ras-related protein Rab-7L1

Overview
Nameras-related protein Rab-7L1
Smed IDSMED30032985
Length (bp)903
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ras-related protein Rab-7L1 (SMED30032985) t-SNE clustered cells

Violin plots show distribution of expression levels for ras-related protein Rab-7L1 (SMED30032985) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ras-related protein Rab-7L1 (SMED30032985) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ras-related protein Rab-7L1 (SMED30032985) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032985

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032985h1SMcG0000813 Contig2676GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032985h1SMcG0000813 Contig2784GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032985h1SMcG0017199 Contig2676GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30032985h1SMcG0000813 dd_Smed_v4_2915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032985h1SMcG0000813 dd_Smed_v4_2915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ras-related protein Rab-7L1 vs. Ensembl Human
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 201.06 bits (510), Expect = 8.801e-64
Identity = 86/172 (50.00%), Postives = 129/172 (75.00%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D++ ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK    +G+P+PC+LLANK D+    + +++I+   KENGF GW+E SVKEN  +  ++  LIE ++
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMM 174          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Human
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 201.06 bits (510), Expect = 8.801e-64
Identity = 86/172 (50.00%), Postives = 129/172 (75.00%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D++ ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK    +G+P+PC+LLANK D+    + +++I+   KENGF GW+E SVKEN  +  ++  LIE ++
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMM 174          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Human
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 201.06 bits (510), Expect = 8.801e-64
Identity = 86/172 (50.00%), Postives = 129/172 (75.00%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D++ ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK    +G+P+PC+LLANK D+    + +++I+   KENGF GW+E SVKEN  +  ++  LIE ++
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMM 174          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Human
Match: RAB32 (RAB32, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9772])

HSP 1 Score: 191.43 bits (485), Expect = 1.012e-59
Identity = 90/181 (49.72%), Postives = 125/181 (69.06%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI-KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIED 660
            + E LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD+S  ++F +VLKWK DLDSK    +G PIP +LLANK D  K+ +   ++++  CKE+GF GW E S K+N+ +E +  +L+E IL  H+   +
Sbjct:   21 TREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPN 201          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Human
Match: RAB38 (RAB38, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9776])

HSP 1 Score: 179.874 bits (455), Expect = 2.697e-55
Identity = 88/211 (41.71%), Postives = 133/211 (63.03%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEV--LCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E L+K+L+IGD  VGKT+ + RYVH  F   Y+ TIGVDFALK ++W     ++LQLWDIAGQER+ +MTRVYY+E+ G  ++FD++  A+F +V KWK DLDSK    +GKP+  +LLANK D     +  N +++   CKE+GF+GW E S KEN+ ++ +   L++ IL     + +S++   ++ +          +  K  +C+ C
Sbjct:    7 EHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHL---------TSTKVASCSGC 208          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Celegans
Match: glo-1 (Gut granule LOss; Rab GTPase GLO-1 [Source:UniProtKB/TrEMBL;Acc:G5EBF0])

HSP 1 Score: 164.466 bits (415), Expect = 1.002e-49
Identity = 83/206 (40.29%), Postives = 122/206 (59.22%), Query Frame = 1
Query:  136 FKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            +KVL+IGDP VGKT+ + R+VH+ F   YK TIGVDFALK +   ++  + LQ+WDI+GQ+RY  MTRVYYK++   I++ D +   +    L+WK DLD K    DG P+P ILLANK DI N+  D +++  L   NGF+G    S KE++ +E +  +L   ++   +G +  +       NR G   LDD + + +     C
Sbjct:   12 YKVLVIGDPGVGKTSIIRRFVHNVFSSNYKTTIGVDFALKILPVDENTVVHLQIWDISGQDRYGVMTRVYYKDAHAAIIVLDSTRERTIEGALRWKTDLDQKVTLADGSPVPAILLANKCDIDNKLGD-DKLYDLETNNGFVGSFRTSAKESVGIEEAFKFLANTVISTEQGGQYDVPFM----NREGNVNLDDNTTHSRYDSKCC 212          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Celegans
Match: rab-7 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146])

HSP 1 Score: 119.398 bits (298), Expect = 2.295e-32
Identity = 61/172 (35.47%), Postives = 100/172 (58.14%), Query Frame = 1
Query:  133 LFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKN-RTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRH 645
            L KV+++GD  VGKT+ +N+YV+  F ++YK TIG DF  +++   D + + LQ+WD AGQER+ S+   +Y+ +  C+L FD+++ ASF S+  W+ +   +    D    P +LL NK D+++ R +     +  C+  G I + E+S KE L VE +   +    L R 
Sbjct:    9 LLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDD-RTVTLQIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARE 179          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Celegans
Match: rab-7 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146])

HSP 1 Score: 119.398 bits (298), Expect = 2.295e-32
Identity = 61/172 (35.47%), Postives = 100/172 (58.14%), Query Frame = 1
Query:  133 LFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKN-RTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRH 645
            L KV+++GD  VGKT+ +N+YV+  F ++YK TIG DF  +++   D + + LQ+WD AGQER+ S+   +Y+ +  C+L FD+++ ASF S+  W+ +   +    D    P +LL NK D+++ R +     +  C+  G I + E+S KE L VE +   +    L R 
Sbjct:    9 LLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDD-RTVTLQIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARE 179          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Celegans
Match: rab-19 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9])

HSP 1 Score: 118.242 bits (295), Expect = 5.846e-32
Identity = 68/200 (34.00%), Postives = 111/200 (55.50%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKN-RTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRH--KGIEDSLDSQNIRNNRNGVYRL 711
              ++LFK++L+GD  VGKT  V R+ + TF D    TIGVDF +K +   D K++KLQ+WD  GQER+ ++T+ YY+ ++G +L +D++ + SF S+ +W  D+           +  +L+  K D+++ R I+  E E+L + NG     E S K N+ V+N+   L   IL R   +G+ +   S   +    G   L
Sbjct:    6 GFDYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTLV-VDGKRVKLQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFA----APNVVKLLIGTKCDLEDQRAIEAEEAEMLQRANGMFAMLETSAKGNVNVDNAFLEL-ATILKRQYDQGVVEQGSSGTFQLGSGGTTAL 199          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Celegans
Match: rab-19 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9])

HSP 1 Score: 118.242 bits (295), Expect = 5.846e-32
Identity = 68/200 (34.00%), Postives = 111/200 (55.50%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKN-RTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRH--KGIEDSLDSQNIRNNRNGVYRL 711
              ++LFK++L+GD  VGKT  V R+ + TF D    TIGVDF +K +   D K++KLQ+WD  GQER+ ++T+ YY+ ++G +L +D++ + SF S+ +W  D+           +  +L+  K D+++ R I+  E E+L + NG     E S K N+ V+N+   L   IL R   +G+ +   S   +    G   L
Sbjct:    6 GFDYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTLV-VDGKRVKLQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFA----APNVVKLLIGTKCDLEDQRAIEAEEAEMLQRANGMFAMLETSAKGNVNVDNAFLEL-ATILKRQYDQGVVEQGSSGTFQLGSGGTTAL 199          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0089933)

HSP 1 Score: 179.874 bits (455), Expect = 1.521e-55
Identity = 89/182 (48.90%), Postives = 119/182 (65.38%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTI--DQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSL 666
            E L+K+L+IG+   GKT+F+ RYVH  F   Y+ TIGVDFALK + W  +  ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++   +F  V KWK DLDSK    DG PIPCILLANK D + + I     +++   +ENGF GW E S KEN+ ++ +   L+  IL   K I   L
Sbjct:   17 EHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADL 198          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0339369)

HSP 1 Score: 179.489 bits (454), Expect = 1.578e-55
Identity = 89/182 (48.90%), Postives = 119/182 (65.38%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTI--DQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSL 666
            E L+K+L+IG+   GKT+F+ RYVH  F   Y+ TIGVDFALK + W  +  ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++   +F  V KWK DLDSK    DG PIPCILLANK D + + I     +++   +ENGF GW E S KEN+ ++ +   L+  IL   K I   L
Sbjct:    9 EHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADL 190          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0346636)

HSP 1 Score: 179.489 bits (454), Expect = 1.578e-55
Identity = 89/182 (48.90%), Postives = 119/182 (65.38%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTI--DQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSL 666
            E L+K+L+IG+   GKT+F+ RYVH  F   Y+ TIGVDFALK + W  +  ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++   +F  V KWK DLDSK    DG PIPCILLANK D + + I     +++   +ENGF GW E S KEN+ ++ +   L+  IL   K I   L
Sbjct:    9 EHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADL 190          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0346635)

HSP 1 Score: 182.57 bits (462), Expect = 1.424e-54
Identity = 86/172 (50.00%), Postives = 116/172 (67.44%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTI--DQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            E L+K+L+IG+   GKT+F+ RYVH  F   Y+ TIGVDFALK + W  +  ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++   +F  V KWK DLDSK    DG PIPCILLANK D + + I     +++   +ENGF GW E S KEN+ ++ +   L+  IL
Sbjct:  184 EHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 355          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0089932)

HSP 1 Score: 180.644 bits (457), Expect = 7.092e-54
Identity = 86/172 (50.00%), Postives = 116/172 (67.44%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTI--DQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            E L+K+L+IG+   GKT+F+ RYVH  F   Y+ TIGVDFALK + W  +  ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++   +F  V KWK DLDSK    DG PIPCILLANK D + + I     +++   +ENGF GW E S KEN+ ++ +   L+  IL
Sbjct:  183 EHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 354          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Zebrafish
Match: rab38c (RAB38c, member of RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-091118-91])

HSP 1 Score: 192.586 bits (488), Expect = 2.034e-60
Identity = 91/183 (49.73%), Postives = 125/183 (68.31%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQN--EIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLD 669
            E LFKVL+IGD  VGKT+ + RYVH  F   Y+ TIGVDFALK ++W     ++LQLWDIAGQERY +MTRVYY+E+ G +++FD++  ++F +VLKWK DLD K    +GKP+P +LLANKSD     +     +++  CKENGF+GW E S KEN  +E +   L++ IL   + I ++ D
Sbjct:    4 EHLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFALKVLHWDSQTVVRLQLWDIAGQERYGNMTRVYYREAVGALIVFDVTRSSTFDAVLKWKDDLDLKVSLNNGKPVPAVLLANKSDQSREGLCSQIPKLDTFCKENGFVGWFETSAKENSNIEAAAKCLVDHILAHEENIVNNTD 186          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Zebrafish
Match: rab32a (RAB32a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031006-10])

HSP 1 Score: 186.422 bits (472), Expect = 4.612e-58
Identity = 89/177 (50.28%), Postives = 122/177 (68.93%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEI-EVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGI 654
            E+LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++  ++F +V KWK DLD+K    +G PIP +LLANK D K    + + + +  CKE GF+GW E S KEN+ V+ +  +L+E IL   KG+
Sbjct:   11 EYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDITRGSTFEAVSKWKHDLDTKVKLANGNPIPSVLLANKCDQKKDGSNNSSLMDNFCKEAGFLGWFETSAKENINVDEAARFLVENILLNDKGL 187          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Zebrafish
Match: rab38b (RAB38b, member of RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-091204-345])

HSP 1 Score: 183.726 bits (465), Expect = 5.459e-57
Identity = 93/212 (43.87%), Postives = 138/212 (65.09%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQN---EIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E L+K+L+IGD  VGKT+ + RYVH T+   Y+ TIGVDFALK + W D + ++LQLWDIAGQER+ +MTRVYY+E+ G  ++FD++  A+F +V KWK DLDSK I  +G+ I  +LLANK D +NR    N   +++  C+ENGF+GW E S KEN+ + ++ ++L++ I+     I  S+    I    N          +K++ C++C
Sbjct:    7 EHLYKILVIGDLGVGKTSIIKRYVHQTYSTNYRATIGVDFALKVLNW-DSETVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVSKWKEDLDSKLILSNGQSIATVLLANKCD-QNRDFLTNNGLKMDQYCRENGFVGWFETSAKENVNINDAANFLVKHIIASENDILKSVVPDTISPQLNS---------DKEMTCSAC 207          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Zebrafish
Match: zgc:162171 (zgc:162171 [Source:ZFIN;Acc:ZDB-GENE-070424-24])

HSP 1 Score: 182.57 bits (462), Expect = 2.420e-56
Identity = 84/172 (48.84%), Postives = 121/172 (70.35%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTI--DQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            E L KVL+IGD  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQERY +MTRVYY+E+ G +++FD++  ++F +VLKWK+DLDSK   G+G+P+P +LLANK D +   +     ++E   +++GF+GW E S K+N  ++ +I  L+E I+
Sbjct:    4 ERLLKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFALKVLNWDHRTVVRLQLWDIAGQERYGNMTRVYYREAVGALVVFDMTRASTFQAVLKWKKDLDSKVALGNGRPLPAVLLANKCDQQRYGLCSKLPKLEHFSRDHGFVGWYETSAKDNTNIDAAIMRLVENIM 175          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Zebrafish
Match: rab32a (RAB32a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031006-10])

HSP 1 Score: 175.252 bits (443), Expect = 2.636e-53
Identity = 94/210 (44.76%), Postives = 133/210 (63.33%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI-KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQ-NIRNNRNGVYRLDDKSHNKKVACNS 750
            E+LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++  ++F +V KWK DLD+K    +G PIP +LLANK D  K+ + + + ++  CKE GF+GW E S K+  M    +D + + + D   GI      Q  I  N +    L+ ++H K  AC+S
Sbjct:   11 EYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDITRGSTFEAVSKWKHDLDTKVKLANGNPIPSVLLANKCDQKKDGSNNSSLMDNFCKEAGFLGWFETSAKKT-MKAAILDQVFK-MADILYGIRAKTAPQRQILKNISHSSCLNHQTHVKCAACSS 218          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Xenopus
Match: rab29 (RAB29, member RAS oncogene family [Source:NCBI gene;Acc:100135159])

HSP 1 Score: 200.675 bits (509), Expect = 1.357e-63
Identity = 92/185 (49.73%), Postives = 130/185 (70.27%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQ 675
            S + LFKVL++GD  VGKT+ + RYVHD F  +YK+T+GVDFALK + W D + ++LQLWDIAGQER++SMTR+YYK++S C++MFDL++  SF +   WK DLD+K I  +G  +PCILLANK D+    + + +I+   KEN FIGW+E SVKEN+ +  S+  LIE ++   +    S  + 
Sbjct:    3 SFDHLFKVLVVGDSTVGKTSLLQRYVHDVFGKDYKMTMGVDFALKVVQWSDTETVRLQLWDIAGQERFASMTRLYYKQASACVIMFDLTNSESFRNCQMWKDDLDNKVILPNGDFVPCILLANKCDLSPWAVSRQQIDQFSKENNFIGWTETSVKENININESMRVLIERMMASREAGNSSFPAH 187          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Xenopus
Match: rab32 (RAB32, member RAS oncogene family [Source:NCBI gene;Acc:496729])

HSP 1 Score: 186.422 bits (472), Expect = 9.754e-58
Identity = 93/211 (44.08%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIK--NRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E+LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK I W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++  ++F ++ KWK DLDSK     G PIP +LLANK D K  N     ++++  CKENGF  W E S K+N+ ++ +   L+E IL   K          +  N +G  R+D ++   +     C
Sbjct:   20 EYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSSTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDVTRGSTFEAITKWKSDLDSKVFLPSGGPIPAVLLANKCDQKKENSLQSPHQMDNFCKENGFAAWFETSAKDNMNIDEAARCLVENILANAKNFP-------VEENDDGSIRVDQEAMPAESKFQCC 223          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Xenopus
Match: gpx1 (glutathione peroxidase 1 [Source:Xenbase;Acc:XB-GENE-922630])

HSP 1 Score: 175.637 bits (444), Expect = 9.507e-54
Identity = 87/218 (39.91%), Postives = 131/218 (60.09%), Query Frame = 1
Query:  118 HSMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQN--EIEVLCKENGFIGWSEISVKENLMVENS----IDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            H  E L+K+L+IGD  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQER+ +MTRVYY+E+ G  ++FD++  A+F +V KWK DLDSK    +G P+  +LLANK D        +  +++  CKE+GF+ W E S KEN+ ++ +    + ++I    D+ + +E  +    I N+            +K  +C++C
Sbjct:    4 HQKEHLYKILVIGDLGVGKTSIIKRYVHQNFSPHYRATIGVDFALKVLSWDSDTVVRLQLWDIAGQERFGNMTRVYYREAVGAFIVFDVTRPATFEAVAKWKEDLDSKLTLANGVPVSAVLLANKCDQGKDNFKNHFTKMDQFCKEHGFVAWYETSAKENINIDEASRCLVSHIIASESDQMQPVEPDIVKPQILNS------------SKIASCSAC 209          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Xenopus
Match: rab32 (RAB32, member RAS oncogene family [Source:NCBI gene;Acc:496729])

HSP 1 Score: 169.474 bits (428), Expect = 8.795e-51
Identity = 93/246 (37.80%), Postives = 129/246 (52.44%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIA-----------------------------------GQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIK--NRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E+LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK I W     ++LQLWDIA                                   GQER+ +MTRVYYKE+ G  ++FD++  ++F ++ KWK DLDSK     G PIP +LLANK D K  N     ++++  CKENGF  W E S K+N+ ++ +   L+E IL   K          +  N +G  R+D ++   +     C
Sbjct:   20 EYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSSTLVRLQLWDIAALQLKRAQLLLYINVNNTQMVHSIQSAITFALSTTGQERFGNMTRVYYKEAVGAFVVFDVTRGSTFEAITKWKSDLDSKVFLPSGGPIPAVLLANKCDQKKENSLQSPHQMDNFCKENGFAAWFETSAKDNMNIDEAARCLVENILANAKNFP-------VEENDDGSIRVDQEAMPAESKFQCC 258          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Xenopus
Match: ENSXETT00000035921.1 (ras-related protein Rab-32-like [Source:NCBI gene;Acc:100496061])

HSP 1 Score: 160.614 bits (405), Expect = 6.808e-48
Identity = 90/209 (43.06%), Postives = 123/209 (58.85%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E L KVL++GD  VGKT+ + RYVH+ F   Y+ TIGVDFALK + W  +  ++LQLWDIAGQER+  MTR+YY+E+ G +++ DL   A+  SV +WK DLDSK    +G PIP ILL NK D        + +E L +E GF      S KEN+ +E +I  LI+ ++   +  E        RN+ N +      S NK  AC+ C
Sbjct:    8 EILCKVLVVGDLGVGKTSIIQRYVHNVFSQCYRATIGVDFALKIVNWDLNTMVRLQLWDIAGQERFGHMTRLYYREAVGALVVCDLGRVATVESVSRWKEDLDSKVCLQNGNPIPVILLGNKCDQVPLGTSASNLEQLGEELGFSHSHMTSAKENVNIEMAISSLIKEMIANDEDYEP-------RNDPNIIQPSLHPSVNK--ACSQC 207          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Mouse
Match: Rab29 (RAB29, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2385107])

HSP 1 Score: 204.912 bits (520), Expect = 2.328e-65
Identity = 89/185 (48.11%), Postives = 134/185 (72.43%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQ 675
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D + ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK     G+P+PC+LLANKSD+    + +++I+   KENGF GW+E SVKEN  +  ++  L+E +++  +    SL +Q
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDQFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDVMSLSTQ 187          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Mouse
Match: Rab29 (RAB29, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2385107])

HSP 1 Score: 204.912 bits (520), Expect = 2.328e-65
Identity = 89/185 (48.11%), Postives = 134/185 (72.43%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQ 675
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D + ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK     G+P+PC+LLANKSD+    + +++I+   KENGF GW+E SVKEN  +  ++  L+E +++  +    SL +Q
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDQFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDVMSLSTQ 187          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Mouse
Match: Rab32 (RAB32, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915094])

HSP 1 Score: 185.267 bits (469), Expect = 2.226e-57
Identity = 86/173 (49.71%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI-KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            + E LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD+S  ++F +VLKWK DLDSK    +G PIP +LLANK D  K+ +   ++++  CK++GF GW E S K+N+ ++ +  +L+E +L
Sbjct:   19 TREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKNDLDSKVHLPNGSPIPAVLLANKCDQKKDNSQSPSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENML 191          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Mouse
Match: Rab38 (RAB38, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1919683])

HSP 1 Score: 180.644 bits (457), Expect = 7.713e-56
Identity = 89/211 (42.18%), Postives = 134/211 (63.51%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEV--LCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E L+K+L+IGD  VGKT+ + RYVH  F   Y+ TIGVDFALK ++W     ++LQLWDIAGQER+ +MTRVYY+E+ G  ++FD++  A+F +V KWK DLDSK    +GKP+  +LLANK D     +  N +++   CKE+GF+GW E S KEN+ ++ +   L++ IL     + +S++   ++ +          +  K V+C+ C
Sbjct:    7 EHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLLESIEPDIVKPHL---------TSPKVVSCSGC 208          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Mouse
Match: Rab38 (RAB38, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1919683])

HSP 1 Score: 136.732 bits (343), Expect = 5.480e-40
Identity = 61/112 (54.46%), Postives = 82/112 (73.21%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGK 462
            E L+K+L+IGD  VGKT+ + RYVH  F   Y+ TIGVDFALK ++W     ++LQLWDIAGQER+ +MTRVYY+E+ G  ++FD++  A+F +V KWK DLDSK    +GK
Sbjct:    7 EHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGK 118          
BLAST of ras-related protein Rab-7L1 vs. UniProt/SwissProt
Match: sp|Q91YQ1|RAB7L_MOUSE (Ras-related protein Rab-7L1 OS=Mus musculus OX=10090 GN=Rab29 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.628e-64
Identity = 89/185 (48.11%), Postives = 134/185 (72.43%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQ 675
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D + ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK     G+P+PC+LLANKSD+    + +++I+   KENGF GW+E SVKEN  +  ++  L+E +++  +    SL +Q
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDVMSLSTQ 187          
BLAST of ras-related protein Rab-7L1 vs. UniProt/SwissProt
Match: sp|Q63481|RAB7L_RAT (Ras-related protein Rab-7L1 OS=Rattus norvegicus OX=10116 GN=Rab29 PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 4.468e-64
Identity = 90/189 (47.62%), Postives = 135/189 (71.43%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRN 687
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D + ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK     G+P+PC+LLANKSD+    + +++I+   KENGF GW+E SVKEN  +  ++  L+E +++  +  ED + S    N
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSR--EDIMSSSTQGN 189          
BLAST of ras-related protein Rab-7L1 vs. UniProt/SwissProt
Match: sp|Q5R7A4|RAB7L_PONAB (Ras-related protein Rab-7L1 OS=Pongo abelii OX=9601 GN=RAB29 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.227e-63
Identity = 86/172 (50.00%), Postives = 129/172 (75.00%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D++ ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK    +G+P+PC+LLANK D+    + +++I+   KENGF GW+E SVKEN  +  ++  LIE ++
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMM 174          
BLAST of ras-related protein Rab-7L1 vs. UniProt/SwissProt
Match: sp|O14966|RAB7L_HUMAN (Ras-related protein Rab-7L1 OS=Homo sapiens OX=9606 GN=RAB29 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.227e-63
Identity = 86/172 (50.00%), Postives = 129/172 (75.00%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            S + LFKVL++GD  VGKT+ V RY  D+F   YK T+GVDFALK + W D++ ++LQLWDIAGQER++SMTR+YY+++S C++MFD+++  +F++  +WK+DLDSK    +G+P+PC+LLANK D+    + +++I+   KENGF GW+E SVKEN  +  ++  LIE ++
Sbjct:    3 SRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMM 174          
BLAST of ras-related protein Rab-7L1 vs. UniProt/SwissProt
Match: sp|Q13637|RAB32_HUMAN (Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3)

HSP 1 Score: 191.43 bits (485), Expect = 4.861e-59
Identity = 90/181 (49.72%), Postives = 125/181 (69.06%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI-KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIED 660
            + E LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD+S  ++F +VLKWK DLDSK    +G PIP +LLANK D  K+ +   ++++  CKE+GF GW E S K+N+ +E +  +L+E IL  H+   +
Sbjct:   21 TREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPN 201          
BLAST of ras-related protein Rab-7L1 vs. TrEMBL
Match: A0A210PYH0 (Ras-related protein Rab-7L1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11879 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 7.411e-74
Identity = 100/177 (56.50%), Postives = 144/177 (81.36%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIE 657
            E LFK+++IGDP VGKT+FV RYV+D++  +YK+TIGVDFALK + W D + IKLQ+WDIAGQER++SMTRVYYK++  CI+MFDL+ +++F + +KWK+DLD+KC   DG  +PC+LLANK D+ +R ++QNEIE +CKE+ F+GW+E SVKE LM+E S+ +L+E ++ +H  ++
Sbjct:    3 EILFKIIIIGDPTVGKTSFVQRYVNDSYRRDYKMTIGVDFALKVVKWSDTQTIKLQIWDIAGQERFTSMTRVYYKDAHACIIMFDLTQKSTFQNAVKWKKDLDAKCSLPDGSTVPCLLLANKCDLSHREVEQNEIEDMCKEHDFVGWTETSVKEGLMIEESMRFLMEEMMAKHSELD 179          
BLAST of ras-related protein Rab-7L1 vs. TrEMBL
Match: A0A267EFY3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012669g2 PE=4 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.380e-73
Identity = 107/193 (55.44%), Postives = 143/193 (74.09%), Query Frame = 1
Query:  124 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGV 702
            ME LFK+L+IGD  VGKT+FV RYV+D F  +YK TIGVDFALK + W D + IKLQ+WDIAGQER++SMTRVYYK+++  I+MFDL+ + +F S LKWKRDLDSKC   DG P+P ILLANK D++ R +DQ E+E  C+E+ FIGW+E S KE +MV+ ++ +LIE +L +   + DS +  +   + NG 
Sbjct:    3 MERLFKILIIGDGTVGKTSFVQRYVNDVFRQDYKSTIGVDFALKVVKWSDTETIKLQMWDIAGQERFTSMTRVYYKDANAAIVMFDLTAKNTFHSALKWKRDLDSKCSLSDGSPVPAILLANKCDLQRREVDQAEVEGFCREHEFIGWTETSAKEGVMVDEAMRFLIEAVLAKSSRLGDSGEGADGDGSGNGA 195          
BLAST of ras-related protein Rab-7L1 vs. TrEMBL
Match: A0A267H320 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015928g2 PE=4 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.380e-73
Identity = 107/193 (55.44%), Postives = 143/193 (74.09%), Query Frame = 1
Query:  124 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGV 702
            ME LFK+L+IGD  VGKT+FV RYV+D F  +YK TIGVDFALK + W D + IKLQ+WDIAGQER++SMTRVYYK+++  I+MFDL+ + +F S LKWKRDLDSKC   DG P+P ILLANK D++ R +DQ E+E  C+E+ FIGW+E S KE +MV+ ++ +LIE +L +   + DS +  +   + NG 
Sbjct:    4 MERLFKILIIGDGTVGKTSFVQRYVNDVFRQDYKSTIGVDFALKVVKWSDTETIKLQMWDIAGQERFTSMTRVYYKDANAAIVMFDLTAKNTFHSALKWKRDLDSKCSLSDGSPVPAILLANKCDLQRREVDQAEVEGFCREHEFIGWTETSAKEGVMVDEAMRFLIEAVLAKSSRLGDSGEGADGDGSGNGA 196          
BLAST of ras-related protein Rab-7L1 vs. TrEMBL
Match: A0A1D2N5M2 (Ras-related protein Rab-7L1 OS=Orchesella cincta OX=48709 GN=Ocin01_06104 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 1.522e-73
Identity = 115/209 (55.02%), Postives = 148/209 (70.81%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E LFKV++IGDP VGKT+FV RYV  +F  +YK T+GVDFALK   W + + I+LQLWDIAGQER++ MTRVYYK++ GCI+MFDL++R SF + +KWK+D+DSKC+  DG PIPC+LLANK D+ +R +DQ EIE   KEN FIGW+E S KE LMV +S+ +L+E +L R  G        N  +N NG  RL  KS     +  SC
Sbjct:   18 EKLFKVIIIGDPTVGKTSFVQRYVQGSFKRDYKGTVGVDFALKVFKWSESQTIRLQLWDIAGQERFTWMTRVYYKDAHGCIIMFDLTNRNSFQNTIKWKKDVDSKCMLPDGSPIPCMLLANKCDLSSRQVDQMEIETFYKENNFIGWTETSAKEGLMVNDSMRFLVEVML-RQSG-----SGTNGFSNGNGTDRLHLKSALPTSSSCSC 220          
BLAST of ras-related protein Rab-7L1 vs. TrEMBL
Match: A0A1I8GIF4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.088e-73
Identity = 107/193 (55.44%), Postives = 143/193 (74.09%), Query Frame = 1
Query:  124 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGV 702
            ME LFK+L+IGD  VGKT+FV RYV+D F  +YK TIGVDFALK + W D + IKLQ+WDIAGQER++SMTRVYYK+++  I+MFDL+ + +F S LKWKRDLDSKC   DG P+P ILLANK D++ R +DQ E+E  C+E+ FIGW+E S KE +MV+ ++ +LIE +L +   + DS +  +   + NG 
Sbjct:    7 MERLFKILIIGDGTVGKTSFVQRYVNDVFRQDYKSTIGVDFALKVVKWSDTETIKLQMWDIAGQERFTSMTRVYYKDANAAIVMFDLTAKNTFHSALKWKRDLDSKCSLSDGSPVPAILLANKCDLQRREVDQAEVEGFCREHEFIGWTETSAKEGVMVDEAMRFLIEAVLAKSSRLGDSGEGADGDGSGNGA 199          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Cavefish
Match: rab38c (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103035037])

HSP 1 Score: 192.971 bits (489), Expect = 1.167e-60
Identity = 98/214 (45.79%), Postives = 136/214 (63.55%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSD-IKNRTIDQ-NEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC*PY 762
            E LFKVL+IGD  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     I+LQLWDIAGQERY +MTRVYY+E+ G +++FD++  ++F +VLKWK DLDSK    +GKP+P +LLANKSD ++     Q  +++  CKENGF+ W E S KEN  +E +   L++ IL   +   +  D   +       Y  + K H  + +C++C  Y
Sbjct:    4 EHLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFALKVLNWDSQTVIRLQLWDIAGQERYGNMTRVYYREAVGALIVFDVTRASTFDAVLKWKDDLDSKVTLSNGKPVPAVLLANKSDQLREGVCSQIPKLDTFCKENGFVSWFETSAKENTNIEAAARCLVQHILAHEENTVNDSDPDTVTLPG---YNNNTKDHG-RTSCSACSKY 213          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Cavefish
Match: rab32a (ras-related protein Rab-32 [Source:NCBI gene;Acc:103025939])

HSP 1 Score: 189.119 bits (479), Expect = 3.856e-59
Identity = 91/177 (51.41%), Postives = 123/177 (69.49%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI-KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGI 654
            E+LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK I W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++  ++F +V KWK DLDSK    +G PIP +LLANK D  K+ +   + ++  CKE GF+GW E S KEN+ V+ +  +L+E IL   KG+
Sbjct:   11 EYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDVTRSSTFEAVSKWKHDLDSKVKLANGNPIPSVLLANKCDQKKDGSNSASLMDTFCKETGFLGWFETSAKENINVDEAARFLVENILLNDKGL 187          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Cavefish
Match: rab38b (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103040837])

HSP 1 Score: 182.956 bits (463), Expect = 7.130e-57
Identity = 90/214 (42.06%), Postives = 132/214 (61.68%), Query Frame = 1
Query:  118 HSMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEV--LCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            H  E L+K+L+IGD  VGKT+ + RYVH T+   Y+ TIGVDFALK + W D + ++LQLWDIAGQER+ +MTRVYY+E+ G  ++FD++   +  +V KWK DLDSK    +GK I  +LLANK D     +  N +++   C+ENG +GW E S KEN+ +  + ++L++ I+     I  S+    I             S NK+++C+ C
Sbjct:    4 HRKEHLYKILVIGDLGVGKTSIIKRYVHQTYSTNYRATIGVDFALKVLNW-DSETVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPTTLEAVTKWKEDLDSKLTLANGKSIATVLLANKCDQSKEVVANNGLKMDQFCQENGIVGWFETSAKENININEAANFLVKHIIASENDILKSVVPDTIS---------PQLSPNKEMSCSGC 207          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Cavefish
Match: zgc:162171 (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103045050])

HSP 1 Score: 182.57 bits (462), Expect = 2.073e-56
Identity = 85/172 (49.42%), Postives = 120/172 (69.77%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQN--EIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            E L KVL+IGD  VGKTA + RYVH  F   Y+ TIGVDFALK + W     I+LQLWDIAGQERY +MTRVYY+E+ G +++FD++  ++F +VLKWK DLDSK    +G+P+P +LLANK D + + +     +++   +++GF+GW E S K+N  ++ +I  L+E IL
Sbjct:    4 ERLLKVLVIGDLGVGKTAIIKRYVHQVFSQHYRATIGVDFALKVLNWDHRTVIRLQLWDIAGQERYGNMTRVYYREAVGALVVFDMTRASTFQAVLKWKMDLDSKVALNNGRPVPAVLLANKCDQQKQGLCARLPKLDTFSRDHGFVGWYETSAKDNTNIDAAIMCLVENIL 175          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Cavefish
Match: zgc:162171 (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103045050])

HSP 1 Score: 182.57 bits (462), Expect = 2.073e-56
Identity = 85/172 (49.42%), Postives = 120/172 (69.77%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQN--EIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
            E L KVL+IGD  VGKTA + RYVH  F   Y+ TIGVDFALK + W     I+LQLWDIAGQERY +MTRVYY+E+ G +++FD++  ++F +VLKWK DLDSK    +G+P+P +LLANK D + + +     +++   +++GF+GW E S K+N  ++ +I  L+E IL
Sbjct:    4 ERLLKVLVIGDLGVGKTAIIKRYVHQVFSQHYRATIGVDFALKVLNWDHRTVIRLQLWDIAGQERYGNMTRVYYREAVGALVVFDMTRASTFQAVLKWKMDLDSKVALNNGRPVPAVLLANKCDQQKQGLCARLPKLDTFSRDHGFVGWYETSAKDNTNIDAAIMCLVENIL 175          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000406.1 (pep scaffold:Pmarinus_7.0:GL478061:71799:86849:1 gene:ENSPMAG00000000366.1 transcript:ENSPMAT00000000406.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 6.689e-59
Identity = 94/204 (46.08%), Postives = 129/204 (63.24%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANK-----SDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL----DRHKGIEDSLDSQNIR-NNRNGVYR 708
            EFLFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK + W     ++LQLWDIAGQER+ +MTRVYYKE+ G +++FD++   +F +V KWK DLDSK     GKPIP +LLANK      D +    D  +++  C++ GF+GW E S KEN+ VE +   L++ IL       +G     D+ +++   RNG  R
Sbjct:   10 EFLFKVLVIGELGVGKTSIIKRYVHHVFSHGYRATIGVDFALKVLGWDADTTVRLQLWDIAGQERFGNMTRVYYKEAVGAMVVFDVTRATTFEAVSKWKHDLDSKVTLPSGKPIPTVLLANKCDGDGGDARGEWSDTAQLDRYCRDEGFVGWFETSAKENINVEAAAQLLVQRILANDVSSAQGCRRCEDTDSVKLTTRNGGAR 213          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006605.1 (pep scaffold:Pmarinus_7.0:GL479131:3746:14175:-1 gene:ENSPMAG00000005962.1 transcript:ENSPMAT00000006605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 1.410e-50
Identity = 81/190 (42.63%), Postives = 127/190 (66.84%), Query Frame = 1
Query:  124 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILD-RHKGIEDSLDSQNIRNN 690
            ME LFKV+++G+ +VGKT+FV RY  + F + Y++T+GVDFA K + W D + IKL LWD+AGQERY S T+ +Y+ +SGC++++DL+ R SF   L WK  +D+     DG P+PC+LL NKSD+  R +   ++E  C+E+ F+   E+SVK+N  + +++  L+E ++    K    SL+  N++ N
Sbjct:    4 MEELFKVVVVGEVQVGKTSFVQRYSRNAFTENYRMTMGVDFAYKVLKWTDTQMIKLHLWDVAGQERYMSATKQFYRGASGCVVIYDLTSRQSFDKALLWKESIDAHASLPDGSPVPCLLLGNKSDLSEREVSAADMERACREHKFLACKEVSVKKNKNIGDAMRCLVEAMMGWVAKNSSQSLEQDNVQLN 193          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Sea Lamprey
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 132.88 bits (333), Expect = 6.838e-39
Identity = 59/106 (55.66%), Postives = 82/106 (77.36%), Query Frame = 1
Query:  310 GQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIE 627
            GQER++SMTR+YYK+++GCI+MFD++   SF + LKWKRDLDSK    DG+PIPCILLANKSD+ +  + + EIE   +++GF+GW+E SVK N  + +SI  L+E
Sbjct:    1 GQERFTSMTRLYYKDAAGCIVMFDVASLPSFHNCLKWKRDLDSKAFLPDGRPIPCILLANKSDLPDWAMSRAEIEQFSRDSGFLGWAETSVKMNHNITDSIRVLVE 106          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 116.701 bits (291), Expect = 1.028e-31
Identity = 61/176 (34.66%), Postives = 110/176 (62.50%), Query Frame = 1
Query:  118 HSMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIK-NRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDR 642
             + +++FK+L+IG+  VGKT+F+ RY  ++F   +  T+G+DF +K +Y  + K+IKLQ+WD AGQERY ++T  YY+ + G ILM+D+++  SF +V  W   +  K    D   +  +L+ NK D++ +R +   +   L ++ GF  + E S K+N+ V+ + + L++ I ++
Sbjct:   24 QNFDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVY-RNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQI--KTYSWDNAQV--VLVGNKCDMEDDRMVPTEQGRQLAEQLGF-EFFETSAKDNINVKQTFERLVDVICEK 193          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 109.383 bits (272), Expect = 3.391e-29
Identity = 67/192 (34.90%), Postives = 110/192 (57.29%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI-KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYL---IECILDRHKGIEDSLDSQNIR 684
            + ++LFK+LLIGD  VGKT  + R+  D F   +  TIG+DF ++ I   D KKIKLQ+WD AGQER+ ++T  YY+ + G +L++D+++  SF ++  W R+++          +  ++L NK D+ + R + +   E L  E G I + E S K ++ VE +   L   I+  +DR     ++ DS  +R
Sbjct:    4 TYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDL-DGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHA----SADVEKMILGNKCDMNERRQVTRERGEKLAIEYG-IKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVR 189          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 113.235 bits (282), Expect = 1.007e-30
Identity = 67/193 (34.72%), Postives = 109/193 (56.48%), Query Frame = 1
Query:  121 SMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNG 699
            S + + K+LLIGD  VGK+  + R+V D F   +  TIG+DF +K +  +  KK+KLQLWD AGQER+ ++T  YY+ + G IL++D++D  +FT++ +W + ++             +L+ NKSD++ R +  ++ E L KE G I + E S K +       D + E      K I++ +DS  +    NG
Sbjct:   16 SYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDIN-GKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHA----NDEAQLLLVGNKSDMETRVVTADQGEALAKELG-IPFIESSAKND-------DNVNEIFFTLAKLIQEKIDSNKLVGVGNG 195          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 112.849 bits (281), Expect = 1.440e-30
Identity = 71/208 (34.13%), Postives = 113/208 (54.33%), Query Frame = 1
Query:  136 FKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKN-RTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRN---NRNGVYRLDDKSHNKKVACN 747
            +K++ +G+  VGKT+ + R+++DTF D Y+ TIG+DF  K +Y  D K I+LQLWD AGQER+ S+   Y ++S   I+++D++ R SF  + KW  D+ ++   GD   I CI + NKSD+ + R I   E E   K  G   + E S K    V+     + + + +        LDS+N  +   N+ GV  +      ++ AC 
Sbjct:   11 YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNE--RGDENVILCI-VGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQ 214          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 107.457 bits (267), Expect = 1.132e-28
Identity = 60/185 (32.43%), Postives = 109/185 (58.92%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNI 681
            ++LFK+LLIG+  VGK+  + R+  DT+ ++Y  TIGVDF +K +   D K +KLQ+WD AGQER+ ++T  YY+ S G I+++D++D+ SF  V  W +++D          +  +L+ NK D+K++ + + ++     +   + + E S  ++  VE++        L   + I++S+  QN+
Sbjct:    6 DYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYAT----STVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDA-------FLTMARQIKESMSQQNL 178          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 106.301 bits (264), Expect = 3.804e-28
Identity = 55/191 (28.80%), Postives = 103/191 (53.93%), Query Frame = 1
Query:  133 LFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKN--RTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSL-----DSQNIR 684
            + KV+++GD  VGKT+ ++RYV+D +  +YK TIG DF  KE+     K   +Q+WD AGQER+ S+   +Y+ +  C+L++D+++ +SF ++  W+ +          +  P ++L NK D +   + + +   + L K  G I     S K  + V+ + + +    L +++   ++      D+ NIR
Sbjct:    8 ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFEDDYNDAINIR 198          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 104.76 bits (260), Expect = 2.111e-27
Identity = 65/223 (29.15%), Postives = 114/223 (51.12%), Query Frame = 1
Query:  112 FFHSMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKN-RTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKS--------HNKKVACNSC 753
            + +  + LFK++LIGD  VGK+  ++R+  + F  + K TIGV+FA + +   D K+IK Q+WD AGQERY ++T  YY+ + G ++++D+S  +S+ +   W  +L           +   L+ NKSD+ + R +   E +   +EN  + ++E S   +  V+ + + LI  I  +    +  L   +   N NG    +  +         NKK   N+C
Sbjct:    6 YGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA----DDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLL-FTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNC 222          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Nematostella
Match: EDO48072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK04])

HSP 1 Score: 208.764 bits (530), Expect = 5.575e-68
Identity = 92/163 (56.44%), Postives = 123/163 (75.46%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSID 615
            E LFKVL++GD  VGKT+FV RYVH     EYK TIGVDFALK I W     ++LQLWDIAGQER++SMTRVYYK ++ C++MFDL+ + +F S +KWK DLDSKC   +GKPIPCIL+ NKSD+  R + +  I+ LC+++ F+GW+E+SVKE + V  +++
Sbjct:    3 EILFKVLIVGDATVGKTSFVQRYVHGNTRREYKPTIGVDFALKVIPWAQDATVRLQLWDIAGQERFTSMTRVYYKGAAACVIMFDLTSQQTFNSTIKWKNDLDSKCKLPNGKPIPCILVGNKSDLSARPVPKETIDKLCRDHSFLGWTEMSVKEEVNVSETME 165          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Nematostella
Match: EDO46057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR62])

HSP 1 Score: 185.267 bits (469), Expect = 2.736e-58
Identity = 85/171 (49.71%), Postives = 124/171 (72.51%), Query Frame = 1
Query:  136 FKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHK 648
            FKVL++GD   GK +FV RYV++ +   YK TIGVDFALK I W  +  I+LQ+W IAGQER+SSMTRVYYK +  C+++FDL  + +    +KWK+DLDSK      KP+PCIL+ NKSD+ +R +D+  I+ LCKE+ F+ W+E+SVKE++ V+  ++YL++ +++  K
Sbjct:    9 FKVLVVGDILTGKQSFVKRYVNNIWHPLYKPTIGVDFALKTIQWAQNTTIRLQIWLIAGQERFSSMTRVYYKGADACVVLFDLERQTTLDGAIKWKKDLDSKYKLHSRKPVPCILVGNKSDLPDRPVDKEIIDKLCKEHSFLCWTEMSVKEDINVKKPMEYLVKHLMEDGK 179          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Nematostella
Match: EDO36757 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHS5])

HSP 1 Score: 177.948 bits (450), Expect = 6.149e-55
Identity = 83/184 (45.11%), Postives = 124/184 (67.39%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILD-----RHKGIEDS 663
            E L+KVL+IG+  VGKT+ + RY    F   YK+TIGVDFALK I+W +  KI LQLWD+AG ER+  MTRVYYK +   I++FDLS  A+F ++LKW RD++ K +  +  PIP I+LANK D+++  +D+ +++  C+ NGF GW   S KE+  +++++ +L++ IL      R   ++DS
Sbjct:   14 EHLYKVLVIGEYGVGKTSIIRRYTEGYFSPNYKLTIGVDFALKIIHWDEKTKINLQLWDVAGHERFGHMTRVYYKYAIAAIIVFDLSRSATFDAILKWYRDVNQKVMLTNENPIPVIILANKCDLEDYPVDEEKLDQFCQNNGFAGWFATSAKEDYNIDDAMRFLVQAILSTSGECRKPSLQDS 197          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Nematostella
Match: EDO48076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK08])

HSP 1 Score: 127.102 bits (318), Expect = 5.853e-37
Identity = 52/104 (50.00%), Postives = 80/104 (76.92%), Query Frame = 1
Query:  304 IAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSID 615
            I+GQE+Y+SMTR YY++++ CI+MFDL+ + +F+ V+ WK DLDSKC   DGK IPCIL+ NKSD+  R + +  I+ LC+++ F+GW+E+SVKE + V  +++
Sbjct:    1 ISGQEKYTSMTRAYYRDATACIIMFDLTSQPTFSKVVFWKEDLDSKCKLPDGKLIPCILVGNKSDLSARPVPKQTIDKLCRDHSFLGWTEMSVKEEVNVSETVE 104          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Nematostella
Match: EDO45332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT62])

HSP 1 Score: 120.168 bits (300), Expect = 4.294e-33
Identity = 58/175 (33.14%), Postives = 100/175 (57.14%), Query Frame = 1
Query:  133 LFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIE 657
            L KV+++GD  VGKT+ +N+YV+  F ++YK TIG DF  KE+   D + + +Q+WD AGQER+ S+   +Y+ +  C+L+FD++   SF ++  W+ +   +    D +  P ++L NK D++NR +     +  C     I + E S KE + VE +   + +  L +   +E
Sbjct:    8 LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVM-VDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTQPNSFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRAVSAKRAQAWCHSKNDIPYFETSAKEAINVEQAFQTIAKNALAQETDVE 181          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Medaka
Match: rab38c (ras-related protein Rab-32-like [Source:NCBI gene;Acc:101156599])

HSP 1 Score: 190.66 bits (483), Expect = 8.382e-60
Identity = 87/174 (50.00%), Postives = 120/174 (68.97%), Query Frame = 1
Query:  115 FHSMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
                EFLFKVL+IGD  VGKT+ + RYVH  F   Y+ TIGVDF LK + W + + ++LQLWDIAGQERY +MTRVYY+E+ G +++FD++  ++F +VLKWK DLDSK     G+P+P +LLANKSD     + +  ++  C+ENGF+GW   S K+N  +E +   L+E IL
Sbjct:   10 MQQQEFLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFVLKVLQWDNDRVVRLQLWDIAGQERYGNMTRVYYREAVGALVVFDVTRASTFDAVLKWKDDLDSKVTLSHGRPVPAVLLANKSDQMASQVPK--LDSFCRENGFVGWFGTSAKDNTNIEEAARCLVEHIL 181          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Medaka
Match: rab38c (ras-related protein Rab-32-like [Source:NCBI gene;Acc:101156599])

HSP 1 Score: 189.889 bits (481), Expect = 2.521e-59
Identity = 87/171 (50.88%), Postives = 120/171 (70.18%), Query Frame = 1
Query:  124 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECIL 636
             EFLFKVL+IGD  VGKT+ + RYVH  F   Y+ TIGVDF LK + W + + ++LQLWDIAGQERY +MTRVYY+E+ G +++FD++  ++F +VLKWK DLDSK     G+P+P +LLANKSD     + +  ++  C+ENGF+GW   S K+N  +E +   L+E IL
Sbjct:   22 FEFLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFVLKVLQWDNDRVVRLQLWDIAGQERYGNMTRVYYREAVGALVVFDVTRASTFDAVLKWKDDLDSKVTLSHGRPVPAVLLANKSDQMASQVPK--LDSFCRENGFVGWFGTSAKDNTNIEEAARCLVEHIL 190          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Medaka
Match: rab32a (RAB32, member RAS oncogene family [Source:NCBI gene;Acc:101161453])

HSP 1 Score: 189.119 bits (479), Expect = 3.958e-59
Identity = 90/177 (50.85%), Postives = 123/177 (69.49%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEI-EVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGI 654
            E+LFKVL+IG+  VGKT+ + RYVH  F   Y+ TIGVDFALK I W     ++LQLWDIAGQER+ +MTRVYYKE+ G  ++FD++  A+F +V KWK DLDSK    +G PIP +LLANK D K  + +   + +  CK+ GF+GW E S K+N+ V+++  +L+E IL   KG+
Sbjct:   11 EYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDVTRGATFEAVSKWKHDLDSKVKLTNGNPIPAVLLANKCDQKKESPNNTPLMDKFCKDTGFLGWFETSAKDNINVDDAARFLVEHILANDKGL 187          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Medaka
Match: RAB29 (ras-related protein Rab-7L1 [Source:NCBI gene;Acc:101167273])

HSP 1 Score: 185.652 bits (470), Expect = 5.382e-58
Identity = 88/173 (50.87%), Postives = 120/173 (69.36%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRH 645
            E L K+L++GD  VGK++FVNRY+   F   YK+T+GVDFA+K ++W D +K++LQLWDIAGQER+ SMTR+YYK + GCI+MFD+S  +SF S   WK+DLD K +  +G  IPC+LLANK D+  R +  + I+     NGF  W E SVKEN  V  ++  L++ IL  H
Sbjct:    3 EHLLKILIVGDGNVGKSSFVNRYISGNFNRTYKMTVGVDFAVKLLHWSDEEKVRLQLWDIAGQERFISMTRIYYKGAVGCIVMFDISSSSSFLSCRLWKQDLDHKAMLPNGDTIPCLLLANKCDLAERAVSADTIDQFSGANGFFTWMEASVKENKNVGEAMRRLVQEILSVH 175          
BLAST of ras-related protein Rab-7L1 vs. Ensembl Medaka
Match: rab38b (ras-related protein Rab-38 [Source:NCBI gene;Acc:101171270])

HSP 1 Score: 181.8 bits (460), Expect = 2.504e-56
Identity = 91/210 (43.33%), Postives = 138/210 (65.71%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSD-IKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            E L+KVL+IGD  VGKT+ + RYVH T+   Y+ TIGVDFALK + W D + ++LQLWDIAGQER+ +MTRVYY+E+ G  ++FD++   +F +VLKWK DLDSK +  +G  I  +LLANK D I++ T +  +++  CK++GFIGW E S K+NL ++ + ++LI+ ++     I  S+    I  + N           ++++C+ C
Sbjct:   17 EHLYKVLVIGDLGVGKTSIIRRYVHQTYSTNYRATIGVDFALKVLNW-DSETVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPTTFEAVLKWKEDLDSKAMLANGSSIATVLLANKCDQIRDLTNNGLKMDQFCKDHGFIGWFETSAKDNLNLKEAANFLIKHMMATENDILKSVVPDTISPHLN---------PGREMSCSGC 216          
BLAST of ras-related protein Rab-7L1 vs. Planmine SMEST
Match: SMESG000038328.1 (SMESG000038328.1)

HSP 1 Score: 432.18 bits (1110), Expect = 3.762e-155
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 1
Query:  124 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC
Sbjct:    1 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 210          
BLAST of ras-related protein Rab-7L1 vs. Planmine SMEST
Match: SMESG000038167.1 (SMESG000038167.1)

HSP 1 Score: 432.18 bits (1110), Expect = 3.762e-155
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 1
Query:  124 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 753
            MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC
Sbjct:    1 MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNSC 210          
BLAST of ras-related protein Rab-7L1 vs. Planmine SMEST
Match: SMESG000060721.1 (SMESG000060721.1)

HSP 1 Score: 169.088 bits (427), Expect = 1.313e-51
Identity = 86/207 (41.55%), Postives = 130/207 (62.80%), Query Frame = 1
Query:  130 FLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI--KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVAC 744
            +LFKVL++G+ + GKT+ + RYVH  F   Y+ TIGVDFALK +   D K +K+QLWDIAGQER+ +MTR YYKE+SG  +++D++  ++  + +KWK DLDSK    +G  IP ILL NKSD    ++  D+N ++   KE+ F G S  S KEN+ +E S++ L+E ++   K  ++    +   N  N   + + ++ N K  C
Sbjct:    6 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYMDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM---KASQEGEPKEGKINTINVTNKANQQTENSKTNC 209          
BLAST of ras-related protein Rab-7L1 vs. Planmine SMEST
Match: SMESG000060723.1 (SMESG000060723.1)

HSP 1 Score: 164.081 bits (414), Expect = 1.462e-49
Identity = 85/210 (40.48%), Postives = 130/210 (61.90%), Query Frame = 1
Query:  127 EFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI--KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVACNS 750
            E+LFKVL+IG+   GKT+ + RYVH  F   Y+ TIGVDFALK +   D   ++LQLWDIAGQER+ +M RVYYK++ G  +++D++  ++F +V+KWK+DLD+K    +G+PIPCILL NK D   + +  D   ++    E+GF+     S KEN+ ++ + + L+E ++   +G E         N  N + +L ++    K A NS
Sbjct:    5 EYLFKVLVIGELGSGKTSIIKRYVHKFFSQHYRATIGVDFALKVLPRDDSSVVRLQLWDIAGQERFGNMLRVYYKDAMGAFIVYDVTRMSTFEAVVKWKKDLDNKVTQPNGEPIPCILLGNKCDCEPEGKLSDSAYLDEFVNEHGFVARFNTSAKENIGIDEAANALVEKMMTIIQGPE--------VNKDNDLIKLGNQKSTDKPAQNS 206          
BLAST of ras-related protein Rab-7L1 vs. Planmine SMEST
Match: SMESG000034019.1 (SMESG000034019.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.266e-34
Identity = 79/214 (36.92%), Postives = 126/214 (58.88%), Query Frame = 1
Query:  118 HSMEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDIK-NRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDS-QNIRNNRNGVYRLDDKSHNKKVACNSC 753
             + +++FK+L+IG+  VGKT+F+ RY  D+F   +  T+G+DF +K I   D KK+KLQ+WD AGQERY ++T  YY+ + G ILM+D+++  SF +V  W   +  K    D   +  +L+ NK D+   R I  +    L  + G + + E S KENL V++  + L++ I D+   + +SLD+  +I NN N   RL D+++  K   N C
Sbjct:   10 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRD-KKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQI--KTYSWDNAQV--VLVGNKVDLDYERVISIDRGRQLASQLG-LEFFETSAKENLHVKSVFERLVDIICDK---MSESLDTDPSIVNNPNKGTRLADETN--KALPNDC 212          
The following BLAST results are available for this feature:
BLAST of ras-related protein Rab-7L1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB298.801e-6450.00RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
RAB298.801e-6450.00RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
RAB298.801e-6450.00RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
RAB321.012e-5949.72RAB32, member RAS oncogene family [Source:HGNC Sym... [more]
RAB382.697e-5541.71RAB38, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glo-11.002e-4940.29Gut granule LOss; Rab GTPase GLO-1 [Source:UniPro... [more]
rab-72.295e-3235.47RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146][more]
rab-72.295e-3235.47RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146][more]
rab-195.846e-3234.00RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9][more]
rab-195.846e-3234.00RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9][more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab321.521e-5548.90gene:FBgn0002567 transcript:FBtr0089933[more]
Rab321.578e-5548.90gene:FBgn0002567 transcript:FBtr0339369[more]
Rab321.578e-5548.90gene:FBgn0002567 transcript:FBtr0346636[more]
Rab321.424e-5450.00gene:FBgn0002567 transcript:FBtr0346635[more]
Rab327.092e-5450.00gene:FBgn0002567 transcript:FBtr0089932[more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab38c2.034e-6049.73RAB38c, member of RAS oncogene family [Source:ZFIN... [more]
rab32a4.612e-5850.28RAB32a, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab38b5.459e-5743.87RAB38b, member of RAS oncogene family [Source:ZFIN... [more]
zgc:1621712.420e-5648.84zgc:162171 [Source:ZFIN;Acc:ZDB-GENE-070424-24][more]
rab32a2.636e-5344.76RAB32a, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab291.357e-6349.73RAB29, member RAS oncogene family [Source:NCBI gen... [more]
rab329.754e-5844.08RAB32, member RAS oncogene family [Source:NCBI gen... [more]
gpx19.507e-5439.91glutathione peroxidase 1 [Source:Xenbase;Acc:XB-GE... [more]
rab328.795e-5137.80RAB32, member RAS oncogene family [Source:NCBI gen... [more]
ENSXETT00000035921.16.808e-4843.06ras-related protein Rab-32-like [Source:NCBI gene;... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab292.328e-6548.11RAB29, member RAS oncogene family [Source:MGI Symb... [more]
Rab292.328e-6548.11RAB29, member RAS oncogene family [Source:MGI Symb... [more]
Rab322.226e-5749.71RAB32, member RAS oncogene family [Source:MGI Symb... [more]
Rab387.713e-5642.18RAB38, member RAS oncogene family [Source:MGI Symb... [more]
Rab385.480e-4054.46RAB38, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91YQ1|RAB7L_MOUSE1.628e-6448.11Ras-related protein Rab-7L1 OS=Mus musculus OX=100... [more]
sp|Q63481|RAB7L_RAT4.468e-6447.62Ras-related protein Rab-7L1 OS=Rattus norvegicus O... [more]
sp|Q5R7A4|RAB7L_PONAB4.227e-6350.00Ras-related protein Rab-7L1 OS=Pongo abelii OX=960... [more]
sp|O14966|RAB7L_HUMAN4.227e-6350.00Ras-related protein Rab-7L1 OS=Homo sapiens OX=960... [more]
sp|Q13637|RAB32_HUMAN4.861e-5949.72Ras-related protein Rab-32 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PYH07.411e-7456.50Ras-related protein Rab-7L1 OS=Mizuhopecten yessoe... [more]
A0A267EFY31.380e-7355.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267H3201.380e-7355.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1D2N5M21.522e-7355.02Ras-related protein Rab-7L1 OS=Orchesella cincta O... [more]
A0A1I8GIF42.088e-7355.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab38c1.167e-6045.79ras-related protein Rab-38-like [Source:NCBI gene;... [more]
rab32a3.856e-5951.41ras-related protein Rab-32 [Source:NCBI gene;Acc:1... [more]
rab38b7.130e-5742.06ras-related protein Rab-38-like [Source:NCBI gene;... [more]
zgc:1621712.073e-5649.42ras-related protein Rab-38-like [Source:NCBI gene;... [more]
zgc:1621712.073e-5649.42ras-related protein Rab-38-like [Source:NCBI gene;... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000406.16.689e-5946.08pep scaffold:Pmarinus_7.0:GL478061:71799:86849:1 g... [more]
ENSPMAT00000006605.11.410e-5042.63pep scaffold:Pmarinus_7.0:GL479131:3746:14175:-1 g... [more]
RAB296.838e-3955.66RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
rab3c1.028e-3134.66RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a3.391e-2934.90RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC41.007e-3034.72Rab family GTPase; essential for vesicle-mediated ... [more]
YPT61.440e-3034.13Rab family GTPase; required for endosome-to-Golgii... [more]
YPT11.132e-2832.43Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT73.804e-2828.80Rab family GTPase; GTP-binding protein of the rab ... [more]
YPT312.111e-2729.15Rab family GTPase; involved in the exocytic pathwa... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO480725.575e-6856.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460572.736e-5849.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367576.149e-5545.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480765.853e-3750.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453324.294e-3333.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab38c8.382e-6050.00ras-related protein Rab-32-like [Source:NCBI gene;... [more]
rab38c2.521e-5950.88ras-related protein Rab-32-like [Source:NCBI gene;... [more]
rab32a3.958e-5950.85RAB32, member RAS oncogene family [Source:NCBI gen... [more]
RAB295.382e-5850.87ras-related protein Rab-7L1 [Source:NCBI gene;Acc:... [more]
rab38b2.504e-5643.33ras-related protein Rab-38 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of ras-related protein Rab-7L1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038328.13.762e-155100.00SMESG000038328.1[more]
SMESG000038167.13.762e-155100.00SMESG000038167.1[more]
SMESG000060721.11.313e-5141.55SMESG000060721.1[more]
SMESG000060723.11.462e-4940.48SMESG000060723.1[more]
SMESG000034019.12.266e-3436.92SMESG000034019.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032985 ID=SMED30032985|Name=ras-related protein Rab-7L1|organism=Schmidtea mediterranea sexual|type=transcript|length=903bp
CCTGATTTTAAAGTTGTTCGTGTTTCATTGCATTAAAATATAAAAATCCG
GAATTTATATCTAAGTTAACTAAGTTGTCTATTCCAATAAAATATTTCAA
ATAAATTTTTATTTTTTCATTCGATGGAATTTCTTTTTAAAGTATTATTA
ATTGGTGATCCAAAAGTCGGTAAAACCGCTTTTGTAAATCGATATGTCCA
TGACACGTTTTTTGATGAATACAAAGTGACAATTGGTGTTGATTTTGCTT
TGAAAGAAATATATTGGCATGATCATAAAAAAATAAAATTACAATTATGG
GACATTGCTGGACAAGAAAGATATTCGTCTATGACGAGAGTTTATTATAA
GGAATCGAGTGGATGCATCCTAATGTTTGATCTGTCGGACCGAGCATCAT
TTACAAGTGTTTTAAAATGGAAAAGAGATCTTGACAGTAAATGTATATTT
GGAGATGGAAAACCGATTCCGTGTATATTACTCGCCAATAAAAGTGACAT
AAAAAATAGAACTATTGATCAAAATGAAATCGAAGTTTTATGCAAAGAAA
ATGGTTTTATTGGATGGAGTGAGATTTCTGTGAAGGAGAATTTGATGGTA
GAAAATTCCATTGACTATTTGATCGAATGCATTCTAGATAGACACAAAGG
AATAGAGGACAGTTTGGACAGTCAAAACATAAGAAATAACCGCAACGGAG
TCTATCGACTTGATGACAAATCTCACAATAAGAAAGTCGCTTGTAATTCC
TGCTGACCATATTAATGTAATAGAAAATTTTGAAAAATTTTATTTATCTA
ATGTGGACTTAAGTCTTCAGTTCAGAATCGTTTTGTTGTAATTTATTTCA
TGAGAATAAACGGTAACAATTTCTAATAATGTAAAAATATAATAATTAAA
TTT
back to top

protein sequence of SMED30032985-orf-1

>SMED30032985-orf-1 ID=SMED30032985-orf-1|Name=SMED30032985-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MEFLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHD
HKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWK
RDLDSKCIFGDGKPIPCILLANKSDIKNRTIDQNEIEVLCKENGFIGWSE
ISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKS
HNKKVACNSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR030697Rab29/Rab38/Rab32
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0016192vesicle-mediated transport
GO:0032438melanosome organization
GO:0090382phagosome maturation
GO:1903232melanosome assembly
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0016020membrane
GO:0030670phagocytic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
GO:0033162melanosome membrane
GO:0042470melanosome
GO:0045335phagocytic vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 113..126
score: 36.24
coord: 47..69
score: 45.34
coord: 5..26
score: 40.61
coord: 148..170
score: 24.84
coord: 28..44
score: 36.43
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 10..204
e-value: 9.4E-8
score: 41.8
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 5..173
e-value: 1.1E-50
score: 184.3
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 7..169
e-value: 1.2E-6
score: -32.9
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 2..173
e-value: 1.2E-10
score: 34.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..206
e-value: 3.1E-52
score: 178.8
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 3..176
NoneNo IPR availablePANTHERPTHR24073:SF315RAS-RELATED PROTEIN RAB-7L1coord: 3..176
NoneNo IPR availablePROSITEPS51419RABcoord: 1..207
score: 28.768
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 5..155
e-value: 4.9E-22
score: 76.4
IPR001806Small GTPasePFAMPF00071Rascoord: 6..170
e-value: 8.1E-44
score: 149.1
IPR030697Ras-related protein Rab29/Rab38/Rab32CDDcd04107Rab32_Rab38coord: 5..188
e-value: 1.41781E-85
score: 249.535
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..188