Cytochrome b561

Overview
NameCytochrome b561
Smed IDSMED30032989
Length (bp)991
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome b561 (SMED30032989) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome b561 (SMED30032989) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome b561 (SMED30032989) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome b561 (SMED30032989) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032989

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032989h1SMcG0018399 dd_Smed_v4_4017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032989h1SMcG0018399 dd_Smed_v4_4017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30032989h1SMcG0018399 dd_Smed_v4_4017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032989h1SMcG0018399 dd_Smed_v6_4017_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome b561 vs. Ensembl Human
Match: CYB561 (cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571])

HSP 1 Score: 115.546 bits (288), Expect = 8.993e-30
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL +V MT  W+G+ + GG  W   L F+ HP+ M++G++F+ GNA+LVYRVFRN  K   K LH +L++ AL++  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   28 QLLGLTLVAMTGAWLGLYR-GGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 167          
BLAST of Cytochrome b561 vs. Ensembl Human
Match: CYB561 (cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571])

HSP 1 Score: 115.546 bits (288), Expect = 9.245e-30
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL +V MT  W+G+ + GG  W   L F+ HP+ M++G++F+ GNA+LVYRVFRN  K   K LH +L++ AL++  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   21 QLLGLTLVAMTGAWLGLYR-GGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 160          
BLAST of Cytochrome b561 vs. Ensembl Human
Match: CYB561 (cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571])

HSP 1 Score: 115.546 bits (288), Expect = 9.245e-30
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL +V MT  W+G+ + GG  W   L F+ HP+ M++G++F+ GNA+LVYRVFRN  K   K LH +L++ AL++  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   21 QLLGLTLVAMTGAWLGLYR-GGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 160          
BLAST of Cytochrome b561 vs. Ensembl Human
Match: CYB561 (cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571])

HSP 1 Score: 115.546 bits (288), Expect = 9.245e-30
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL +V MT  W+G+ + GG  W   L F+ HP+ M++G++F+ GNA+LVYRVFRN  K   K LH +L++ AL++  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   21 QLLGLTLVAMTGAWLGLYR-GGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 160          
BLAST of Cytochrome b561 vs. Ensembl Human
Match: CYB561 (cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571])

HSP 1 Score: 115.546 bits (288), Expect = 9.245e-30
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL +V MT  W+G+ + GG  W   L F+ HP+ M++G++F+ GNA+LVYRVFRN  K   K LH +L++ AL++  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   21 QLLGLTLVAMTGAWLGLYR-GGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 160          
BLAST of Cytochrome b561 vs. Ensembl Celegans
Match: F55H2.5 (Putative cytochrome b561 [Source:UniProtKB/Swiss-Prot;Acc:P34465])

HSP 1 Score: 124.79 bits (312), Expect = 1.633e-33
Identity = 70/165 (42.42%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  116 QNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEK--LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKP--------NMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHR 580
            Q++  F  ++ + ++ G   V++  +WM    E GF W E     F+YHP FMI+GMVF++G A+LVYRVFRN +K  +K LH IL+   L+   + LKAVFD HNL   P        N+ SLHSW+GL  VIL+  Q+++GFI++ FP +P  +R  ++P H+
Sbjct:   16 QSVKLFNIILVMSQVFGGLAVLLVTIWMSKF-ESGFAWNEDPDKEFNYHPTFMIMGMVFLFGEALLVYRVFRNERKKFSKTLHVILHSCVLVFMLMALKAVFDYHNLHKDPSGNPAPIVNLVSLHSWIGLSVVILYFAQYIVGFITYFFPGMPIPIRQLVMPFHQ 179          
BLAST of Cytochrome b561 vs. Ensembl Celegans
Match: F39G3.5 (pep chromosome:WBcel235:V:4722618:4724621:1 gene:WBGene00018210.1 transcript:F39G3.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39G3.5)

HSP 1 Score: 68.9366 bits (167), Expect = 2.376e-13
Identity = 49/173 (28.32%), Postives = 84/173 (48.55%), Query Frame = 2
Query:   98 SRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLV-----------FHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRS 583
            SRL   ++ N F  ++ I    G   + +   ++   + G   W  K+               H   MIL  ++  G A+L YR++R   KI +K LH  L+++A+ LG   L  +  S N     N  S+HSW+G+  + ++  Q+  GF+++L P  P   RA ++P+HR+
Sbjct:    5 SRLGNARSFNRFDIILSITHFVGFITICLNGYFLNTFKNG-LAWPSKVKNGDNKALGKRGDQLHAFLMILAFIYFQGEALLAYRLYRYDAKIISKLLHTALHIIAIGLGITALTVIIMSTNNAGWNNFTSVHSWIGICLLSVYLVQFSFGFLTYLCPCSPGKYRARLMPIHRA 176          
BLAST of Cytochrome b561 vs. Ensembl Celegans
Match: F39G3.5 (pep chromosome:WBcel235:V:4722620:4724621:1 gene:WBGene00018210.1 transcript:F39G3.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39G3.5)

HSP 1 Score: 68.9366 bits (167), Expect = 2.376e-13
Identity = 49/173 (28.32%), Postives = 84/173 (48.55%), Query Frame = 2
Query:   98 SRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLV-----------FHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRS 583
            SRL   ++ N F  ++ I    G   + +   ++   + G   W  K+               H   MIL  ++  G A+L YR++R   KI +K LH  L+++A+ LG   L  +  S N     N  S+HSW+G+  + ++  Q+  GF+++L P  P   RA ++P+HR+
Sbjct:    5 SRLGNARSFNRFDIILSITHFVGFITICLNGYFLNTFKNG-LAWPSKVKNGDNKALGKRGDQLHAFLMILAFIYFQGEALLAYRLYRYDAKIISKLLHTALHIIAIGLGITALTVIIMSTNNAGWNNFTSVHSWIGICLLSVYLVQFSFGFLTYLCPCSPGKYRARLMPIHRA 176          
BLAST of Cytochrome b561 vs. Ensembl Celegans
Match: F39G3.4 (pep chromosome:WBcel235:V:4724753:4726726:1 gene:WBGene00018209.1 transcript:F39G3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39G3.4)

HSP 1 Score: 49.2914 bits (116), Expect = 1.235e-6
Identity = 28/110 (25.45%), Postives = 62/110 (56.36%), Query Frame = 2
Query:  254 HPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRS 583
            H   M LG +++ G A+L YRV+R T    +  +H  L++ +++L    L ++  +       +  ++HS++G+  ++++  Q   GF ++LF   P+  ++ ++P+HR+
Sbjct:   61 HGFLMFLGFIYLQGEALLSYRVYRFTTNRVSILIHTFLHIASIVLAVGALFSIILTIKYTGASHFSNIHSYLGVCLLLVYSGQLSFGFCTYLFKCTPKDYQSRLMPVHRA 170          
BLAST of Cytochrome b561 vs. Ensembl Celegans
Match: F39G3.5 (pep chromosome:WBcel235:V:4722620:4724565:1 gene:WBGene00018210.1 transcript:F39G3.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39G3.5)

HSP 1 Score: 46.2098 bits (108), Expect = 5.063e-6
Identity = 38/137 (27.74%), Postives = 62/137 (45.26%), Query Frame = 2
Query:   98 SRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLV-----------FHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGL 475
            SRL   ++ N F  ++ I    G   + +   ++   + G   W  K+               H   MIL  ++  G A+L YR++R   KI +K LH  L+++A+ LG   L  +  S N     N  S+HSW+G+
Sbjct:    5 SRLGNARSFNRFDIILSITHFVGFITICLNGYFLNTFKNG-LAWPSKVKNGDNKALGKRGDQLHAFLMILAFIYFQGEALLAYRLYRYDAKIISKLLHTALHIIAIGLGITALTVIIMSTNNAGWNNFTSVHSWIGI 140          
BLAST of Cytochrome b561 vs. Ensembl Fly
Match: CG1275 (gene:FBgn0035321 transcript:FBtr0072906)

HSP 1 Score: 132.109 bits (331), Expect = 2.608e-36
Identity = 72/150 (48.00%), Postives = 102/150 (68.00%), Query Frame = 2
Query:  140 LIFICEICGLAVVIMTAVWMGVVQEGGFGWTEK--LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKP--NMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            L  + ++CGL ++++ A W+G    GG   T    + F++HP+FM +G +++YGN+IL+YR FR T+K   K  HA +++ A IL  + LK VFDSHNL N P  NMYSLHSW+GL AVI+F  Q+V GF++FL P L E  R A++PLH
Sbjct:   22 LYVLTQLCGLTMIVLVATWIGQ-HFGGLAGTSNPGVEFNWHPLFMTIGFIYLYGNSILIYRGFRTTRKKTLKLTHAGIHMGAFILTVIALKTVFDSHNLANPPIPNMYSLHSWLGLSAVIVFSLQYVAGFVAFLAPGLRENYRIAMMPLH 170          
BLAST of Cytochrome b561 vs. Ensembl Fly
Match: CG1275 (gene:FBgn0035321 transcript:FBtr0072908)

HSP 1 Score: 131.724 bits (330), Expect = 2.737e-36
Identity = 72/150 (48.00%), Postives = 102/150 (68.00%), Query Frame = 2
Query:  140 LIFICEICGLAVVIMTAVWMGVVQEGGFGWTEK--LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKP--NMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            L  + ++CGL ++++ A W+G    GG   T    + F++HP+FM +G +++YGN+IL+YR FR T+K   K  HA +++ A IL  + LK VFDSHNL N P  NMYSLHSW+GL AVI+F  Q+V GF++FL P L E  R A++PLH
Sbjct:   11 LYVLTQLCGLTMIVLVATWIGQ-HFGGLAGTSNPGVEFNWHPLFMTIGFIYLYGNSILIYRGFRTTRKKTLKLTHAGIHMGAFILTVIALKTVFDSHNLANPPIPNMYSLHSWLGLSAVIVFSLQYVAGFVAFLAPGLRENYRIAMMPLH 159          
BLAST of Cytochrome b561 vs. Ensembl Fly
Match: CG1275 (gene:FBgn0035321 transcript:FBtr0072907)

HSP 1 Score: 133.265 bits (334), Expect = 5.471e-36
Identity = 72/150 (48.00%), Postives = 102/150 (68.00%), Query Frame = 2
Query:  140 LIFICEICGLAVVIMTAVWMGVVQEGGFGWTEK--LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKP--NMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            L  + ++CGL ++++ A W+G    GG   T    + F++HP+FM +G +++YGN+IL+YR FR T+K   K  HA +++ A IL  + LK VFDSHNL N P  NMYSLHSW+GL AVI+F  Q+V GF++FL P L E  R A++PLH
Sbjct:  108 LYVLTQLCGLTMIVLVATWIGQ-HFGGLAGTSNPGVEFNWHPLFMTIGFIYLYGNSILIYRGFRTTRKKTLKLTHAGIHMGAFILTVIALKTVFDSHNLANPPIPNMYSLHSWLGLSAVIVFSLQYVAGFVAFLAPGLRENYRIAMMPLH 256          
BLAST of Cytochrome b561 vs. Ensembl Fly
Match: CG1275 (gene:FBgn0035321 transcript:FBtr0072905)

HSP 1 Score: 133.265 bits (334), Expect = 5.471e-36
Identity = 72/150 (48.00%), Postives = 102/150 (68.00%), Query Frame = 2
Query:  140 LIFICEICGLAVVIMTAVWMGVVQEGGFGWTEK--LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKP--NMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            L  + ++CGL ++++ A W+G    GG   T    + F++HP+FM +G +++YGN+IL+YR FR T+K   K  HA +++ A IL  + LK VFDSHNL N P  NMYSLHSW+GL AVI+F  Q+V GF++FL P L E  R A++PLH
Sbjct:  108 LYVLTQLCGLTMIVLVATWIGQ-HFGGLAGTSNPGVEFNWHPLFMTIGFIYLYGNSILIYRGFRTTRKKTLKLTHAGIHMGAFILTVIALKTVFDSHNLANPPIPNMYSLHSWLGLSAVIVFSLQYVAGFVAFLAPGLRENYRIAMMPLH 256          
BLAST of Cytochrome b561 vs. Ensembl Fly
Match: nemy (gene:FBgn0261673 transcript:FBtr0339742)

HSP 1 Score: 83.5741 bits (205), Expect = 9.483e-19
Identity = 51/130 (39.23%), Postives = 78/130 (60.00%), Query Frame = 2
Query:  212 EGGFGWTE--KLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPE----TLRAAILPLHRS 583
              GF W+E  K  F+ HP+ MI G V + G +IL+YR+ R  K+I  K +H   + +A+   ++G  +VF SH+  +K N YSLHSW+G   + +F  Q+V+GF SFL     E    + R+A++P+H S
Sbjct:    4 RDGFAWSESPKQQFNLHPILMIAGFVTLSGFSILIYRLCRCVKQIYVKLIHMFFHAVAIPCIALGFISVFASHDALHKVNFYSLHSWLGFVTMGMFVLQFVIGFFSFLVMLCCENKTYSCRSAMVPIHAS 133          
BLAST of Cytochrome b561 vs. Ensembl Zebrafish
Match: cyb561 (cytochrome b561 [Source:ZFIN;Acc:ZDB-GENE-070713-3])

HSP 1 Score: 115.546 bits (288), Expect = 5.268e-30
Identity = 70/142 (49.30%), Postives = 96/142 (67.61%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GLA V++T VWMG  + GG+ W      F+ HP+ M+LG+VF+YG+A+LVYRVFRN  K   K LHA+L+++AL++  VGL AVFD H+     +MYSLHSW G+   +LF  QW+LG   FLFP     L++  LPLH
Sbjct:   22 QVVGLACVVITGVWMGHYR-GGYAWDGSAQEFNVHPLCMVLGLVFLYGDAVLVYRVFRNESKRSVKILHALLHMMALVISIVGLVAVFDFHSSSKISHMYSLHSWCGMLTFVLFFLQWLLGLGFFLFPWASAQLKSWYLPLH 162          
BLAST of Cytochrome b561 vs. Ensembl Zebrafish
Match: cyb561a3a (cytochrome b561 family, member A3a [Source:NCBI gene;Acc:100002371])

HSP 1 Score: 102.449 bits (254), Expect = 3.813e-25
Identity = 66/158 (41.77%), Postives = 92/158 (58.23%), Query Frame = 2
Query:  113 VQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRN--TKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ + GF     +C I G+A V++   W   +   GF W      F++HPV M+ GM+ +YGNA +VYR+       K+  K LHA L LL+ I   +GL AVF+ HN+ +  N+YSLHSWVG+    LF  QWV+GF SFL P  P  +RA + P H
Sbjct:    1 MRGIVGFYITYLLCLILGIACVVLVVHW-NFMYRDGFAWDGSSKNFNWHPVLMVTGMLVLYGNAAVVYRIPLTWGHNKLPWKLLHAGLLLLSFIFSVIGLCAVFNFHNVHHTANLYSLHSWVGICTAALFTAQWVMGFTSFLLPCTPMAVRAFVKPTH 157          
BLAST of Cytochrome b561 vs. Ensembl Zebrafish
Match: cyb561a3a (cytochrome b561 family, member A3a [Source:NCBI gene;Acc:100002371])

HSP 1 Score: 102.449 bits (254), Expect = 3.813e-25
Identity = 66/158 (41.77%), Postives = 92/158 (58.23%), Query Frame = 2
Query:  113 VQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRN--TKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ + GF     +C I G+A V++   W   +   GF W      F++HPV M+ GM+ +YGNA +VYR+       K+  K LHA L LL+ I   +GL AVF+ HN+ +  N+YSLHSWVG+    LF  QWV+GF SFL P  P  +RA + P H
Sbjct:    1 MRGIVGFYITYLLCLILGIACVVLVVHW-NFMYRDGFAWDGSSKNFNWHPVLMVTGMLVLYGNAAVVYRIPLTWGHNKLPWKLLHAGLLLLSFIFSVIGLCAVFNFHNVHHTANLYSLHSWVGICTAALFTAQWVMGFTSFLLPCTPMAVRAFVKPTH 157          
BLAST of Cytochrome b561 vs. Ensembl Zebrafish
Match: cybrd1 (cytochrome b reductase 1 [Source:NCBI gene;Acc:552960])

HSP 1 Score: 101.679 bits (252), Expect = 8.676e-25
Identity = 66/160 (41.25%), Postives = 101/160 (63.12%), Query Frame = 2
Query:  110 VVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLV-FHYHPVFMILGMVFIYGNAILVYRV---FRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++++   FL    +  + G+  + +   W+   +EG  GW      F++HP+ M++G +F+ G AI+VYR+   +R +K++  K +HA L++LA IL  + + AVFD HN KN PNMYSLHSWVGL AV+L+  Q VLG   +L P  P  +RAA++PLH
Sbjct:    1 MMEDYPQFLLFFILASVVGIVSIAVALSWVLHYREG-LGWDGGAAEFNWHPLLMVIGFIFLQGIAIVVYRLPWTWRCSKQMM-KLIHAGLHILAFILAVISVVAVFDFHNAKNIPNMYSLHSWVGLAAVVLYPSQIVLGIAVYLIPVTPVRVRAALMPLH 158          
BLAST of Cytochrome b561 vs. Ensembl Zebrafish
Match: cyb561a3b (cytochrome b561 family, member A3b [Source:ZFIN;Acc:ZDB-GENE-091204-222])

HSP 1 Score: 96.6709 bits (239), Expect = 3.374e-23
Identity = 58/135 (42.96%), Postives = 79/135 (58.52%), Query Frame = 2
Query:  176 VIMTAVWMGVVQEGGFGWTEK-LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            VI   +W G    GGF W    L F++HPV M+  +V +YGNAI++YRV     + R K  HA L  +A++L  +G+ A FD H   N P++YSLHSW+G+  V+LF  QW  G  +FL P  P   R  + PLH
Sbjct:   19 VIFVWLWSGT-WRGGFAWDGSFLQFNWHPVLMVTSLVVLYGNAIVLYRVPLTWSRWRCKLSHAGLLSVAVVLSVLGVCAAFDFHRGNNIPHLYSLHSWIGISTVVLFTLQWFGGLCAFLLPWTPLAFRVFLKPLH 152          
BLAST of Cytochrome b561 vs. Ensembl Xenopus
Match: lama5 (laminin subunit alpha 5 [Source:Xenbase;Acc:XB-GENE-1007923])

HSP 1 Score: 112.079 bits (279), Expect = 1.263e-28
Identity = 68/159 (42.77%), Postives = 101/159 (63.52%), Query Frame = 2
Query:  107 SVVQNLNGFLP-LIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHR 580
            ++ QN+ GF+P L+   +I G+AV+ +T  W+   + GGF W+  L F+ HP+ M+LGMVF+ G A+LVYRVFR+  K   K LH +L+++AL++  VG+ AVF  H      +MYSLHSW G+    L+  QW++GF+ F  P +  T R+   PLH 
Sbjct:    4 ALSQNI-GFMPYLVAGSQILGIAVLAITGAWLSQYR-GGFSWSGPLQFNVHPLCMVLGMVFLCGEALLVYRVFRHETKRATKILHGVLHVMALVISLVGIIAVFQFHKANGYADMYSLHSWCGITTFSLYILQWIIGFLLFFVPGVAYTYRSRFKPLHE 160          
BLAST of Cytochrome b561 vs. Ensembl Xenopus
Match: cybrd1 (cytochrome b reductase 1 [Source:NCBI gene;Acc:548408])

HSP 1 Score: 98.9821 bits (245), Expect = 2.023e-23
Identity = 67/137 (48.91%), Postives = 87/137 (63.50%), Query Frame = 2
Query:  176 VIMTAVWMGVVQEGGFGWTEKLV-FHYHPVFMILGMVFIYGNAILVYRV--FRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            VI T VW+   +EG  GW      F++HPV +  G +FI G AI+VYR+    N  K+  K++HA L+L A +   V L AVFD HN KN PNMYSLHSW+GL  VIL+  Q VLG   +L P   +TLRAA++P+H
Sbjct:   22 VIFTLVWVLHWREG-LGWDGGAAEFNWHPVLVTSGFIFIQGIAIIVYRLPWTWNCSKLLMKFIHAGLHLTAFVFTIVALVAVFDFHNAKNIPNMYSLHSWIGLTVVILYALQLVLGVSIYLLPFARDTLRAALMPVH 157          
BLAST of Cytochrome b561 vs. Ensembl Mouse
Match: Cyb561 (cytochrome b-561 [Source:MGI Symbol;Acc:MGI:103253])

HSP 1 Score: 112.079 bits (279), Expect = 3.937e-29
Identity = 63/142 (44.37%), Postives = 90/142 (63.38%), Query Frame = 2
Query:  152 CEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
             ++ GL VV +T  W+G+ + GG  W   L F+ HP+ M++GM+F+ G+A+LVYRVFR   K   K LH +L++ A I+  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   57 SQLLGLTVVAVTGAWLGLYR-GGIAWESSLQFNVHPLCMVIGMIFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAVFDYHKKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 197          
BLAST of Cytochrome b561 vs. Ensembl Mouse
Match: Cyb561 (cytochrome b-561 [Source:MGI Symbol;Acc:MGI:103253])

HSP 1 Score: 112.464 bits (280), Expect = 8.083e-29
Identity = 63/141 (44.68%), Postives = 90/141 (63.83%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL VV +T  W+G+ + GG  W   L F+ HP+ M++GM+F+ G+A+LVYRVFR   K   K LH +L++ A I+  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   20 QLLGLTVVAVTGAWLGLYR-GGIAWESSLQFNVHPLCMVIGMIFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAVFDYHKKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 159          
BLAST of Cytochrome b561 vs. Ensembl Mouse
Match: Cyb561a3 (cytochrome b561 family, member A3 [Source:MGI Symbol;Acc:MGI:2686925])

HSP 1 Score: 99.7525 bits (247), Expect = 3.257e-24
Identity = 61/141 (43.26%), Postives = 78/141 (55.32%), Query Frame = 2
Query:  164 GLAVVIMTAVWMGVVQEGGFGWTEK-LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGS--VGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            G   ++ TA WM     GGF W    L+F++HPV M+ GMV +YG A LVYR+  +    R  W      L  L      VGL AVF  HN     ++YSLHSW+G+  V+LF CQW LGF  FL P   + LR+ + PLH
Sbjct:   17 GSMCILFTAYWMQY-WRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLH 156          
BLAST of Cytochrome b561 vs. Ensembl Mouse
Match: Cyb561a3 (cytochrome b561 family, member A3 [Source:MGI Symbol;Acc:MGI:2686925])

HSP 1 Score: 99.7525 bits (247), Expect = 3.257e-24
Identity = 61/141 (43.26%), Postives = 78/141 (55.32%), Query Frame = 2
Query:  164 GLAVVIMTAVWMGVVQEGGFGWTEK-LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGS--VGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            G   ++ TA WM     GGF W    L+F++HPV M+ GMV +YG A LVYR+  +    R  W      L  L      VGL AVF  HN     ++YSLHSW+G+  V+LF CQW LGF  FL P   + LR+ + PLH
Sbjct:   17 GSMCILFTAYWMQY-WRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLH 156          
BLAST of Cytochrome b561 vs. Ensembl Mouse
Match: Cyb561a3 (cytochrome b561 family, member A3 [Source:MGI Symbol;Acc:MGI:2686925])

HSP 1 Score: 99.7525 bits (247), Expect = 3.257e-24
Identity = 61/141 (43.26%), Postives = 78/141 (55.32%), Query Frame = 2
Query:  164 GLAVVIMTAVWMGVVQEGGFGWTEK-LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGS--VGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            G   ++ TA WM     GGF W    L+F++HPV M+ GMV +YG A LVYR+  +    R  W      L  L      VGL AVF  HN     ++YSLHSW+G+  V+LF CQW LGF  FL P   + LR+ + PLH
Sbjct:   17 GSMCILFTAYWMQY-WRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLH 156          
BLAST of Cytochrome b561 vs. UniProt/SwissProt
Match: sp|P34465|CY561_CAEEL (Putative cytochrome b561 OS=Caenorhabditis elegans OX=6239 GN=F55H2.5 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.077e-32
Identity = 70/165 (42.42%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  116 QNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEK--LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKP--------NMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHR 580
            Q++  F  ++ + ++ G   V++  +WM    E GF W E     F+YHP FMI+GMVF++G A+LVYRVFRN +K  +K LH IL+   L+   + LKAVFD HNL   P        N+ SLHSW+GL  VIL+  Q+++GFI++ FP +P  +R  ++P H+
Sbjct:   16 QSVKLFNIILVMSQVFGGLAVLLVTIWMSKF-ESGFAWNEDPDKEFNYHPTFMIMGMVFLFGEALLVYRVFRNERKKFSKTLHVILHSCVLVFMLMALKAVFDYHNLHKDPSGNPAPIVNLVSLHSWIGLSVVILYFAQYIVGFITYFFPGMPIPIRQLVMPFHQ 179          
BLAST of Cytochrome b561 vs. UniProt/SwissProt
Match: sp|P49447|CY561_HUMAN (Cytochrome b561 OS=Homo sapiens OX=9606 GN=CYB561 PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 4.440e-29
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL +V MT  W+G+ + GG  W   L F+ HP+ M++G++F+ GNA+LVYRVFRN  K   K LH +L++ AL++  VGL AVFD H  K   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   21 QLLGLTLVAMTGAWLGLYR-GGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 160          
BLAST of Cytochrome b561 vs. UniProt/SwissProt
Match: sp|Q95204|CY561_SHEEP (Cytochrome b561 OS=Ovis aries OX=9940 GN=CYB561 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.368e-28
Identity = 64/142 (45.07%), Postives = 90/142 (63.38%), Query Frame = 2
Query:  152 CEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
             ++ GL VV MT  W+G+ + GG  W   L F+ HP+ M++G+VF+ G+A+LVYRVFRN  K   K LH +L++ A ++  VGL AVF+ H  K   ++YSLHSW G+    LF  QW++GF  FLFP    +LR+   P H
Sbjct:   21 SQLLGLTVVAMTGAWLGMYR-GGIAWESALQFNVHPLCMVIGLVFLQGDALLVYRVFRNEAKRTTKVLHGLLHVFAFVIALVGLVAVFEHHRKKGYADLYSLHSWCGILVFALFFAQWLVGFSFFLFPGASFSLRSRYRPQH 161          
BLAST of Cytochrome b561 vs. UniProt/SwissProt
Match: sp|P10897|CY561_BOVIN (Cytochrome b561 OS=Bos taurus OX=9913 GN=CYB561 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.888e-28
Identity = 68/151 (45.03%), Postives = 94/151 (62.25%), Query Frame = 2
Query:  128 GFLPL-IFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            G LP  +   ++ GL VV MT  W+G+ + GG  W   L F+ HP+ MI+G+VF+ G+A+LVYRVFRN  K   K LH +L++ A ++  VGL AVF+ H  K   ++YSLHSW G+    LF  QW++GF  FLFP    +LR+   P H
Sbjct:   12 GALPYYVAFSQLLGLIVVAMTGAWLGMYR-GGIAWESALQFNVHPLCMIIGLVFLQGDALLVYRVFRNEAKRTTKVLHGLLHVFAFVIALVGLVAVFEHHRKKGYADLYSLHSWCGILVFALFFAQWLVGFSFFLFPGASFSLRSRYRPQH 161          
BLAST of Cytochrome b561 vs. UniProt/SwissProt
Match: sp|Q5RCZ2|CY561_PONAB (Cytochrome b561 OS=Pongo abelii OX=9601 GN=CYB561 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.858e-28
Identity = 62/141 (43.97%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ GL +V MT  W+G+ + GG  W   L F+ HP+ M++G++F+ G+A+LVYRVFRN  K   K LH +L++ AL++  VGL AVFD H  +   ++YSLHSW G+   +L+  QW++GF  FLFP    +LR+   P H
Sbjct:   21 QLLGLTLVAMTGAWLGLYR-GGIAWESDLQFNAHPLCMVIGLIFLQGDALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKEGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQH 160          
BLAST of Cytochrome b561 vs. TrEMBL
Match: Q9BPQ6 (Cytochrome b561 OS=Dugesia japonica OX=6161 GN=pcyt PE=2 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 5.626e-118
Identity = 214/246 (86.99%), Postives = 234/246 (95.12%), Query Frame = 2
Query:   68 MHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSXXXXXXXXXXXXXXXXXTEFNGSYDIANRSSTMLGNXXXXXXXXXXXXXXXXXXWSEYRRIEPGTEEERIILSD 805
            MHSYEAVDGISRLSVVQNLNGFLPLIFICE+CGLA+VIMTAVWMGV+Q+GGFGWT++LVF YHP+FMILGM+FIYGNAI+VYRVFRNTKKIRAKWLHA+LNLLALILGSVGLKAVFDSHN+K   NMYSLHSWVGLG VILFGCQWVLGFISFLFPKLPETLR+AI+PLHRSLGMIILGLA+AAAVMGITE+N + D +   STMLGNFIGII L+FVSIVLFLV+WSEYRRIEPGTEEERIIL+D
Sbjct:    1 MHSYEAVDGISRLSVVQNLNGFLPLIFICEVCGLAIVIMTAVWMGVLQDGGFGWTKELVFRYHPMFMILGMIFIYGNAIMVYRVFRNTKKIRAKWLHAVLNLLALILGSVGLKAVFDSHNMKGTANMYSLHSWVGLGCVILFGCQWVLGFISFLFPKLPETLRSAIMPLHRSLGMIILGLAVAAAVMGITEYNNN-DKSKSPSTMLGNFIGIISLIFVSIVLFLVIWSEYRRIEPGTEEERIILND 245          
BLAST of Cytochrome b561 vs. TrEMBL
Match: A0A0X3Q7L9 (Cytochrome b561 domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR155786 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 3.079e-49
Identity = 116/245 (47.35%), Postives = 169/245 (68.98%), Query Frame = 2
Query:   65 HMHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTE-KLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSXXXXXXXXXXXXXXXXXTE---FNGSYDIANRSSTMLGNXXXXXXXXXXXXXXXXXXWSEYRRIEPGTEEE 787
            ++ +Y+++D     +  Q  N F+PL+ + +I GL  VI++ VWMG+   GGF W++  +VF+YHPVFM+LG+VF +G+A+LVYRVFR   K+  K +HAIL LL+L+   VGLKA FDSHNL+  PN+YS+HSWVG+   +LF  QWV+G I+FL P +P  +RA++LPLH S+GMII   +I A + GITE   F+ SY   N  +  +GN +G+  ++F ++V++LV   EYRR EP + E 
Sbjct:   34 NLRAYDSLDQPPD-APEQRHNAFVPLVVVAQIAGLLAVILSIVWMGI-YAGGFDWSQPDIVFNYHPVFMVLGLVFCFGDAMLVYRVFRMFPKLPVKVVHAILMLLSLLFAVVGLKAAFDSHNLRGIPNLYSIHSWVGITVAVLFALQWVIGLITFLVPSVPMRVRASVLPLHTSMGMIIFTGSICACISGITEKNFFSKSYSALN-PAEQVGNALGVALVLFGALVIYLVSRYEYRRQEPPSAER 275          
BLAST of Cytochrome b561 vs. TrEMBL
Match: A0A0X3NVG9 (Cytochrome b ascorbate-dependent protein 3 OS=Schistocephalus solidus OX=70667 GN=CYAC3 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.036e-48
Identity = 116/245 (47.35%), Postives = 169/245 (68.98%), Query Frame = 2
Query:   65 HMHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTE-KLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSXXXXXXXXXXXXXXXXXTE---FNGSYDIANRSSTMLGNXXXXXXXXXXXXXXXXXXWSEYRRIEPGTEEE 787
            ++ +Y+++D     +  Q  N F+PL+ + +I GL  VI++ VWMG+   GGF W++  +VF+YHPVFM+LG+VF +G+A+LVYRVFR   K+  K +HAIL LL+L+   VGLKA FDSHNL+  PN+YS+HSWVG+   +LF  QWV+G I+FL P +P  +RA++LPLH S+GMII   +I A + GITE   F+ SY   N  +  +GN +G+  ++F ++V++LV   EYRR EP + E 
Sbjct:   68 NLRAYDSLDQPPD-APEQRHNAFVPLVVVAQIAGLLAVILSIVWMGI-YAGGFDWSQPDIVFNYHPVFMVLGLVFCFGDAMLVYRVFRMFPKLPVKVVHAILMLLSLLFAVVGLKAAFDSHNLRGIPNLYSIHSWVGITVAVLFALQWVIGLITFLVPSVPMRVRASVLPLHTSMGMIIFTGSICACISGITEKNFFSKSYSALN-PAEQVGNALGVALVLFGALVIYLVSRYEYRRQEPPSAER 309          
BLAST of Cytochrome b561 vs. TrEMBL
Match: A0A5K3F591 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.476e-47
Identity = 115/247 (46.56%), Postives = 161/247 (65.18%), Query Frame = 2
Query:   62 IHMHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEK-LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSXXXXXXXXXXXXXXXXXTE---FNGSYDIANRSSTMLGNXXXXXXXXXXXXXXXXXXWSEYRRIEPGTEEER 790
            +++ +Y+++D              +PLI I +I GLA V+   +WMG   +G F W +   VF+YHPVFM+LG++F +G+A+L+YRVFR   K+  K +HA+L LL+L+   VGLK+ FDSHNL+  PNMYSLHSW+GL  +ILF  QWV+G ++FL P +P  LRA ILPLH S+G+ +   AIAA + GITE   F G Y     +S ML NF+GI  +VF  I+ ++V   +YRR+EP    ER
Sbjct:    1 MNLRAYDSLDQPPDSEETSKTKAIIPLIVIAQIFGLAAVVTCIIWMGYYNDG-FDWADSACVFNYHPVFMVLGLIFCFGDAMLIYRVFRFLPKLPLKAVHAVLMLLSLLFSVVGLKSAFDSHNLRAIPNMYSLHSWIGLVTIILFSLQWVIGLVTFLVPSIPLRLRATILPLHTSMGLFLFCCAIAACISGITEKNFFGGEYSNLPIAS-MLSNFMGIFIVVFGGIIFYIVHRHDYRRLEPQRANER 245          
BLAST of Cytochrome b561 vs. TrEMBL
Match: A0A183SNR2 (Cytochrome b561 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS5860 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.512e-45
Identity = 109/215 (50.70%), Postives = 152/215 (70.70%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTE-KLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSXXXXXXXXXXXXXXXXXTE---FNGSYDIANRSSTMLGNXXXXXXXXXXXXXXXXXXWSEYRRIEPGTEEE 787
            +I GL  VI++ VWMG+   GGF W++  +VF+YHPVFM+LG+VF +G+A+LVYRVFR   K+  K +HAIL LL+L+   VGLKA FDSHNL+  PN+YS+HSWVG+   +LF  QWV+G I+FL P +P  +RA++LPLH S+GMII   +I A + GITE   F+ SY   N +   +GN +G+  ++F ++V++LV   EYRR EP + E 
Sbjct:   12 QIAGLLAVILSIVWMGI-YAGGFDWSQPDIVFNYHPVFMVLGLVFCFGDAMLVYRVFRMFPKLPVKVVHAILMLLSLLFAVVGLKAAFDSHNLRGIPNLYSIHSWVGITVAVLFALQWVIGLITFLVPSVPMRVRASVLPLHTSMGMIIFTGSICACISGITEKNFFSKSYSALNPTEQ-VGNALGVALVLFGALVIYLVSRYEYRRQEPPSAER 224          
BLAST of Cytochrome b561 vs. Ensembl Cavefish
Match: cyb561 (cytochrome b561 [Source:NCBI gene;Acc:103030455])

HSP 1 Score: 111.309 bits (277), Expect = 1.639e-28
Identity = 72/142 (50.70%), Postives = 96/142 (67.61%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            ++ G+A V++T VWMG    GG+ W      F+ HP+ M+LGMVF+YG+ +LVYRVFRN  K   K LHA+++++AL++  VGL AVFD HN  N PNMYSLHSW G+   +L+  QW+LG   FLFP     LR+  LPLH
Sbjct:   21 QVLGVACVVITGVWMGHFY-GGYAWNGSGQQFNVHPLCMVLGMVFLYGDGVLVYRVFRNESKRSVKILHALIHMMALVISIVGLVAVFDYHNKANIPNMYSLHSWCGMLTFVLYFLQWLLGLGLFLFPWASTVLRSWYLPLH 161          
BLAST of Cytochrome b561 vs. Ensembl Cavefish
Match: cybrd1 (cytochrome b reductase 1 [Source:NCBI gene;Acc:103030267])

HSP 1 Score: 98.9821 bits (245), Expect = 9.234e-24
Identity = 68/141 (48.23%), Postives = 90/141 (63.83%), Query Frame = 2
Query:  164 GLAVVIMTAVWMGVVQEGGFGWTEKLV-FHYHPVFMILGMVFIYGNAILVYRVFRNTK--KIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            G   V+    W+   +EG  GW      F++HP+ +I+G +F+ G AI+VYR+    K  K+  K++HA LN+LA IL ++ L AVFD HN +N PNMYSLHSWVGL AVIL+  Q VLG   +L P  P  LRAA +PLH
Sbjct:   21 GFVSVVFVLRWVLHFREG-LGWDGGAAEFNWHPLLIIIGFIFLQGIAIVVYRLPWTWKCSKLMMKFIHAGLNVLAFILAAISLVAVFDFHNTQNIPNMYSLHSWVGLTAVILYSLQIVLGIAIYLLPVSPVPLRAAFMPLH 160          
BLAST of Cytochrome b561 vs. Ensembl Cavefish
Match: cybrd1 (cytochrome b reductase 1 [Source:NCBI gene;Acc:103030267])

HSP 1 Score: 99.3673 bits (246), Expect = 9.696e-24
Identity = 68/141 (48.23%), Postives = 90/141 (63.83%), Query Frame = 2
Query:  164 GLAVVIMTAVWMGVVQEGGFGWTEKLV-FHYHPVFMILGMVFIYGNAILVYRVFRNTK--KIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            G   V+    W+   +EG  GW      F++HP+ +I+G +F+ G AI+VYR+    K  K+  K++HA LN+LA IL ++ L AVFD HN +N PNMYSLHSWVGL AVIL+  Q VLG   +L P  P  LRAA +PLH
Sbjct:   21 GFVSVVFVLRWVLHFREG-LGWDGGAAEFNWHPLLIIIGFIFLQGIAIVVYRLPWTWKCSKLMMKFIHAGLNVLAFILAAISLVAVFDFHNTQNIPNMYSLHSWVGLTAVILYSLQIVLGIAIYLLPVSPVPLRAAFMPLH 160          
BLAST of Cytochrome b561 vs. Ensembl Cavefish
Match: cyb561a3a (cytochrome b ascorbate-dependent protein 3 [Source:NCBI gene;Acc:103029030])

HSP 1 Score: 89.3521 bits (220), Expect = 1.793e-20
Identity = 59/125 (47.20%), Postives = 73/125 (58.40%), Query Frame = 2
Query:  212 EGGFGWTEKL-VFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXX--GSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
             GGF W  K   F++HPV M+LG+V +YGNA +VYR+     + +  W      LL L L    VGL AVFD HN  N PN+YSLHSWVG+   +LF  QW  GF +FL P  P  LR  + P H
Sbjct:   33 RGGFAWDHKAKQFNWHPVLMVLGLVVLYGNAAVVYRIPLTWGQNKLPWKLLHAGLLLLSLIFAVVGLCAVFDFHNAGNTPNLYSLHSWVGITTTVLFAMQWAAGFGAFLLPCSPMALRVFVKPAH 157          
BLAST of Cytochrome b561 vs. Ensembl Sea Lamprey
Match: cyb561 (cytochrome b561 [Source:ZFIN;Acc:ZDB-GENE-070713-3])

HSP 1 Score: 104.76 bits (260), Expect = 1.029e-27
Identity = 63/117 (53.85%), Postives = 81/117 (69.23%), Query Frame = 2
Query:  155 EICGLAVVIMTAVWMGVVQEGGFGWTEK-LVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQ 502
            ++ GLA VI+  VWMG  + GGF W    L F+ HP+ M++GMVF+YG+AILVYRVFR   K   K +HA L++ ALI   +GL AVFD HN  N PN+YSLHSW+G+  +ILF  Q
Sbjct:   21 QLLGLAAVIVVGVWMGHYR-GGFSWDHGVLEFNIHPLCMVIGMVFLYGDAILVYRVFREEDKKCIKIIHATLHMCALISSVIGLVAVFDFHNSLNIPNLYSLHSWLGIITIILFAMQ 136          
BLAST of Cytochrome b561 vs. Ensembl Sea Lamprey
Match: cybrd1 (cytochrome b reductase 1 [Source:NCBI gene;Acc:552960])

HSP 1 Score: 91.2781 bits (225), Expect = 1.026e-21
Identity = 66/147 (44.90%), Postives = 86/147 (58.50%), Query Frame = 2
Query:  158 ICGLAVVIMTAVWM-----GVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRV--FRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            + GL  V + A W      GV  +GG        F++HP+ MILG V + G A+++YR+     + K+  K +HA L   + +L  V L AVFD HN KN PNMYSLHSWVGL AV+LF  QW LG   FL+P  P +LRA   P+H
Sbjct:   19 VLGLLAVALVAAWQWGWRGGVAWDGG-----ARHFNWHPLLMILGPVVLNGLAMVLYRIPWTLGSSKMLLKCIHAGLQTFSFLLVVVALVAVFDFHNFKNIPNMYSLHSWVGLTAVLLFCMQWALGLAIFLYPGSPASLRAFSKPIH 160          
BLAST of Cytochrome b561 vs. Ensembl Nematostella
Match: EDO43587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY72])

HSP 1 Score: 130.183 bits (326), Expect = 4.987e-36
Identity = 69/147 (46.94%), Postives = 98/147 (66.67%), Query Frame = 2
Query:  131 FLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAIL 568
            F+  + + ++ G+  +++T +WMG  + GGF W      F+YHPV M++G+V++Y  A++VYRVFRN  K   K +H  L L+A  +   GLKA FD HN +  PNMYSLHSW+GL  V+LF  Q V GF+SFL+PKLP+  RA+ L
Sbjct:   15 FIASVSLIQVLGIIAIVLTGIWMGKYR-GGFAWDGSGQQFNYHPVCMVIGLVYLYSEAMIVYRVFRNETKYTVKLVHFALQLVAFFVAVFGLKAAFDFHNKQGFPNMYSLHSWLGLCTVLLFTFQLVGGFVSFLYPKLPDAPRASYL 160          
BLAST of Cytochrome b561 vs. Ensembl Medaka
Match: cyb561 (cytochrome b561 [Source:NCBI gene;Acc:101173063])

HSP 1 Score: 119.398 bits (298), Expect = 2.818e-31
Identity = 71/150 (47.33%), Postives = 97/150 (64.67%), Query Frame = 2
Query:  131 FLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            F  L+ + ++ GL  V++T VWMG  + GGF W      F+ HP+ M+LG+V ++G+AILVYRVF N  K + K LH  ++LLAL+   VG+ AVFD H+    P++YSLHSW GL  +ILF  QWV+G + FL P     LRA  LP+H
Sbjct:   32 FAGLVGVSQVLGLLSVVLTGVWMGHYR-GGFAWDGSAREFNLHPLCMVLGLVLLHGDAILVYRVFSNEAKKKVKLLHGTIHLLALVTSIVGVAAVFDFHSASLIPHLYSLHSWGGLTTLILFSLQWVMGLLFFLLPGASSWLRATYLPIH 180          
BLAST of Cytochrome b561 vs. Ensembl Medaka
Match: cyb561a3a (cytochrome b ascorbate-dependent protein 3 [Source:NCBI gene;Acc:101164900])

HSP 1 Score: 105.531 bits (262), Expect = 3.129e-26
Identity = 67/141 (47.52%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  164 GLAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRN--TKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
             +A VI   VW   +  GGF W   +L F++HPV M+ G+V +YGN  ++YR+       K+  K LHA L LL+LIL  VGL AVF+ HN KN PN+YSLHSW+G+ A  LF  QWV GF  FL P  P ++R  + P+H
Sbjct:   18 SVACVICLCVW-NSLWRGGFAWDGSQLEFNWHPVLMVTGLVVLYGNGAVLYRIPLTWGYDKLPWKLLHAALMLLSLILSVVGLCAVFNYHNAKNIPNLYSLHSWIGIAAAALFAIQWVAGFAGFLLPWTPLSMRKLLKPVH 157          
BLAST of Cytochrome b561 vs. Ensembl Medaka
Match: cyb561a3a (cytochrome b ascorbate-dependent protein 3 [Source:NCBI gene;Acc:101164900])

HSP 1 Score: 104.76 bits (260), Expect = 5.985e-26
Identity = 67/140 (47.86%), Postives = 88/140 (62.86%), Query Frame = 2
Query:  167 LAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRN--TKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            +A VI   VW   +  GGF W   +L F++HPV M+ G+V +YGN  ++YR+       K+  K LHA L LL+LIL  VGL AVF+ HN KN PN+YSLHSW+G+ A  LF  QWV GF  FL P  P ++R  + P+H
Sbjct:   19 VACVICLCVW-NSLWRGGFAWDGSQLEFNWHPVLMVTGLVVLYGNGAVLYRIPLTWGYDKLPWKLLHAALMLLSLILSVVGLCAVFNYHNAKNIPNLYSLHSWIGIAAAALFAIQWVAGFAGFLLPWTPLSMRKLLKPVH 157          
BLAST of Cytochrome b561 vs. Ensembl Medaka
Match: cyb561a3a (cytochrome b ascorbate-dependent protein 3 [Source:NCBI gene;Acc:101164900])

HSP 1 Score: 105.916 bits (263), Expect = 6.988e-26
Identity = 67/140 (47.86%), Postives = 88/140 (62.86%), Query Frame = 2
Query:  167 LAVVIMTAVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRN--TKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            +A VI   VW   +  GGF W   +L F++HPV M+ G+V +YGN  ++YR+       K+  K LHA L LL+LIL  VGL AVF+ HN KN PN+YSLHSW+G+ A  LF  QWV GF  FL P  P ++R  + P+H
Sbjct:   67 VACVICLCVW-NSLWRGGFAWDGSQLEFNWHPVLMVTGLVVLYGNGAVLYRIPLTWGYDKLPWKLLHAALMLLSLILSVVGLCAVFNYHNAKNIPNLYSLHSWIGIAAAALFAIQWVAGFAGFLLPWTPLSMRKLLKPVH 205          
BLAST of Cytochrome b561 vs. Ensembl Medaka
Match: cyb561a3b (cytochrome b ascorbate-dependent protein 3-like [Source:NCBI gene;Acc:101172595])

HSP 1 Score: 91.2781 bits (225), Expect = 4.966e-21
Identity = 58/133 (43.61%), Postives = 76/133 (57.14%), Query Frame = 2
Query:  188 AVWMGVVQEGGFGWT-EKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLK--AVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLH 577
            + W GV Q GGF W    L F++HPVFM+ G+V +YG + +VYRV     + ++ W      L+ L L    L   AVFD H   + P++YSLHSWVGL  V LF  QWVLG   FL P  P   R+ + P+H
Sbjct:   40 SCWSGVWQ-GGFAWDGSDLQFNWHPVFMVSGLVVLYGISAVVYRVPSTWGQRKSTWKLVHGGLMLLALLLSVLGLYAVFDFHRAASIPHLYSLHSWVGLCTVGLFAFQWVLGLAGFLLPCSPLWFRSRLKPVH 171          
BLAST of Cytochrome b561 vs. Planmine SMEST
Match: SMESG000028998.1 (SMESG000028998.1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.714e-139
Identity = 246/246 (100.00%), Postives = 246/246 (100.00%), Query Frame = 2
Query:   68 MHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWXXXXXXXXXXXXGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSXXXXXXXXXXXXXXXXXTEFNGSYDIANRSSTMLGNXXXXXXXXXXXXXXXXXXWSEYRRIEPGTEEERIILSD 805
            MHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWLHAILNLLALILGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSLGMIILGLAIAAAVMGITEFNGSYDIANRSSTMLGNFIGIIGLVFVSIVLFLVVWSEYRRIEPGTEEERIILSD
Sbjct:    1 MHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEGGFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWLHAILNLLALILGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGFISFLFPKLPETLRAAILPLHRSLGMIILGLAIAAAVMGITEFNGSYDIANRSSTMLGNFIGIIGLVFVSIVLFLVVWSEYRRIEPGTEEERIILSD 246          
The following BLAST results are available for this feature:
BLAST of Cytochrome b561 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYB5618.993e-3045.39cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571][more]
CYB5619.245e-3045.39cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571][more]
CYB5619.245e-3045.39cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571][more]
CYB5619.245e-3045.39cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571][more]
CYB5619.245e-3045.39cytochrome b561 [Source:HGNC Symbol;Acc:HGNC:2571][more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F55H2.51.633e-3342.42Putative cytochrome b561 [Source:UniProtKB/Swiss-... [more]
F39G3.52.376e-1328.32pep chromosome:WBcel235:V:4722618:4724621:1 gene:W... [more]
F39G3.52.376e-1328.32pep chromosome:WBcel235:V:4722620:4724621:1 gene:W... [more]
F39G3.41.235e-625.45pep chromosome:WBcel235:V:4724753:4726726:1 gene:W... [more]
F39G3.55.063e-627.74pep chromosome:WBcel235:V:4722620:4724565:1 gene:W... [more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG12752.608e-3648.00gene:FBgn0035321 transcript:FBtr0072906[more]
CG12752.737e-3648.00gene:FBgn0035321 transcript:FBtr0072908[more]
CG12755.471e-3648.00gene:FBgn0035321 transcript:FBtr0072907[more]
CG12755.471e-3648.00gene:FBgn0035321 transcript:FBtr0072905[more]
nemy9.483e-1939.23gene:FBgn0261673 transcript:FBtr0339742[more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyb5615.268e-3049.30cytochrome b561 [Source:ZFIN;Acc:ZDB-GENE-070713-3... [more]
cyb561a3a3.813e-2541.77cytochrome b561 family, member A3a [Source:NCBI ge... [more]
cyb561a3a3.813e-2541.77cytochrome b561 family, member A3a [Source:NCBI ge... [more]
cybrd18.676e-2541.25cytochrome b reductase 1 [Source:NCBI gene;Acc:552... [more]
cyb561a3b3.374e-2342.96cytochrome b561 family, member A3b [Source:ZFIN;Ac... [more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lama51.263e-2842.77laminin subunit alpha 5 [Source:Xenbase;Acc:XB-GEN... [more]
cybrd12.023e-2348.91cytochrome b reductase 1 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyb5613.937e-2944.37cytochrome b-561 [Source:MGI Symbol;Acc:MGI:103253... [more]
Cyb5618.083e-2944.68cytochrome b-561 [Source:MGI Symbol;Acc:MGI:103253... [more]
Cyb561a33.257e-2443.26cytochrome b561 family, member A3 [Source:MGI Symb... [more]
Cyb561a33.257e-2443.26cytochrome b561 family, member A3 [Source:MGI Symb... [more]
Cyb561a33.257e-2443.26cytochrome b561 family, member A3 [Source:MGI Symb... [more]
back to top
BLAST of Cytochrome b561 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34465|CY561_CAEEL2.077e-3242.42Putative cytochrome b561 OS=Caenorhabditis elegans... [more]
sp|P49447|CY561_HUMAN4.440e-2945.39Cytochrome b561 OS=Homo sapiens OX=9606 GN=CYB561 ... [more]
sp|Q95204|CY561_SHEEP1.368e-2845.07Cytochrome b561 OS=Ovis aries OX=9940 GN=CYB561 PE... [more]
sp|P10897|CY561_BOVIN1.888e-2845.03Cytochrome b561 OS=Bos taurus OX=9913 GN=CYB561 PE... [more]
sp|Q5RCZ2|CY561_PONAB3.858e-2843.97Cytochrome b561 OS=Pongo abelii OX=9601 GN=CYB561 ... [more]
back to top
BLAST of Cytochrome b561 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9BPQ65.626e-11886.99Cytochrome b561 OS=Dugesia japonica OX=6161 GN=pcy... [more]
A0A0X3Q7L93.079e-4947.35Cytochrome b561 domain-containing protein (Fragmen... [more]
A0A0X3NVG91.036e-4847.35Cytochrome b ascorbate-dependent protein 3 OS=Schi... [more]
A0A5K3F5911.476e-4746.56Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183SNR22.512e-4550.70Cytochrome b561 domain-containing protein OS=Schis... [more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cyb5611.639e-2850.70cytochrome b561 [Source:NCBI gene;Acc:103030455][more]
cybrd19.234e-2448.23cytochrome b reductase 1 [Source:NCBI gene;Acc:103... [more]
cybrd19.696e-2448.23cytochrome b reductase 1 [Source:NCBI gene;Acc:103... [more]
cyb561a3a1.793e-2047.20cytochrome b ascorbate-dependent protein 3 [Source... [more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyb5611.029e-2753.85cytochrome b561 [Source:ZFIN;Acc:ZDB-GENE-070713-3... [more]
cybrd11.026e-2144.90cytochrome b reductase 1 [Source:NCBI gene;Acc:552... [more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome b561 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435874.987e-3646.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome b561 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyb5612.818e-3147.33cytochrome b561 [Source:NCBI gene;Acc:101173063][more]
cyb561a3a3.129e-2647.52cytochrome b ascorbate-dependent protein 3 [Source... [more]
cyb561a3a5.985e-2647.86cytochrome b ascorbate-dependent protein 3 [Source... [more]
cyb561a3a6.988e-2647.86cytochrome b ascorbate-dependent protein 3 [Source... [more]
cyb561a3b4.966e-2143.61cytochrome b ascorbate-dependent protein 3-like [S... [more]
back to top
BLAST of Cytochrome b561 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028998.11.714e-139100.00SMESG000028998.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032989 ID=SMED30032989|Name=Cytochrome b561|organism=Schmidtea mediterranea sexual|type=transcript|length=991bp
CCGATCTATTTGATTAGTTTACACTTTAAAATTCAAATTTAATACATATT
TTCATTGATTTATTCATATGCATTCCTATGAAGCGGTCGATGGAATCAGT
CGGCTTTCAGTAGTTCAAAATCTCAATGGATTTTTGCCATTAATATTCAT
ATGTGAAATTTGTGGGCTTGCTGTCGTCATTATGACTGCTGTGTGGATGG
GTGTCGTTCAAGAAGGGGGATTTGGTTGGACTGAGAAACTCGTTTTCCAT
TATCATCCTGTGTTCATGATATTGGGCATGGTTTTTATTTATGGCAATGC
AATTTTGGTATATAGAGTATTTAGAAATACGAAAAAGATTCGTGCTAAAT
GGTTGCATGCGATTTTGAATTTATTAGCTTTAATATTGGGATCAGTCGGA
CTTAAGGCGGTTTTTGATTCCCATAATTTAAAAAATAAACCAAACATGTA
TAGCCTTCATAGTTGGGTTGGACTTGGAGCTGTTATATTATTTGGATGTC
AGTGGGTTCTAGGATTTATTTCATTTCTTTTTCCTAAACTACCCGAAACA
TTGAGAGCTGCTATACTCCCATTACACAGAAGCCTTGGAATGATTATCCT
TGGATTAGCAATTGCCGCTGCTGTTATGGGCATCACGGAATTTAATGGAT
CGTATGATATAGCAAACCGATCATCAACTATGCTGGGAAATTTTATTGGG
ATAATAGGATTGGTGTTCGTTAGTATAGTATTGTTCCTAGTTGTATGGTC
CGAGTATCGAAGAATTGAGCCTGGCACCGAGGAAGAAAGGATTATTCTCA
GCGATTAATTAAAATGTTCGGATAAATTTCTATACTCTTGTAGATTGTCA
ATTGTAATGCGTTTTGTATTGTGTTTGGGTTCCATGACTTTATTTAATAT
TTCAATGATTTTCTTGTTTAACTTTATTTAATTTTATTGAAATTATTGTT
TGCGTCGTTTATTATTGTCTTGTCATATCATTGTAATAAAG
back to top

protein sequence of SMED30032989-orf-1

>SMED30032989-orf-1 ID=SMED30032989-orf-1|Name=SMED30032989-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MHSYEAVDGISRLSVVQNLNGFLPLIFICEICGLAVVIMTAVWMGVVQEG
GFGWTEKLVFHYHPVFMILGMVFIYGNAILVYRVFRNTKKIRAKWLHAIL
NLLALILGSVGLKAVFDSHNLKNKPNMYSLHSWVGLGAVILFGCQWVLGF
ISFLFPKLPETLRAAILPLHRSLGMIILGLAIAAAVMGITEFNGSYDIAN
RSSTMLGNFIGIIGLVFVSIVLFLVVWSEYRRIEPGTEEERIILSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005765lysosomal membrane
GO:0031902late endosome membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028836Cyt_b561-like
IPR043205CYB561/CYBRD1-like
IPR006593Cyt_b561/ferric_Rdtase_TM
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006593Cytochrome b561/ferric reductase transmembraneSMARTSM00665561_7coord: 62..189
e-value: 8.7E-56
score: 201.3
IPR006593Cytochrome b561/ferric reductase transmembranePFAMPF03188Cytochrom_B561coord: 62..191
e-value: 1.7E-45
score: 154.5
IPR006593Cytochrome b561/ferric reductase transmembranePROSITEPS50939CYTOCHROME_B561coord: 28..226
score: 44.656
NoneNo IPR availableGENE3DG3DSA:1.20.120.1770coord: 15..234
e-value: 2.6E-71
score: 241.4
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 93..112
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
IPR028836Cytochrome b561-likePANTHERPTHR10106:SF0CYTOCHROME B561-RELATEDcoord: 22..233
IPR043205Cytochrome b561/Cytochrome b reductase 1-likePANTHERPTHR10106CYTOCHROME B561-RELATEDcoord: 22..233