more]
ripor12.946e-926.28RHO family interacting cell polarization regulator... [more]
ripor13.087e-926.28RHO family interacting cell polarization regulator... [more]
ripor21.910e-827.41RHO family interacting cell polarization regulator... [more]
ripor21.920e-827.41RHO family interacting cell polarization regulator... [more]
back to top
BLAST of SMED30033015 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033015 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033015 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO423561.852e-928.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263232.398e-936.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30033015 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripor22.940e-824.16RHO family interacting cell polarization regulator... [more]
ripor23.613e-826.67RHO family interacting cell polarization regulator... [more]
ripor23.878e-824.16RHO family interacting cell polarization regulator... [more]
ripor23.930e-826.67RHO family interacting cell polarization regulator... [more]
ripor16.782e-823.08RHO family interacting cell polarization regulator... [more]
back to top
BLAST of SMED30033015 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049533.10.000e+096.15SMESG000049533.1[more]
SMESG000049533.10.000e+096.10SMESG000049533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033015 ID=SMED30033015|Name=SMED30033015|organism=Schmidtea mediterranea sexual|type=transcript|length=1645bp
TATATAAATCTTATATGATAAATTTAATCATGAACAGATTATCTGTAATG
GTAGAGTCAAGTGATTATTTAAAAAGTCAAAATGACTCGGAAACTAGAAA
ACCCCATTCCGGCTCTCTCAGTGATTTAACTCAAAAATCCATTGGTCGAG
AAGACAGCATTATTAGCAAAAGTTCACTGTCATTATTTTTCAAGAAATCA
GTCGAAGGATCTTGGTCAAATGGTTCGATATCCACAAGTCACTTTCCACG
GCCCGATAAGGCCTTAGTTCTGTTTGATAAAGTATTATCGGGTTTAAACG
AAATGTTCGAGAAATATTCACAACTGACAACTGAGGACGGGATTGAGCAT
CAGGATTACAATGAGATTTGCACTAAAATCGATGACCGGATGATGCTGGT
ACAAACACTCAAGGCTGATTATTTGAAATTATTAGAAATGAAAAAAGAGG
AGTATGATAAAATTCAATCGAATCTTGGATCCATTCTCAAAAATAAAAAC
AGCAAAGTAAACATAGATTTGGAAGAAAGTGAACCATACTGGACTATTTC
TAAAGAATTATTCATAATTGAATCCAAATTGGAAAAATGTACTGGAAAAT
TACAGTTCCAGATCATGGATCTGGATTCGGTGGGGAAAATAAATTCATTG
GATCAGTATGAATTATCAATCAGACTAAATGATACGACAAAATTCAAATC
GAGAATAAAAATAGAGAAAACTGGCCATCAATTGTGGGATATGAGAAATT
TCGAAATCTATCCCATTGTCGATGACTACATTTATATCAAGTTTTCCGAA
TTGAAACCTCTCAACAAGTCATCCGTTCTCATAGAAAAGAAGTTACCATT
CGTAAATGAAATGATTCGATCAAGTCCCAGTATTTTTACAATGTGGCTTA
CACCTGTGGGAACAATAAAACTGAAAGTTATCGTGCAATGGAATGCAATT
CTCGACAAGTCAAATTTGCATTCACAATTGATCAGCAGTGAGGAAGTTCC
GGTTCGTAGTAGAGCCTCATCAACATCACACAAGTATGGAAATAATAAAT
TATCCATAAACATTGAGAATTTGTTCCGTTCTAGTCGAACTGAGAATAAC
ATTCATTCCATTTCTAACATTCTTGAAGATGTCGATGAAGAGAAAAAGTC
CAAAGAAGCATTCCAAAACATACCGACTGAAATTAAGTTGTGTGAGGAAT
CCGCACAGAAAACAGACAATGATGTTGAGAACATAAACAAAGACCTAAAT
ATAGATATTGTTCCAGAGAATCTCTCTAATGTGCAAATCAATGTTAGTAA
TGAAACAACAAATCTTTCCGCTGAGAAGCTAGAACTAAATTCAACTATAG
TTTTATTGAGAAAAGAAAAAATCGATTTATCATTTCATAATGAAGATTCA
CCAAATGAAAAAATAGTAGAAAGTATTAGTGAGGAAGACGAAAAAGAGAA
AACTGAGGAAAATGGGAAAGAGAAAACTGAGGAAGATGAAAAAGAGAAAA
CTGAGGAAGACGAAAAAGAGAAAACTGAGGAAAATGGGAAAGAGAAAACT
GAGGAAGATGAAAAAGAGAAAACTGAGGAAGACGAAAAAGAGAAAACTGA
GGAAAATGGGAAAGAGAAAACTGAGGAAGATGAAAAAGAGAAAAC
back to top

protein sequence of SMED30033015-orf-1

>SMED30033015-orf-1 ID=SMED30033015-orf-1|Name=SMED30033015-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=547bp
YKSYMINLIMNRLSVMVESSDYLKSQNDSETRKPHSGSLSDLTQKSIGRE
DSIISKSSLSLFFKKSVEGSWSNGSISTSHFPRPDKALVLFDKVLSGLNE
MFEKYSQLTTEDGIEHQDYNEICTKIDDRMMLVQTLKADYLKLLEMKKEE
YDKIQSNLGSILKNKNSKVNIDLEESEPYWTISKELFIIESKLEKCTGKL
QFQIMDLDSVGKINSLDQYELSIRLNDTTKFKSRIKIEKTGHQLWDMRNF
EIYPIVDDYIYIKFSELKPLNKSSVLIEKKLPFVNEMIRSSPSIFTMWLT
PVGTIKLKVIVQWNAILDKSNLHSQLISSEEVPVRSRASSTSHKYGNNKL
SINIENLFRSSRTENNIHSISNILEDVDEEKKSKEAFQNIPTEIKLCEES
AQKTDNDVENINKDLNIDIVPENLSNVQINVSNETTNLSAEKLELNSTIV
LLRKEKIDLSFHNEDSPNEKIVESISEEDEKEKTEENGKEKTEEDEKEKT
EEDEKEKTEENGKEKTEEDEKEKTEEDEKEKTEENGKEKTEEDEKEK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR031780FAM65_N
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation