slc6a-8

Overview
Nameslc6a-8 (AKN21428.1)
Smed IDSMED30032979
Length (bp)4025
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc6a-8 (SMED30032979) t-SNE clustered cells

Violin plots show distribution of expression levels for slc6a-8 (SMED30032979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc6a-8 (SMED30032979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc6a-8 (SMED30032979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30032979SMESG000079327.1 SMESG000079326.1 dd_Smed_v4_2109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30032979SMESG000079327.1 SMESG000079326.1 dd_Smed_v4_2109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032979SMESG000079327.1 SMESG000079326.1 dd_Smed_v4_2109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032979SMESG000079327.1 SMESG000079326.1 dd_Smed_v4_2109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30032979SMESG000079327.1 SMESG000079326.1 dd_Smed_v6_2109_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30032979SMESG000079327.1 SMESG000079326.1 dd_Smed_v6_2109_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-8 vs. Ensembl Human
Match: ARRB1 (arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711])

HSP 1 Score: 476.093 bits (1224), Expect = 1.369e-155
Identity = 253/449 (56.35%), Postives = 314/449 (69.93%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G  D+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADD---TVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPKEEPP----------HREVPENETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 390          
BLAST of slc6a-8 vs. Ensembl Human
Match: ARRB1 (arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711])

HSP 1 Score: 475.707 bits (1223), Expect = 2.234e-155
Identity = 254/456 (55.70%), Postives = 316/456 (69.30%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADD---TVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP----------HREVPENETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 398          
BLAST of slc6a-8 vs. Ensembl Human
Match: ARRB2 (arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712])

HSP 1 Score: 468.003 bits (1203), Expect = 1.489e-152
Identity = 250/458 (54.59%), Postives = 316/458 (69.00%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKND 1517
            EK  ++VFKKSSPN K+T YLGKRDF+D+LD VDPVDGVVL+DPDYLKDRKVFV +  AFRYGREDLDVLGL+FRKDL++A+ Q +                R  TRLQ+RL++KLG +A+PF+F +P N P SVTLQPGP D GK CGVD+E++ + A + +EK+HKRNSV+L IRK+ +AP+KP PQPSAE  + F+MS  SL LEASLDKE YYHGE ++VNV V NNS KT+KKIK++VRQ+ADICL++   YKC V +LE +D     S  + +CKVY + PLLS+NR+KRGLALDGKLKHEDTNLASSTI+ E  NKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP D  P                +  P+         E++VP           +D +LI+ DT+             + DDD++FEDFARLRL G   +D
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAF---------PPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQV---SPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHIP----------------LPRPQ-----SAAPETDVP-----------VDTNLIEFDTN------------YATDDDIVFEDFARLRLKGMKDDD 403          
BLAST of slc6a-8 vs. Ensembl Human
Match: ARRB2 (arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712])

HSP 1 Score: 456.062 bits (1172), Expect = 8.452e-148
Identity = 250/479 (52.19%), Postives = 316/479 (65.97%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFE---------------------LPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKND 1517
            EK  ++VFKKSSPN K+T YLGKRDF+D+LD VDPVDGVVL+DPDYLKDRKVFV +  AFRYGREDLDVLGL+FRKDL++A+ Q +                R  TRLQ+RL++KLG +A+PF+F                      +P N P SVTLQPGP D GK CGVD+E++ + A + +EK+HKRNSV+L IRK+ +AP+KP PQPSAE  + F+MS  SL LEASLDKE YYHGE ++VNV V NNS KT+KKIK++VRQ+ADICL++   YKC V +LE +D     S  + +CKVY + PLLS+NR+KRGLALDGKLKHEDTNLASSTI+ E  NKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP D  P                +  P+         E++VP           +D +LI+ DT+             + DDD++FEDFARLRL G   +D
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAF---------PPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTVRMPLPSEGQGAGAGTVSGVGIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQV---SPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHIP----------------LPRPQ-----SAAPETDVP-----------VDTNLIEFDTN------------YATDDDIVFEDFARLRLKGMKDDD 424          
BLAST of slc6a-8 vs. Ensembl Human
Match: ARRB2 (arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712])

HSP 1 Score: 432.18 bits (1110), Expect = 4.566e-139
Identity = 237/458 (51.75%), Postives = 302/458 (65.94%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKND 1517
            EK  ++VFKKSSPN K+T YLGKRDF+D+LD VDPV               VFV +  AFRYGREDLDVLGL+FRKDL++A+ Q +                R  TRLQ+RL++KLG +A+PF+F +P N P SVTLQPGP D GK CGVD+E++ + A + +EK+HKRNSV+L IRK+ +AP+KP PQPSAE  + F+MS  SL LEASLDKE YYHGE ++VNV V NNS KT+KKIK++VRQ+ADICL++   YKC V +LE +D     S  + +CKVY + PLLS+NR+KRGLALDGKLKHEDTNLASSTI+ E  NKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP D  P         L   +S       +       E++VP           +D +LI+ DT+             + DDD++FEDFARLRL G   +D
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPV---------------VFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAF---------PPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQV---SPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHIP---------LPRPQSAPTPTPPLPVPPAAPETDVP-----------VDTNLIEFDTN------------YATDDDIVFEDFARLRLKGMKDDD 400          
BLAST of slc6a-8 vs. Ensembl Celegans
Match: arr-1 (Beta-arrestin arr-1 [Source:UniProtKB/Swiss-Prot;Acc:P51485])

HSP 1 Score: 451.44 bits (1160), Expect = 2.918e-146
Identity = 264/483 (54.66%), Postives = 322/483 (66.67%), Query Frame = 3
Query:  111 LDDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKD-RKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVA---DNPDEKAHKR---NSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKNDP*PRPAP 1538
            +D+ KK GT       +VFKK+SPNGKIT YLGKRDFID  DYVD +DG+VLID +Y+KD RKV  H+LAAFRYGREDLDVLGLTFRKDL   + QVYP  +K        IS R L+RLQERL +KLG NA+PF+FE+   + +SVTLQP P D GKPCGVDYELKT+VA    +  EK  K    N+V+LAIRKLTYAP +  PQP  ++ K F+MS G L +E SLDKE YYHGESISVNV + NNSNKT+KK+KI + Q ADICL+   SY C V  +E  +GFP+    T   KV+ VCPLLSNN+DKRGLALDG+LKHEDTNLASSTI++  T+KE+LGI+VQY+VKVR VLG    ++  ELPFTL+H KP                      +SPE        T+  +P+ +   + S  +D DLIQL    + R           DDDLIFEDFAR+RL G D  D   +P+P
Sbjct:    2 VDEDKKSGT-------RVFKKTSPNGKITTYLGKRDFIDRGDYVDLIDGMVLIDEEYIKDNRKVTAHLLAAFRYGREDLDVLGLTFRKDLISETFQVYPQTDK-------SIS-RPLSRLQERLKRKLGANAFPFWFEVAPKSASSVTLQPAPGDTGKPCGVDYELKTFVAVTDGSSGEKPKKSALSNTVRLAIRKLTYAPFESRPQPMVDVSKYFMMSSGLLHMEVSLDKEMYYHGESISVNVHIQNNSNKTVKKLKIYIIQVADICLFTTASYSCEVARIESNEGFPVGPGGT-LSKVFAVCPLLSNNKDKRGLALDGQLKHEDTNLASSTILDSKTSKESLGIVVQYRVKVRAVLGPLNGELFAELPFTLTHSKPP---------------------ESPE-------RTDRGLPSIE-ATNGSEPVDIDLIQLHEELEPR----------YDDDLIFEDFARMRLHGNDSED---QPSP 426          
BLAST of slc6a-8 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 350.903 bits (899), Expect = 1.908e-106
Identity = 190/395 (48.10%), Postives = 262/395 (66.33%), Query Frame = 2
Query: 1982 DESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIW-KICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCY--FISNYLSLLEKNNNTNMFTD---SATEYLENNVLMVNQSSG--------IGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSVRAS 3124
            D   N E   DP  R+ W+ +LDFL S++GFAVD  N++RFPY+CF+NGGG FLIPY + +LL  +P+FY+EL  GQY R G +T W +ICPLFKG+GY  +L  FYV  +YNVI+AW L+YL+ SFS  LPW  C+  +NS  CY    S   + + ++ N ++  +   +A EY     L +++++         + +LG ++W++ALSL ++Y+I Y  ++KG+   GK VW TA+ PYVVL  L IRGV L G   GI+Y++ PNF+ML +P VW  AATQ+FFS+G GF V +AY+SYN+FH  V+ + L  + +N  TS  SGFVIF+ LGYMS +  KP+E V      L+F+VYP ALST+P   FW+V+FFLML  LGLDSS   S
Sbjct:   28 DGPVNTE-PKDP-AREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGS 420          
BLAST of slc6a-8 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 323.168 bits (827), Expect = 1.202e-102
Identity = 170/376 (45.21%), Postives = 253/376 (67.29%), Query Frame = 2
Query: 2003 NHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIW-KICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSP----TLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVV-NGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
                   R  WA++++FL +++G+AVD  N++RFP +C+++GGGAFLIPYF+ L++  LPMFY+EL+ GQ+ R G ++IW K+CPLF+G+GY    +  ++A++YN IIA ++Y+  VS S      +PW  C   WN+  C   S+ L++    N T + T S  EY    VL V +S+G  +LG +K +MA+ LL ++I++Y  L+KG +  GK VWVTA  PY++L+ LLIRG++L GA  G+ Y++TP+F+ L  P VW AAATQIFFS+G GF V +A +SYN+F+   + + +  + +N  TS FSG V+F+ LGYMS    KP+ +VV   + +LIFIVYP AL+T+    FW+ IFF+ML  LG+DS+
Sbjct:   93 RRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRC---SDDLNVTISRNGTPLTTPSE-EYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDST 464          

HSP 2 Score: 71.633 bits (174), Expect = 1.202e-102
Identity = 46/141 (32.62%), Postives = 69/141 (48.94%), Query Frame = 1
Query: 3157 FGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            F  +EA +TG  DE  F+ K  K+       V+  I YFLS P  +YGG F+I   D+Y    S+L +   E I   W YG+D  +  I+ M GF   I +R+ +   +P  I  I I  ++      + +   +YT+P W
Sbjct:  465 FAGIEAFITGFCDESRFLSKNRKW----FVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIYWRVCWT-CSPVFISVIFIMTVYNSSFKPIQMA--SYTFPWW 598          
BLAST of slc6a-8 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 295.049 bits (754), Expect = 2.981e-95
Identity = 165/399 (41.35%), Postives = 247/399 (61.90%), Query Frame = 2
Query: 2024 RKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPT-LPWTVCDKWWNSENCYFISNYLSLLEKNNNT--------NMFTDSATEYLEN---------------------------NVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
            R+ W+S  DF+ S IG+A+   NV+RFPY+C+QNGGGAFLIPY ++L+ C  P+F +E  +GQ M  GGL ++KICP+FKGVG A+ ++ F++ +YY V+++W+  YL+ SF+ + +PW  CD  WN+ NC   S Y+ +   +N T         +  D   EY +                            N  ++  SSG+ N G ++W++AL LLL++II YLC+FKGVK+ GK V++TA  PY++L  LLIRG+ LEGA  G+++++ P+F  LL+  VW+ A TQ+FFS G+G    +A  SYN F+  V+   L    VNS TS+F+GFVIF+++G+M+ Q  K + +V      L+F+ YP  +  LP   FW+ +FFLM+  LG+DS 
Sbjct:   10 REQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCR--SEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQ 406          

HSP 2 Score: 75.485 bits (184), Expect = 2.981e-95
Identity = 47/143 (32.87%), Postives = 71/143 (49.65%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSA-GPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            QF  +E   T I+DEF  + +K KY REI   V+  I Y + L   T GGF++ QL+D Y+A G +LL +   ECI   W  GID   + +K M G+     ++  + + TP     + +  L   +   ++     Y YP W
Sbjct:  406 QFCTMEGFFTAIIDEFPQIRRK-KYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRID--AYNYDYPVW 545          
BLAST of slc6a-8 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 271.552 bits (693), Expect = 2.294e-78
Identity = 143/390 (36.67%), Postives = 224/390 (57.44%), Query Frame = 2
Query: 1967 LAENSDESKNLEN--HSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEK-----NNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSV 3115
            L  +  ++K LE   HS+   R  W  + DFL S++ +AV   NV+RFPY+C++NGGG+FL+ Y +   L A+P+F +E+  GQY++ G + +W +CPLF+GVG  +V++ F    Y+ VI+AW+++Y+  S +   PW  C+ +WN   C       + L +      +       S  ++ E  VL  + +  I   G ++W +   +   ++I+Y  L+KG+    K V+  A+ PYV++  LLIRG+ LEGA  GI +++ PN   LL   VW  A TQ+F+S GVGF   IA  S+N F+     + +    +N  TS+ +GF +F+ LGYMSH  +K + ++V   + L F+ YP   S LP    +AV+FFLM+  LGLDS V
Sbjct:    9 LPTDEAKAKELEQSQHSEEPDRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGKENFTELARIKALVASAGGHTQTSVEQFWEKRVL--HDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQV 396          
BLAST of slc6a-8 vs. Ensembl Fly
Match: krz (gene:FBgn0040206 transcript:FBtr0305268)

HSP 1 Score: 464.922 bits (1195), Expect = 9.536e-151
Identity = 254/463 (54.86%), Postives = 321/463 (69.33%), Query Frame = 3
Query:  135 TSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLG--FGTSDISLELPFTLSHPKPADEE-PNMSNFTFEDLHSNKSKIQSP--EIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGD 1508
             S  ++ ++VFKKSS NGKIT YLGKRDF+D++ +VDP+DGVV IDP+Y+KDRKVF  VLAAFRYGREDLDVLGLTFRKDLYLA +Q+YPP+            +R +TRLQERLIKKLG NA+PFYFE+P   PASV+LQP P D GK CGVDYELK +V +N ++K HKRNSV+L IRK+ YAP K   QPS E+ K+F+M P  + LEA+LDKE Y+HGE ISVNV V NNSN+T+KKIK+ VRQ ADICL++   YK +V E+E EDG  +    T   KV+++CPLL+NN+DK GLALDG+LKHEDTNLASST+I     +E+LGI+V YKVKV+L++       D+  ELPFTL HPKP +EE P +         S ++ +      ++S +D  TES      +  +       +LIQLD               + DDD+IFEDFARLRL G +
Sbjct:   40 ASSRRQATRVFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLGLTFRKDLYLAHEQIYPPMQ----------LDRPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDVGKSCGVDYELKAFVGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVAPGFT-LSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLLISSPLLNGDLVAELPFTLMHPKPEEEEHPLLGE------RSPRASLAGGGLPLVSMSDGETESATGGQDVPTTT------NLIQLDDD------------EAQDDDIIFEDFARLRLKGAE 467          
BLAST of slc6a-8 vs. Ensembl Fly
Match: krz (gene:FBgn0040206 transcript:FBtr0085877)

HSP 1 Score: 464.922 bits (1195), Expect = 9.536e-151
Identity = 254/463 (54.86%), Postives = 321/463 (69.33%), Query Frame = 3
Query:  135 TSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLG--FGTSDISLELPFTLSHPKPADEE-PNMSNFTFEDLHSNKSKIQSP--EIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGD 1508
             S  ++ ++VFKKSS NGKIT YLGKRDF+D++ +VDP+DGVV IDP+Y+KDRKVF  VLAAFRYGREDLDVLGLTFRKDLYLA +Q+YPP+            +R +TRLQERLIKKLG NA+PFYFE+P   PASV+LQP P D GK CGVDYELK +V +N ++K HKRNSV+L IRK+ YAP K   QPS E+ K+F+M P  + LEA+LDKE Y+HGE ISVNV V NNSN+T+KKIK+ VRQ ADICL++   YK +V E+E EDG  +    T   KV+++CPLL+NN+DK GLALDG+LKHEDTNLASST+I     +E+LGI+V YKVKV+L++       D+  ELPFTL HPKP +EE P +         S ++ +      ++S +D  TES      +  +       +LIQLD               + DDD+IFEDFARLRL G +
Sbjct:   40 ASSRRQATRVFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLGLTFRKDLYLAHEQIYPPMQ----------LDRPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDVGKSCGVDYELKAFVGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVAPGFT-LSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLLISSPLLNGDLVAELPFTLMHPKPEEEEHPLLGE------RSPRASLAGGGLPLVSMSDGETESATGGQDVPTTT------NLIQLDDD------------EAQDDDIIFEDFARLRLKGAE 467          
BLAST of slc6a-8 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 367.851 bits (943), Expect = 6.646e-119
Identity = 192/408 (47.06%), Postives = 267/408 (65.44%), Query Frame = 2
Query: 2000 ENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIW-KICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCY-----------FISNYLSLLEKNNNTNM---------------------FTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSVRAS 3124
            +N+S    R+ W+ ++DFL S+IGFAVD +NV+RFPY+C++NGGGAFL+PY + L++  +P+FY+EL  GQ+ R G +T W ++ PLFKG+GYA VL+ FYV  YYNVIIAWSL + F SF+ +LPWT C+  WN+ NC             I NY  L    N + +                     F  +A+EY    +L +N+S GI +LG +KW+MAL LL++Y+I Y  L+KG+   GK VW TA+ PY VL  LLIRG+ L G+  GI+Y++TPNF  + K +VW+ AATQ+FFS+G GF V +AYASYN +H  V+ + L+ + +NS TS  +GFVIF+ LGYM+H +   +E V      L+F+VYP A++T+P   FWA+IFF+ML  LGLDSS   S
Sbjct:   19 DNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGS 426          

HSP 2 Score: 81.6481 bits (200), Expect = 6.646e-119
Identity = 46/142 (32.39%), Postives = 74/142 (52.11%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
             FG  EA++T + DEF     K+K  RE+  A + ++ + + L + T GGF+   L D+Y+AG S+L     E I   WIYG +  ++ I+ M GF     +++ ++++ P  +L IT+  L   E  T       Y YP W
Sbjct:  422 SFGGSEAIITALSDEF----PKIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTY----ADYVYPSW 555          
BLAST of slc6a-8 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 367.466 bits (942), Expect = 9.988e-119
Identity = 192/408 (47.06%), Postives = 267/408 (65.44%), Query Frame = 2
Query: 2000 ENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIW-KICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCY-----------FISNYLSLLEKNNNTNM---------------------FTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSVRAS 3124
            +N+S    R+ W+ ++DFL S+IGFAVD +NV+RFPY+C++NGGGAFL+PY + L++  +P+FY+EL  GQ+ R G +T W ++ PLFKG+GYA VL+ FYV  YYNVIIAWSL + F SF+ +LPWT C+  WN+ NC             I NY  L    N + +                     F  +A+EY    +L +N+S GI +LG +KW+MAL LL++Y+I Y  L+KG+   GK VW TA+ PY VL  LLIRG+ L G+  GI+Y++TPNF  + K +VW+ AATQ+FFS+G GF V +AYASYN +H  V+ + L+ + +NS TS  +GFVIF+ LGYM+H +   +E V      L+F+VYP A++T+P   FWA+IFF+ML  LGLDSS   S
Sbjct:   19 DNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGS 426          

HSP 2 Score: 81.6481 bits (200), Expect = 9.988e-119
Identity = 46/142 (32.39%), Postives = 74/142 (52.11%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
             FG  EA++T + DEF     K+K  RE+  A + ++ + + L + T GGF+   L D+Y+AG S+L     E I   WIYG +  ++ I+ M GF     +++ ++++ P  +L IT+  L   E  T       Y YP W
Sbjct:  422 SFGGSEAIITALSDEF----PKIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTY----ADYVYPSW 555          
BLAST of slc6a-8 vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 363.614 bits (932), Expect = 5.016e-117
Identity = 183/366 (50.00%), Postives = 254/366 (69.40%), Query Frame = 2
Query: 2018 QTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWK-ICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
            +TR+ W  + +FL ++IGFAVD  NV+RFPYIC+QNGGGAFL+PY + L+   LP+FY+EL  GQ+ RCG L+IWK ICP  KGVGYA  L++ Y+ +YYN II W++YYLF SF+  LPWT CD  WN+ENC  +++        N T + T  A E+ E  VL   + +G+  +GP+K  +AL +  +++++Y  L+KGV+  GK VWVTA+ PYVVL  LL+RGV L GA EGIKY++TP +  L    VWI AA+QIFFS+G GF   +A +SYN F+   + + LI +++N LTS  +GFVIF+ LGYM++  +  ++KV      L+FIVYP A++T+ G  FW++IFFLML  LGLDS+
Sbjct:   72 RTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTS-------ENFTELATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDST 430          

HSP 2 Score: 80.1073 bits (196), Expect = 5.016e-117
Identity = 47/141 (33.33%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 3157 FGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            FG LEA++T + DE+  V  +   +RE+   ++L  ++  +LP  TYGG  L+   + Y  G ++L V  +E  G  W YG+D  +  ++QM G    + +RI + YI+P  +L I I   F+   +   LG   Y YP W
Sbjct:  431 FGGLEAMITALCDEYPRVIGR---RRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFI---FSIMGYKEMLG-EEYYYPDW 564          
BLAST of slc6a-8 vs. Ensembl Zebrafish
Match: arrb2b (arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1332])

HSP 1 Score: 483.411 bits (1243), Expect = 1.248e-158
Identity = 259/453 (57.17%), Postives = 320/453 (70.64%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            +K  ++VFKKSSPN K+T YLGKRDF+D+LD+VDPVDGV+LIDP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDL+++S Q YPPL        PD   + L+RLQERL+KKLG NAYPF F +P N P SVTLQPGP D GK CGVD+E++ + A   DEK HKRNSV+L IRK+ YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V ++E +D     SS + +CKVY + P LSNNR+KRGLALDG+LKHEDTNLASSTI+ + +NKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP+ E+PN             S+ QS           E++VP           +D +LI+ +T           N  S DDD +FEDFARLRL G
Sbjct:    3 DKAGTRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVLLIDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFISSFQAYPPL--------PD-ERKPLSRLQERLLKKLGQNAYPFNFTIPQNLPCSVTLQPGPEDTGKACGVDFEVRAFCAKTVDEKTHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQVEADDQV---SSSSTFCKVYTLTPTLSNNREKRGLALDGQLKHEDTNLASSTIVKDVSNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPS-EQPN-------------SRPQS--------AVPETDVP-----------VDANLIEFET-----------NNFSQDDDFVFEDFARLRLKG 398          
BLAST of slc6a-8 vs. Ensembl Zebrafish
Match: arrb1 (arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-1])

HSP 1 Score: 474.552 bits (1220), Expect = 3.631e-155
Identity = 255/457 (55.80%), Postives = 311/457 (68.05%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGG 1505
            ++VFKK+SPNGK+T YLGKRDF+D++D V+PVDGVVLIDP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP+ +           + LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVD+E+K + A+N +EK HKRNSV+L IRK+ YAP+KP PQP AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D   I +    +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  NKE LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP +E        + D   N +                               ID +LI+ DT+               DDD+IFEDFAR RL G 
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPE---------EKKSLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENVEEKIHKRNSVRLVIRKVQYAPEKPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAIEESDD---IVAPSATFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPLEES------IYRDAPENDAP------------------------------IDTNLIEFDTN---------------DDDIIFEDFARQRLIGA 399          
BLAST of slc6a-8 vs. Ensembl Zebrafish
Match: arrb2a (arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131-29])

HSP 1 Score: 466.848 bits (1200), Expect = 2.201e-152
Identity = 248/453 (54.75%), Postives = 317/453 (69.98%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            +K  ++VFKKSSPN K+T YLGKRDF+D+LD+VDPVDGV+L+DP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDLY+ + Q YPP+ +          ++  +RLQERL+KKLG NAYPF+F +P N P SVTLQPGP D GK CGVD+E++ + A + +EK HKRNSV+L IRK+ YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V ++E +D     +S + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASSTI+ + +NKE LG++V Y+VKV+LV+  G  D+S+ELPF L HPKP+                             +  ++ S VP   +L+     ID +LI+ DT           N L  DDD++FEDFARLRL G
Sbjct:    3 DKAGTRVFKKSSPNCKVTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYIFTFQAYPPIPE---------ESKPHSRLQERLLKKLGQNAYPFHFSIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSMEEKNHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQV---ASSSTFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKDVSNKEVLGVLVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPS---------------------------ESSLSHSTSAVP---MLDPP---IDTNLIEFDT-----------NSLIPDDDIVFEDFARLRLKG 398          
BLAST of slc6a-8 vs. Ensembl Zebrafish
Match: arrb2a (arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131-29])

HSP 1 Score: 464.151 bits (1193), Expect = 3.169e-151
Identity = 248/460 (53.91%), Postives = 317/460 (68.91%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            +K  ++VFKKSSPN K+T YLGKRDF+D+LD+VDPVDGV+L+DP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDLY+ + Q YPP+ +          ++  +RLQERL+KKLG NAYPF+F +P N P SVTLQPGP D GK CGVD+E++ + A + +EK HKRNSV+L IRK+ YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V ++E +D     +S + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASSTI+ + +NKE LG++V Y+VKV+LV+  G         D+S+ELPF L HPKP+                             +  ++ S VP   +L+     ID +LI+ DT           N L  DDD++FEDFARLRL G
Sbjct:    3 DKAGTRVFKKSSPNCKVTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYIFTFQAYPPIPE---------ESKPHSRLQERLLKKLGQNAYPFHFSIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSMEEKNHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQV---ASSSTFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKDVSNKEVLGVLVSYRVKVKLVVSRGGLLSSLLERDVSVELPFVLMHPKPS---------------------------ESSLSHSTSAVP---MLDPP---IDTNLIEFDT-----------NSLIPDDDIVFEDFARLRLKG 406          
BLAST of slc6a-8 vs. Ensembl Zebrafish
Match: slc6a2 (solute carrier family 6 member 2 [Source:ZFIN;Acc:ZDB-GENE-110408-4])

HSP 1 Score: 360.147 bits (923), Expect = 1.007e-121
Identity = 190/419 (45.35%), Postives = 270/419 (64.44%), Query Frame = 2
Query: 1871 KMQNIELNESKLI--KSHXXXXXXXXXXCRTIALLAENSDESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNT--NMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSV 3115
            K  N+E  E +LI  K  N +   N S   + +  A  S   + +E       R+ W  ++DFL S+IGFAVD +NV+RFPY+C++NGGGAFLIPY + L +  +P+FY+EL  GQY R G  T+WKICP+FKGVGY  +++  YV  YYNVIIAWSLYYL+ S +  LPW  C+  WNS NC    +    +  N  +        A E+ E  VL  ++S GIG+LG  +W + + L+++  I+Y  L+KGVK  GK V++TA +PY+VL  LLIRG+ L GA+ GI+ ++  + K L  P VWI AATQIFFS+G GF V IA++SYN F+   + + ++ + +N +TS FSGF IF+ LGYM+ Q +  ++ V      L+F++YP A+STLPG  F+A++FF+ML  LG+DSS+
Sbjct:   18 KQFNVEKKEVELILVKEQNGVQYTNSSVVASPSSRACTSASGEEIE-------RETWGKKMDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYVLFLFIAGMPLFYMELALGQYNREGAATLWKICPVFKGVGYTVIVIALYVGFYYNVIIAWSLYYLYASLTSELPWLHCNNPWNSPNCTEPKDINGTVLGNGTSYAKYKNTPAAEFYERGVLHSHESKGIGDLGLPRWELTICLVVVAFILYFSLWKGVKSSGKVVYITATMPYIVLLVLLIRGITLPGAMNGIRAYLHIDLKKLNNPQVWIDAATQIFFSLGAGFGVLIAFSSYNKFNNNCYRDAILTSTINCVTSFFSGFAIFSVLGYMAEQHKVNIKDVATEGAGLVFVIYPEAISTLPGATFFAIVFFIMLLTLGIDSSM 429          

HSP 2 Score: 99.3673 bits (246), Expect = 1.007e-121
Identity = 65/208 (31.25%), Postives = 119/208 (57.21%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQWXXXXXXXXXXXXXXXXXXFGGVVLYRIKATSWKERICLSISPNWEHRDIRSKTQFNRLKINHWITV 3777
              G +EA+LTG+ D+F    K +K  R++ T   +   + ++L   T GG +++ L DKY+AG S+L   L E IG  W YG+D  ++ I++M GF   I +R+ +K+++P  +L + IA + T    T +     Y +P W+ ++G  I+LSS++ +P +     + +  +S+KER+   ++P  EH  + ++    + K+ HW+T+
Sbjct:  428 SMGGMEAVLTGLSDDF----KILKRNRKLFTFATVVGTFLMALLCVTNGGIYVLTLLDKYAAGTSILFGVLFEAIGVSWFYGVDRFSEDIERMMGFKPGIYWRLCWKFVSPAFLLLVVIASIVTSGRLTYD----EYVFPYWADMLGWSIALSSMLFVPFYAIYKFFSVP-SSFKERLAYCVTPEHEHH-LVAEGNVRQFKLKHWLTI 625          
BLAST of slc6a-8 vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 427.172 bits (1097), Expect = 3.468e-137
Identity = 248/447 (55.48%), Postives = 307/447 (68.68%), Query Frame = 3
Query:  162 VFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            V  +S P   +T YLGKRDF+D++D VDPVDGVVL+DP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP+ +   +K P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP AE  + F+MS   L LEASLDKE YYHGE I+VNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E ++   + +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ +  NKE LGIIV YKVKV+LV+  G  D+++ELPFTL HPKP  EEP         LH    + ++P                          ID +LI+ DT+               DDD++FEDFAR RL G
Sbjct:    3 VSGRSCPPVALTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPE---EKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADND--VVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPT-EEP---------LHREVPENEAP--------------------------IDTNLIEFDTN---------------DDDIVFEDFARQRLKG 386          
BLAST of slc6a-8 vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 424.476 bits (1090), Expect = 3.373e-136
Identity = 245/437 (56.06%), Postives = 303/437 (69.34%), Query Frame = 3
Query:  192 ITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            +T YLGKRDF+D++D VDPVDGVVL+DP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP+ +   +K P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP AE  + F+MS   L LEASLDKE YYHGE I+VNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E ++   + +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ +  NKE LGIIV YKVKV+LV+  G  D+++ELPFTL HPKP  EEP         LH    + ++P                          ID +LI+ DT+               DDD++FEDFAR RL G
Sbjct:   13 LTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPE---EKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADND--VVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPT-EEP---------LHREVPENEAP--------------------------IDTNLIEFDTN---------------DDDIVFEDFARQRLKG 386          
BLAST of slc6a-8 vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 424.861 bits (1091), Expect = 5.127e-136
Identity = 245/438 (55.94%), Postives = 304/438 (69.41%), Query Frame = 3
Query:  189 KITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++T YLGKRDF+D++D VDPVDGVVL+DP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP+ +   +K P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP AE  + F+MS   L LEASLDKE YYHGE I+VNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E ++   + +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ +  NKE LGIIV YKVKV+LV+  G  D+++ELPFTL HPKP  EEP         LH    + ++P                          ID +LI+ DT+               DDD++FEDFAR RL G
Sbjct:   32 QLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPE---EKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADND--VVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPT-EEP---------LHREVPENEAP--------------------------IDTNLIEFDTN---------------DDDIVFEDFARQRLKG 406          
BLAST of slc6a-8 vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 424.476 bits (1090), Expect = 6.137e-136
Identity = 247/445 (55.51%), Postives = 306/445 (68.76%), Query Frame = 3
Query:  189 KITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            K+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP+ +   +K P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP AE  + F+MS   L LEASLDKE YYHGE I+VNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E ++   + +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ +  NKE LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP  EEP         LH    + ++P                          ID +LI+ DT+               DDD++FEDFAR RL G
Sbjct:   25 KLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPE---EKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADND--VVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPT-EEP---------LHREVPENEAP--------------------------IDTNLIEFDTN---------------DDDIVFEDFARQRLKG 407          
BLAST of slc6a-8 vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 424.476 bits (1090), Expect = 9.674e-136
Identity = 246/445 (55.28%), Postives = 306/445 (68.76%), Query Frame = 3
Query:  189 KITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++T YLGKRDF+D++D VDPVDGVVL+DP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP+ +   +K P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP AE  + F+MS   L LEASLDKE YYHGE I+VNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E ++   + +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ +  NKE LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP  EEP         LH    + ++P                          ID +LI+ DT+               DDD++FEDFAR RL G
Sbjct:   32 QLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPE---EKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADND--VVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPT-EEP---------LHREVPENEAP--------------------------IDTNLIEFDTN---------------DDDIVFEDFARQRLKG 414          
BLAST of slc6a-8 vs. Ensembl Mouse
Match: Arrb1 (arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473])

HSP 1 Score: 473.011 bits (1216), Expect = 1.367e-154
Identity = 252/449 (56.12%), Postives = 313/449 (69.71%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +A PF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G  D+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDNV---APSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPKEEPP----------HREVPESETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 390          
BLAST of slc6a-8 vs. Ensembl Mouse
Match: Arrb1 (arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473])

HSP 1 Score: 473.011 bits (1216), Expect = 1.944e-154
Identity = 253/456 (55.48%), Postives = 315/456 (69.08%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +A PF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDNV---APSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP----------HREVPESETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 398          
BLAST of slc6a-8 vs. Ensembl Mouse
Match: Arrb1 (arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473])

HSP 1 Score: 471.085 bits (1211), Expect = 7.918e-154
Identity = 253/457 (55.36%), Postives = 314/457 (68.71%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVL--------GFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +A PF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+        G   SD+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDNV---APSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLAGRGVCFSDVAVELPFTLMHPKPKEEPP----------HREVPESETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 399          
BLAST of slc6a-8 vs. Ensembl Mouse
Match: Arrb2 (arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474])

HSP 1 Score: 460.685 bits (1184), Expect = 9.006e-150
Identity = 250/462 (54.11%), Postives = 317/462 (68.61%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMS-PGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEI---ISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKND 1517
            EK  ++VFKKSSPN K+T YLGKRDF+D+LD VDPVDGVVL+DPDYLKDRKVFV +  AFRYGREDLDVLGL+FRKDL++A+ Q +                R  TRLQ+RL+KKLG +A+PF+F +P N P SVTLQPGP D GK CGVD+E++ + A + +EK+HKRNSV+L IRK+ +AP+ P PQPSAE  + F+MS   SL LEASLDKE YYHGE ++VNV V NNS KT+KKI+++VRQ+ADICL++   YKC V +LE +D     S  + +CKVY + PLLS+NR+KRGLALDG+LKHEDTNLASSTI+ E  NKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP D             H    + QS  I   +       E++VP           +D +LI+ DT+             + DDD++FEDFARLRL G   +D
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAF---------PPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQV---SPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHD-------------HITLPRPQSAPIHPPLLCPSAPRETDVP-----------VDTNLIEFDTN------------YATDDDIVFEDFARLRLKGMKDDD 415          
BLAST of slc6a-8 vs. Ensembl Mouse
Match: Arrb2 (arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474])

HSP 1 Score: 460.685 bits (1184), Expect = 9.006e-150
Identity = 250/462 (54.11%), Postives = 317/462 (68.61%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMS-PGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEI---ISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKND 1517
            EK  ++VFKKSSPN K+T YLGKRDF+D+LD VDPVDGVVL+DPDYLKDRKVFV +  AFRYGREDLDVLGL+FRKDL++A+ Q +                R  TRLQ+RL+KKLG +A+PF+F +P N P SVTLQPGP D GK CGVD+E++ + A + +EK+HKRNSV+L IRK+ +AP+ P PQPSAE  + F+MS   SL LEASLDKE YYHGE ++VNV V NNS KT+KKI+++VRQ+ADICL++   YKC V +LE +D     S  + +CKVY + PLLS+NR+KRGLALDG+LKHEDTNLASSTI+ E  NKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP D             H    + QS  I   +       E++VP           +D +LI+ DT+             + DDD++FEDFARLRL G   +D
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAF---------PPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQV---SPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHD-------------HITLPRPQSAPIHPPLLCPSAPRETDVP-----------VDTNLIEFDTN------------YATDDDIVFEDFARLRLKGMKDDD 415          
BLAST of slc6a-8 vs. UniProt/SwissProt
Match: sp|Q4R562|ARRB1_MACFA (Beta-arrestin-1 OS=Macaca fascicularis OX=9541 GN=ARRB1 PE=2 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 3.277e-155
Identity = 256/449 (57.02%), Postives = 315/449 (70.16%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G  D+++ELPFTL HPKP  EEP         LH    + Q+P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADD---TVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPK-EEP---------LHREVPENQTP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 390          
BLAST of slc6a-8 vs. UniProt/SwissProt
Match: sp|P29066|ARRB1_RAT (Beta-arrestin-1 OS=Rattus norvegicus OX=10116 GN=Arrb1 PE=1 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 9.454e-155
Identity = 254/456 (55.70%), Postives = 316/456 (69.30%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADD---TVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP----------HREVPESETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 398          
BLAST of slc6a-8 vs. UniProt/SwissProt
Match: sp|P49407|ARRB1_HUMAN (Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1 PE=1 SV=2)

HSP 1 Score: 475.707 bits (1223), Expect = 1.073e-154
Identity = 254/456 (55.70%), Postives = 316/456 (69.30%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADD---TVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP----------HREVPENETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 398          
BLAST of slc6a-8 vs. UniProt/SwissProt
Match: sp|P17870|ARRB1_BOVIN (Beta-arrestin-1 OS=Bos taurus OX=9913 GN=ARRB1 PE=1 SV=1)

HSP 1 Score: 474.552 bits (1220), Expect = 2.573e-154
Identity = 253/456 (55.48%), Postives = 316/456 (69.30%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D V+PVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADD---TVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP----------HREVPEHETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 398          
BLAST of slc6a-8 vs. UniProt/SwissProt
Match: sp|Q8BWG8|ARRB1_MOUSE (Beta-arrestin-1 OS=Mus musculus OX=10090 GN=Arrb1 PE=1 SV=1)

HSP 1 Score: 473.011 bits (1216), Expect = 1.360e-153
Identity = 253/456 (55.48%), Postives = 315/456 (69.08%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            ++VFKK+SPNGK+T YLGKRDF+D++D VDPVDGVVL+DP+YLK+R+V+V +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP  +   DK P      LTRLQERLIKKLG +A PF FE+P N P SVTLQPGP D GK CGVDYE+K + A+N +EK HKRNSV+L IRK+ YAP++P PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KKIKI+VRQ+ADICL+N   YKC V   E +D     +  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  N+E LGIIV YKVKV+LV+  G       +SD+++ELPFTL HPKP +E P          H    + ++P                          +D +LI+LDT+               DDD++FEDFAR RL G
Sbjct:    6 TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE---DKKP------LTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDNV---APSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP----------HREVPESETP--------------------------VDTNLIELDTN---------------DDDIVFEDFARQRLKG 398          
BLAST of slc6a-8 vs. TrEMBL
Match: A0A0H3YK12 (Slc6a-8 OS=Schmidtea mediterranea OX=79327 GN=slc6a-8 PE=2 SV=1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 2
Query: 1874 MQNIELNESKLIKSHXXXXXXXXXXCRTIALLAENSDESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSVRASIILNFELIYFSSEPLKLY 3178
            MQNIELNESKLIKSHNNINNENPSNCRTIALLAENSDESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMALSLLLLYIIIYLCLFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSVRASIILNFELIYFSSEPLKLY
Sbjct:    1 MQNIELNESKLIKSHNNINNENPSNCRTIALLAENSDESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMALSLLLLYIIIYLCLFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSVRASIILNFELIYFSSEPLKLY 435          
BLAST of slc6a-8 vs. TrEMBL
Match: A0A1I8FTU6 (Arrestin_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004557g1 PE=4 SV=1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 304/481 (63.20%), Postives = 362/481 (75.26%), Query Frame = 3
Query:   93 NNHDVDLDDI----KKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELP-HNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENT-NKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKND 1517
            NN DV+        K Q    +++ ++VFKKSSPNGKITAYLGKRDF+D+L +VDP+DGVVL+DPDY+KDRKV+ HVLAAFRYGREDLDVLGLTFRKDLY+A  QVYPP+           + + LTRLQERLIKKLG NA+PF+FELP   +PASVTLQPGPND+GKPCGVDYELKTYVA+  D K+HKR++V+LAIRKLTYAP++P PQPSAE  K+FIMS G LRLEASLDKEKYYHGESI++NVLVDNN++KT+KK++I+VRQ ADICL++  SYKC V ELE E+GFPI  SQTGWCKVY VCPLL+NNRDKRGLALDG+LKHEDTNLASSTI+ + + +KENLGI+V Y+VKVRLVLGFG+SD+ +ELPF L+HPKP +          EDL S      +      T               +DS I+D DLI LD   D     +    L  DDDLIFEDFARLRL G  + D
Sbjct:   21 NNGDVNQSSTDPSAKSQQAQSQRQGTRVFKKSSPNGKITAYLGKRDFVDHLTHVDPIDGVVLVDPDYMKDRKVYAHVLAAFRYGREDLDVLGLTFRKDLYIACMQVYPPIKD---------NAKPLTRLQERLIKKLGDNAHPFFFELPPQQSPASVTLQPGPNDSGKPCGVDYELKTYVAETADGKSHKRSTVRLAIRKLTYAPEQPGPQPSAETTKEFIMSAGCLRLEASLDKEKYYHGESIAINVLVDNNTSKTVKKVRISVRQIADICLFSPNSYKCGVAELESEEGFPIGPSQTGWCKVYHVCPLLANNRDKRGLALDGQLKHEDTNLASSTILKDASQSKENLGIVVNYRVKVRLVLGFGSSDVCVELPFVLTHPKPCE----------EDL-SEAGDAPAAASAGSTSKAAAPEPAAAAAAAADSDILDTDLIHLDAGSDGARSLH----LHPDDDLIFEDFARLRLQGHGEED 477          
BLAST of slc6a-8 vs. TrEMBL
Match: A0A1I8J0I0 (Arrestin_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010879g1 PE=4 SV=1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 304/481 (63.20%), Postives = 362/481 (75.26%), Query Frame = 3
Query:   93 NNHDVDLDDI----KKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELP-HNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENT-NKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKND 1517
            NN DV+        K Q    +++ ++VFKKSSPNGKITAYLGKRDF+D+L +VDP+DGVVL+DPDY+KDRKV+ HVLAAFRYGREDLDVLGLTFRKDLY+A  QVYPP+           + + LTRLQERLIKKLG NA+PF+FELP   +PASVTLQPGPND+GKPCGVDYELKTYVA+  D K+HKR++V+LAIRKLTYAP++P PQPSAE  K+FIMS G LRLEASLDKEKYYHGESI++NVLVDNN++KT+KK++I+VRQ ADICL++  SYKC V ELE E+GFPI  SQTGWCKVY VCPLL+NNRDKRGLALDG+LKHEDTNLASSTI+ + + +KENLGI+V Y+VKVRLVLGFG+SD+ +ELPF L+HPKP +          EDL S      +      T               +DS I+D DLI LD   D     +    L  DDDLIFEDFARLRL G  + D
Sbjct:   21 NNGDVNQSSTDPSAKTQQAQSQRQGTRVFKKSSPNGKITAYLGKRDFVDHLTHVDPIDGVVLVDPDYMKDRKVYAHVLAAFRYGREDLDVLGLTFRKDLYIACMQVYPPIKD---------NAKPLTRLQERLIKKLGDNAHPFFFELPPQQSPASVTLQPGPNDSGKPCGVDYELKTYVAETADGKSHKRSTVRLAIRKLTYAPEQPGPQPSAETTKEFIMSAGCLRLEASLDKEKYYHGESIAINVLVDNNTSKTVKKVRISVRQIADICLFSPNSYKCGVAELESEEGFPIGPSQTGWCKVYHVCPLLANNRDKRGLALDGQLKHEDTNLASSTILKDASQSKENLGIVVNYRVKVRLVLGFGSSDVCVELPFVLTHPKPCE----------EDL-SEAGDAPAAASAGSTSKAAAPEPAAAAAAAADSDILDTDLIHLDAGSDGARSLH----LHPDDDLIFEDFARLRLQGHGEED 477          
BLAST of slc6a-8 vs. TrEMBL
Match: A0A1V1FN69 (Beta-arrestin OS=Ambigolimax valentianus OX=1338344 PE=2 SV=1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 299/469 (63.75%), Postives = 353/469 (75.27%), Query Frame = 3
Query:  114 DDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILS-ADDDLIFEDFARLRLTGGDKND 1517
            D  KKQGT       +VFKKS PNGK+T YLGKRDFID+L ++DP+DGV+L+DPDYLKDRKVF H+LAAFRYGREDLDVLGLTFRKDLYL+S QVYPP+   +        ++ LTRLQERLIKKLG NAYPF+FELP N+PASVTLQP P D GKPCGVDYELKT+VADN DEK HKRNSV+LAIRKLTYAP++P+PQP+AE +KDFIMSPGS+RLEASLDKEKYYHGESI++NVLVDNN+NKT+KKIKI+VRQ ADICL++   YKC V +LE E+GFPI SSQTG+CKV+ + PLLSNNRDKRGLALDGKLKHEDTNLASSTI+ E + KE+LGI+V Y+VKV+L++GF + ++++ELPFTL+HPKP D                          S     + S  P     E      D +LIQLD        TN E      DDD IFEDFARLRL G + +D
Sbjct:   17 DQQKKQGT-------RVFKKSCPNGKVTTYLGKRDFIDHLSHIDPIDGVILVDPDYLKDRKVFAHILAAFRYGREDLDVLGLTFRKDLYLSSMQVYPPVKDSK-------ESKPLTRLQERLIKKLGPNAYPFFFELPPNSPASVTLQPAPGDTGKPCGVDYELKTFVADNIDEKPHKRNSVRLAIRKLTYAPEEPAPQPNAEALKDFIMSPGSMRLEASLDKEKYYHGESIAINVLVDNNTNKTVKKIKISVRQFADICLFSTAQYKCTVADLESEEGFPIQSSQTGFCKVFHMTPLLSNNRDKRGLALDGKLKHEDTNLASSTIMTEKSQKESLGIVVSYRVKVKLIMGFTSGELAVELPFTLTHPKPPD--------------------------SPAPSRSASTAPP----EGGDASFDTNLIQLD--------TNGEAFYGDKDDDFIFEDFARLRLKGHEGDD 433          
BLAST of slc6a-8 vs. TrEMBL
Match: A0A2T7NC68 (Arrestin_C domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_21283 PE=4 SV=1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 299/454 (65.86%), Postives = 351/454 (77.31%), Query Frame = 3
Query:  162 VFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRK-LTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILS-ADDDLIFEDFARLRLTGGDKND 1517
            VFKKSSPNGKIT YLGKRDFID+L ++DP+DGVVL+DP+YLKDRKV+ H+LAAFRYGREDLDVLGLTFRKDLYL+S QVYPP+         D S  K LTRLQERLIKKLG NAYPFYFELP N PASVTLQP P D GKPCGVDYELKTYVADN DEK HKRNSV+LAIRKLTYAP++P+PQPSAE VKDF+MSPGS+RLEASLDKEKYYHGESI++NVLVDNN+NKT+KK+K++VRQ ADICL++   YKC V E+E E+GFPI  SQTG+CKVY +CPLL+NNRDKRGLALDGKLKHEDTNLASSTI+ E + KENLGI+V Y+VKV+L+LGFG+ D+S+ELPFTL+HPKP +  P     +         ++++P                          +D +LI+LD        TN E   +  DDD IFEDFARLRL G + +D
Sbjct:  183 VFKKSSPNGKITTYLGKRDFIDHLTHIDPIDGVVLVDPEYLKDRKVYAHILAAFRYGREDLDVLGLTFRKDLYLSSMQVYPPVK--------DHSEPKPLTRLQERLIKKLGPNAYPFYFELPPNAPASVTLQPAPGDTGKPCGVDYELKTYVADNVDEKPHKRNSVRLAIRKLTYAPEEPAPQPSAEAVKDFMMSPGSIRLEASLDKEKYYHGESIALNVLVDNNTNKTVKKVKLSVRQFADICLFSTAQYKCTVAEMESEEGFPIQPSQTGFCKVYHLCPLLTNNRDKRGLALDGKLKHEDTNLASSTIMTEKSQKENLGIVVSYRVKVKLILGFGSGDLSVELPFTLTHPKPIESPPPSRPPS-----MVPPEVETP--------------------------VDANLIKLD--------TNGEPFYADKDDDFIFEDFARLRLKGHEGDD 589          
BLAST of slc6a-8 vs. Ensembl Cavefish
Match: arrb2a (arrestin red cell [Source:NCBI gene;Acc:103028079])

HSP 1 Score: 474.167 bits (1219), Expect = 4.138e-155
Identity = 249/460 (54.13%), Postives = 314/460 (68.26%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG-------TSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            +K  ++VFKKSSPN KIT YLGKRDF+D+LD VDPVDGV+L+DP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDLY+++ Q +PP+ +   ++ P+      +RLQERL+KKLG  A+PF+F +P N P SVTLQPGP D GK CGVDYE++ + A + +EK HKRNSV+L IRK+ YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V ++E +D     SS + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASSTI+ E  NKE LG++V Y+VKV+LV+  G         D+S+ELPF L HPKP             DL +++     PE+    D N                     LI+ +T           N  + DDDL+FEDFARLRL G
Sbjct:    3 DKAGTRVFKKSSPNCKITVYLGKRDFVDHLDQVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPIQE---ERKPN------SRLQERLLKKLGQQAHPFHFTIPQNLPCSVTLQPGPEDTGKACGVDYEIRAFCARSVEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQV---SSSSTFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKEGCNKEVLGVLVSYRVKVKLVVSRGGLLSSLLERDVSVELPFVLMHPKPI------------DLSTSRPASAVPEVDPPIDTN---------------------LIEFET-----------NSFAQDDDLVFEDFARLRLKG 406          
BLAST of slc6a-8 vs. Ensembl Cavefish
Match: arrb1 (arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-1])

HSP 1 Score: 464.537 bits (1194), Expect = 4.651e-152
Identity = 232/358 (64.80%), Postives = 281/358 (78.49%), Query Frame = 3
Query:  159 KVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADE 1232
            +VFKK+SPNGK+T YLGKRDF+D++D V+PVDGVVLIDP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL++A+ Q +PP+ +           + LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVD+E+K + A+N +EK HKRNSV+L IRK+ YAP+KP PQP AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+KK+KI+VRQ+ADICL+N   YKC V   E +D   I +    +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASST++ E  NKE LGIIV YKVKV+LV+  G  D+++ELPFTL HPKP +E
Sbjct:   17 RVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPE---------EKKGLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENVEEKIHKRNSVRLIIRKVQYAPEKPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKMKISVRQYADICLFNTAQYKCPVATEESDD---IVAPSATFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPVEE 361          
BLAST of slc6a-8 vs. Ensembl Cavefish
Match: arrb2a (arrestin red cell [Source:NCBI gene;Acc:103028079])

HSP 1 Score: 458.373 bits (1178), Expect = 1.109e-148
Identity = 250/489 (51.12%), Postives = 317/489 (64.83%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGK------------------------------------ITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTG 1502
            +K  ++VFKKSSPN K                                    IT YLGKRDF+D+LD VDPVDGV+L+DP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDLY+++ Q +PP+ +   ++ P+      +RLQERL+KKLG  A+PF+F +P N P SVTLQPGP D GK CGVDYE++ + A + +EK HKRNSV+L IRK+ YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V ++E +D     SS + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASSTI+ E  NKE LG++V Y+VKV+LV+  G  D+S+ELPF L HPKP             DL +++     PE+          + P           ID +LI+ +T           N  + DDDL+FEDFARLRL G
Sbjct:    3 DKAGTRVFKKSSPNCKVNFTAYFQFFFEHLSLFLFVIVFIMHELIMHSVLFQITVYLGKRDFVDHLDQVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPIQE---ERKPN------SRLQERLLKKLGQQAHPFHFTIPQNLPCSVTLQPGPEDTGKACGVDYEIRAFCARSVEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQ---VSSSSTFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKEGCNKEVLGVLVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPI------------DLSTSRPASAVPEV----------DPP-----------IDTNLIEFET-----------NSFAQDDDLVFEDFARLRLKG 434          
BLAST of slc6a-8 vs. Ensembl Cavefish
Match: arrb2b (arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1332])

HSP 1 Score: 432.95 bits (1112), Expect = 6.222e-140
Identity = 217/358 (60.61%), Postives = 275/358 (76.82%), Query Frame = 3
Query:  159 KVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADE 1232
            +VFKKSSPN K+T YLGKRDF+D+LD+VDPVDGV+LIDP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDLY+++ Q +PPL +          ++ L+RLQERL+KKLG +A+PF F +P N P SVTLQPGP D GK CGVD+E++ + A + +EK HKR  V+       YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V ++E +D     S  + +CKVY + P L+NNR+KRGLALDGKLKHEDTNLASSTI+ + +NKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP+++
Sbjct:    8 RVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVLLIDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPLPE---------EHKPLSRLQERLLKKLGQHAHPFNFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSVEEKIHKRCRVQ-------YAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQVEADDQV---SPSSTFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKDVSNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPSEQ 345          
BLAST of slc6a-8 vs. Ensembl Cavefish
Match: slc6a3 (solute carrier family 6 member 3 [Source:NCBI gene;Acc:103026128])

HSP 1 Score: 379.407 bits (973), Expect = 8.296e-117
Identity = 192/404 (47.52%), Postives = 266/404 (65.84%), Query Frame = 2
Query: 2000 ENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDS-----ATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDS------SVRASIILNFELIYFSSEPLKLY 3178
            + H   + R+ W  ++DFL S+IGFAVD +NV+RFPY+C++NGGGAFL+PY + +++  +P+FY+EL  GQY R G   +WKICP+FKGVG+  +L++ YV  YYNVIIAW+L+YLF SFS  LPW  C+  WNS NC            + N  +  DS     A EY E  VL +  S GI +LG  +W +   L ++ +++Y  L+KGVK  GK VW+TA +PYVVL  LL+RGV L GA++GIK +++ +F  L    VWI AATQI FS+GVGF V IA++SYN F    + + +I +++NSLTS FSGFVIF++LGYMS +    L+KV      L+FI+YP A++TLPG + WAVIFF+ML  LG+DS      SV   +I  F+ ++   E   L+
Sbjct:   53 QTHPSGEQRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQYNREGAAGVWKICPVFKGVGFTVILISLYVGFYYNVIIAWALFYLFSSFSGELPWVNCNNTWNSANC-----------SDLNATLLNDSHKVTPALEYFERGVLHMQDSRGIDDLGLPRWQLTCCLAVVIVVLYFSLWKGVKTSGKVVWITATMPYVVLTVLLLRGVTLPGAIDGIKAYLSVDFLRLCDAQVWIEAATQICFSLGVGFGVLIAFSSYNKFSNNCYRDAIITSSINSLTSFFSGFVIFSFLGYMSQKHNVALDKVATDGPGLVFIIYPEAIATLPGSSVWAVIFFIMLLTLGIDSAMGGMESVITGLIDEFKFLHRHRELFTLF 445          

HSP 2 Score: 82.0333 bits (201), Expect = 2.422e-15
Identity = 56/206 (27.18%), Postives = 116/206 (56.31%), Query Frame = 1
Query: 3160 GALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQWXXXXXXXXXXXXXXXXXXFGGVVLYRIKATSWKERICLSISPNWEHRDIRSKTQFNRLKINHWITV 3777
            G +E+++TG++DEF F+ +     RE+ T  ++ + + +SL   T GG ++  L D ++AG S+L   L+E IG  W YG+D  +D I++M G    + +R+ +K+++P  +L + +    T           +Y +P W+ ++G  +S+SS++M+P++  +  +     S+  ++  +I+P  EH  +  + +  +  ++HW+ V
Sbjct:  419 GGMESVITGLIDEFKFLHRH----RELFTLFIVVLTFLISLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGIAWFYGVDRFSDDIQEMIGHRPGLYWRLCWKFVSPCFLLFMVVVSFATFNPPKYG----SYYFPTWANMVGWCLSISSMIMVPLY-AIYKFCTLPGSFCAKLAYAITPETEHHLVE-RGEVRQFTLHHWLVV 614          
BLAST of slc6a-8 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 317.005 bits (811), Expect = 9.906e-103
Identity = 166/371 (44.74%), Postives = 246/371 (66.31%), Query Frame = 2
Query: 2003 NHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHN-NCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
               +   R  W  + DFL S +G+A+   NV+RFPY+C +NGGGAFLIPYF+TL+   +P+F +E   GQY   GGL +WK+ P+FKGVG ASV+++FY+ +YY VII+W++YYL+ SF+  LPW  C+  WN++ C+  SNY S+L+  N     T +  E+ E N  M   SSG+   G ++  +A++L + ++++Y C++KGV + GK V+ +A  PYV+L  L  RG+ L GA EGI ++ITP+F+ L    VW+ AATQIFFS G+G    +A  SYN FH  V+N + +I   +NS+TS+F+GFVIF+ +G+MSH  +KP++++      L F+ YP A++ LP    W+++FF ML  LGLDS 
Sbjct:    3 KKKELPVRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCF--SNY-SILDTTN----LTSTVVEFWERN--MHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQ 364          

HSP 2 Score: 76.6406 bits (187), Expect = 9.906e-103
Identity = 47/143 (32.87%), Postives = 77/143 (53.85%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSA-GPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            QF  +E  +T + DE+    + ++  +EI  AV+  I Y + L N T GG ++ +++D YSA G SLL +   E I   W YG+D   D I +M G  +H  + I + + TP  ++ + +  +   E+  + LG  +YTYP W
Sbjct:  364 QFCTVEGFVTALSDEYP---QYLRGHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVV--EMTPLTLG--SYTYPMW 499          
BLAST of slc6a-8 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 292.738 bits (748), Expect = 4.970e-94
Identity = 159/331 (48.04%), Postives = 219/331 (66.16%), Query Frame = 2
Query: 2132 GAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWK-ICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENC--YFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNG-NLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
            GAFLIPY +  +   +P+FY+EL  GQ+ R G ++IW+ ICP+FKGVG+A  ++NFYVA YYN IIAW+LYYL+ SF+ TLPWT CD  WN+ NC  YF +  ++  + + +       A E+   NVL +  S G+G +G L+W + L L L++ I+Y  L+KGVK  GK VWVTA  PYVVL  LLIRG  L GA  G+ +++ PN+K LL  +VW+ AA QIFFS+G GF V +A ASYN F+   + + L+ ++VN  TS  SGFVIF  LGYM+      +E V      +L+FI YP A++ + G  FWA++FF+M+  LGLDS+
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFDTTGVAWGKHSRS------PAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDST 325          

HSP 2 Score: 72.0182 bits (175), Expect = 4.970e-94
Identity = 42/141 (29.79%), Postives = 74/141 (52.48%), Query Frame = 1
Query: 3157 FGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            FG LEA++T ++DE+  +F K   +RE     ++TI +  +L   TYGG ++++L +++ +G S++ + LLE I   W YG+      I  M GF     +R+ +  I+P  +  I ++ L   +     L    Y +P W
Sbjct:  326 FGGLEAIITAVMDEYPSLFSK---RREYFVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSPGYFWRLCWVAISPLFLSFIVVSFLTGSK----PLKLFDYDFPDW 459          
BLAST of slc6a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.098 bits (575), Expect = 1.306e-72
Identity = 144/335 (42.99%), Postives = 210/335 (62.69%), Query Frame = 2
Query: 2132 GAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPT-LPWTVCDKWWNSENCYFISNYLSLLEKNNNTNM-------FTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
            GAFL+PY +T++   +P+F++E+  GQ  + G + +WKI PLF GVG AS+++ F   LYY V++AWSLYYL  S +   LPWT C  WW +  C   S+ L      +N +         T  A E+ E NVL V  SSG+ +LG + W M L LL +++++Y  ++KG+KF GK V+VT  +PYV+L  LL++GVML GA++GI Y++ P++  L  P VW+ A+TQ+F+  GVGF V  A  SYN FH   + + +I   +NS TS FSGFV+F++LG+M+ +    +  V      L+F+VYP A+S LP    WA + F+ML  LG+DS 
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAAC---SDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRV--SSGMHDLGSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSE 330          

HSP 2 Score: 67.0106 bits (162), Expect = 1.306e-72
Identity = 43/143 (30.07%), Postives = 65/143 (45.45%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSA-GPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            +F  +E  +TG+ D F       K +RE  T +   + + LS+   T GG ++ QL+D Y+A G S+L +   ECI   W+YG +     +  M GF  H      +  ++P   L I +  L   E    N     Y YP W
Sbjct:  330 EFAGMEGFVTGLTDLFPSQLSG-KRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFRPHAWVWWCWSVVSPAVCLGIFVFHLVHYERLVYN---GRYEYPGW 468          
BLAST of slc6a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004302.1 (pep scaffold:Pmarinus_7.0:GL490722:800:6194:-1 gene:ENSPMAG00000003892.1 transcript:ENSPMAT00000004302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.519 bits (506), Expect = 9.142e-59
Identity = 107/196 (54.59%), Postives = 137/196 (69.90%), Query Frame = 3
Query:  588 GVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQH-ADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFG 1172
            G++   ++    N    + +RNSV+L IRK+ +AP+KP PQP AE  + F+MS   L LEASLDK  YYHGE I+VNV V NNS KT+KKIK+ V++  ADICL+N   YKC V     E+G       +  CKVY + PLL++NRDKRGLALDGKLKHEDTNLASSTI+ +  NKE LGI+V Y+VKV+L++  G
Sbjct:    1 GIEQVNRSSAPANTVHHSRRRNSVRLVIRKVQFAPEKPGPQPMAETTRQFLMSDKPLHLEASLDKMIYYHGEPINVNVHVTNNSTKTVKKIKMTVKEFFADICLFNTAQYKCPVAT---EEGDDTVGPSSTLCKVYTLTPLLASNRDKRGLALDGKLKHEDTNLASSTIVQDGANKEVLGILVSYRVKVKLIVSRG 193          
BLAST of slc6a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.134 bits (505), Expect = 9.984e-58
Identity = 112/259 (43.24%), Postives = 163/259 (62.93%), Query Frame = 2
Query: 2009 SDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNS-ENCYFISNYLSLLEKNNNTNMFTDSATEYLEN-NVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFI--TPNFKMLLKPDV 2773
             +   R +WAS+ +++ S+IG AV   N++RFPY+ ++NGGGAFLIPY + L    LP+F++E   GQ+   G +TIWK+ PL KG+G+  V+ +  +ALYYN IIA+ L+YLF SF+  LPW+ C KWW + ENC+  S   S L + N +++ +   T   +  N   + +S  +   G + W++AL+LLL +I+    L KG+K  GK V+ TAI PYVVL  LLIRG  L GA+ GI+Y+I    NF  L   +V
Sbjct:    1 DENAERGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDRSVCNSSLAEGNCSSVNSSKQTPSEQYWNKYALRRSESMDETGDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYIGRQSNFTKLQSAEV 259          
BLAST of slc6a-8 vs. Ensembl Nematostella
Match: EDO43535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYJ9])

HSP 1 Score: 400.979 bits (1029), Expect = 1.537e-129
Identity = 204/302 (67.55%), Postives = 243/302 (80.46%), Query Frame = 3
Query:  189 KITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKD-RKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTI 1091
            +IT YLGKRDFID++ ++DP+DGVVL+DP+Y+KD +KVF HVLAAFRYGREDLDVLGLTFRKDL+LA+ QVYPP       KT D   + LTRLQERL+KKLG NAYPF FELP  +P+SVTLQP P D GKPCGVDYELKTYVA++ +EK HKR++V+LAIRKLTYA ++P PQP +E  KDF+MS   L +EASLDK  YYHGE+I+VNV++ N S++  KKIKI VRQ ADICL++   YKC V  LE EDGFP++ S T   KVY + PLL  NRDKRGLALDGKLKHEDTNLASST+
Sbjct:   13 QITTYLGKRDFIDHVKHIDPIDGVVLVDPEYVKDGKKVFAHVLAAFRYGREDLDVLGLTFRKDLFLATVQVYPP-------KTDD--QKALTRLQERLLKKLGSNAYPFKFELPPGSPSSVTLQPAPGDTGKPCGVDYELKTYVAESLEEKPHKRDTVRLAIRKLTYATEQPQPQPFSEGEKDFMMSQHPLHVEASLDKGLYYHGETIAVNVIISNRSSRNCKKIKITVRQFADICLFSTAQYKCPVASLESEDGFPVHPSGT-LTKVYCLTPLLGENRDKRGLALDGKLKHEDTNLASSTM 304          
BLAST of slc6a-8 vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 329.717 bits (844), Expect = 3.294e-107
Identity = 176/394 (44.67%), Postives = 249/394 (63.20%), Query Frame = 2
Query: 2024 RKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIW-KICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYF----ISNYLSLLEKNNN-----------------TNMFTDS---------ATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
            R+ W  + DFL S IGFAV   NV+RFPY+C+ NGGGAFL+PY + L+LC +PMF++EL  GQY   G + +W  ICPLF+G+G+AS++++F V +YYNVIIAW LY+L VSF   + W  CD WWN++NCY      S   SL   +NN                 TN  T+          + E+ EN +L +  S GIG  G ++W + + L+L ++ +Y C++KGVK  GK V+ TA  PY+VL  L +RGV L GA +GI +++ P +  L  P VW+AAATQIF+S+G+GF   +A  SYN FH  +  + +  + +N  TS+F+GFVIF+ LG+MSH + KP+E+V N    L F+VYP A++ +P    WA++FF M+  LGLDS 
Sbjct:    6 RETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTDNCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANATNATTECLFPENQVSPSLEFWENYILRL--SDGIGEAGEIRWQILVCLILAWVGVYFCMWKGVKSSGKVVYFTATFPYLVLFILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLNKPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQ 397          

HSP 2 Score: 79.7221 bits (195), Expect = 3.294e-107
Identity = 47/142 (33.10%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            QFG +EA++TGI+DE+    K+    +E+  AV   + + L + N T GG +++ L+D  S G SLL +   E +   WIYG D  +  I+ M G      +R  +K+  P  +  I     F   IF   +   +Y YPQW
Sbjct:  397 QFGMMEAVITGIIDEYPVCRKR----KELFIAVACFLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGADRFSKDIEDMVGSRPAAWWRFTWKFCAPTVMAGI----FFYSIIFWQGVSYGSYKYPQW 530          
BLAST of slc6a-8 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 315.849 bits (808), Expect = 3.855e-105
Identity = 161/388 (41.49%), Postives = 246/388 (63.40%), Query Frame = 2
Query: 1970 AENSDESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWK-ICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCY------FISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
              +S++S  ++   + QTR  W+S+ +F+ S +G+ V F NV+RFPY+C++NGG  FLIPYF+ L++  +P+F++EL  GQ+   G + +WK ICPL KG+GYA  ++++   +YY VI+AW+ YYLF+SF   +PW  CD  WN++ C        + N   L    N T   T  + E+  NNVL + +   I + G ++W +  + +L +I++Y CLFKG+K  GK V+ TA  P++VL  L+IRG  LEG+++G+ Y++ P+++ L  P VWI AATQI++S+GVGF   I + SYN F+  VH + L+ +  N  TS F+GFV+F+ LG+M+  +   + KV      L F+ YP A+S +P    WAV+FF ML  LGLDS 
Sbjct:   22 TSSSEDSPQIDVEEE-QTRDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTSPSGEFWSNNVLEMTED--ISDFGDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQ 406          

HSP 2 Score: 86.2705 bits (212), Expect = 3.855e-105
Identity = 66/187 (35.29%), Postives = 105/187 (56.15%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQWXXXXXXXXXXXXXXXXXXFGGVVLYRIKATSWKERICLSISPNWE 3714
            QF  +EA++T I+DE+ +V +  K+++ +   ++   L  L LP    GG ++  L D   AG SLL V+LLE I   WIYG+D  +D ++ M G      FRI +KY++P   LAI +A L   +    N       YP W+ +IG ++ LSS++MIP F    +Y+ ++ + +ERI   + P+ E
Sbjct:  406 QFATIEAVITAIVDEYPWV-RGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYN----GKPYPGWAELIGWMLMLSSVLMIPAFAIHEIYK-RSGTLRERITFLLKPDEE 586          
BLAST of slc6a-8 vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 313.538 bits (802), Expect = 1.010e-102
Identity = 156/365 (42.74%), Postives = 232/365 (63.56%), Query Frame = 2
Query: 2024 RKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVL--MVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
            R+ W  +LDF+ ++IGF+V   N++RFPY+C++NGGG FLIPY + LLL  +P+  +E+  GQ+M  GG+T WKICPLF+G+GYASV++  Y+ +YY VI+ W+ YY+F SF   LPW+ CD  WN+E C+     ++     +        + + L  +    ++N S G+  +G + W MAL LL  +I+ YLC+FKGVK  G+ V+ TA  PYV+L  + +R V L GA EGI++++ P++  L    VW+ AATQ+FFS  +G    IA  SYN F    + +C+I A VNS TS + GFVIF+ LG+M+ +   P+++V      L FI YP A++ +P    W+++FF M+  LGLDS 
Sbjct:    9 RETWVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCHVGRKMITTFNSGSKCCQLFIKSFKCLWKDAADYVLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIFSVLGFMAEKQGVPIQEVAESGPGLAFIAYPAAVAEMPISPLWSILFFFMVILLGLDSE 373          

HSP 2 Score: 80.8777 bits (198), Expect = 1.010e-102
Identity = 51/143 (35.66%), Postives = 75/143 (52.45%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSA-GPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            +F  +E  +T I+D F    ++  Y++EI  A   T  +F+ L   T GG ++ QL+D YSA G  LL +SL E IG  W+YG +     +  M GF ++   ++ + + TP   LA+ I  L   E  T NL   TY YP W
Sbjct:  373 EFVGVEGFVTAIVDMFPGYLRR-GYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFDNYSASGICLLWISLFESIGIGWVYGAERFYQNMTDMIGFRINPYLKVCWIFCTPIFCLAVFIFSLVNYEPLTYNL---TYKYPVW 511          
BLAST of slc6a-8 vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 320.472 bits (820), Expect = 1.649e-101
Identity = 172/385 (44.68%), Postives = 253/385 (65.71%), Query Frame = 2
Query: 1976 NSDESKNLENHSDP-----QTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIW-KICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSS 3112
             +D +K L+N         ++R+ W  +++FLF+ IGFAV + N +RFPY+CF+NGGGAFLIPY + L L  +P+F++EL  GQ ++ G +  W KICPLF G+G+AS++++F V++YYNVI+AWSLY+L+ SF   +PW  C   WN+ +CY       +   + N +    S+ E+L  NVL + +S  I   G L  ++ L LL+ +I++Y  +++G++  GK V+VTA LPY++L    I+GV L GA++G+ YFITP +  L  P VWI AA+QI +S+ +GF V I +ASYN     V ++ L+ + +N  TS+F+GFVIFA +GYM+H   K + +V +    L+FIVYP A+S LP    WAVIFFLML  LGLDS 
Sbjct:    2 TADSNKPLKNDEKKDLVTVESRERWDRKIEFLFACIGFAVGYGNFWRFPYMCFKNGGGAFLIPYVLFLCLGGIPLFFMELSLGQLLQEGPIKAWQKICPLFSGIGFASIVISFIVSIYYNVILAWSLYFLYNSFFADIPWVGCHHSWNTPDCY-------VYNASANASG-VSSSREFLVKNVLEITKS--IEEPGGLSVHLTLCLLVAWILVYFSIWRGIRTTGKVVYVTATLPYIILVIFFIKGVTLPGAIDGVLYFITPQWDRLQDPKVWIDAASQILYSLTIGFGVLIGFASYNPRKNNVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQEKSVPEVASQGPGLVFIVYPAAISQLPFPQIWAVIFFLMLIALGLDSQ 376          

HSP 2 Score: 69.707 bits (169), Expect = 1.649e-101
Identity = 43/142 (30.28%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQW 3579
            QFG +E +   +++++    +++   RE+   V+  +++ L L   + GG F+  L+D +S G SLL V   E +   WIYG    AD I QM G  +   + I +KYI+P  +L I +  L   +  T         YP W
Sbjct:  376 QFGQVEVVAAALIEQWP---RQLHKHRELVVLVICFVMFLLGLSCVSKGGMFVFNLFDSFSCGLSLLFVVCFELLVIGWIYGARRYADNISQMIGRPVLQWWVICWKYISPIMVLGIFVFSLAKYKRIT----YENVPYPAW 510          
BLAST of slc6a-8 vs. Ensembl Medaka
Match: arrb2a (arrestin beta 2 [Source:NCBI gene;Acc:101159286])

HSP 1 Score: 469.544 bits (1207), Expect = 1.595e-153
Identity = 249/454 (54.85%), Postives = 316/454 (69.60%), Query Frame = 3
Query:  144 EKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGG 1505
            +K  ++VFKKSSPN K+T YLGKRDF+D+LD+VDPVDGV+L+DP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDLY+++ Q +PP+ +   ++ P+      +RLQ+RL+KKLG +A+PFYF +P N P SVTLQPGP D GK CGVD+E++ + A + +EK HKRNSV+L IRK+ YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V +LE +D     SS + +CKVY + P L  NR+KRGLALDGKLKHEDTNLASSTI+ + TNKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP   EP +S                               P   + E D   ID +LI+ +T+            +S DDD +FEDFARLRL G 
Sbjct:    3 DKAGTRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPVPE---ERKPN------SRLQDRLLKKLGQHAHPFYFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQLEADDQV---SSSSTFCKVYTLTPTLDKNREKRGLALDGKLKHEDTNLASSTIVKDVTNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFILMHPKPV--EPPLSR------------------------------PQSAVPEMDPP-IDTNLIEFETN------------VSQDDDFVFEDFARLRLKGA 398          
BLAST of slc6a-8 vs. Ensembl Medaka
Match: arrb1 (arrestin beta 1 [Source:NCBI gene;Acc:101163309])

HSP 1 Score: 466.848 bits (1200), Expect = 7.410e-152
Identity = 231/369 (62.60%), Postives = 285/369 (77.24%), Query Frame = 3
Query:  159 KVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGT-----------SDISLELPFTLSHPKPADE 1232
            +VFKK+SPNGK+T YLGKRDF+D++D+VDPVDGV+LIDP+YLK+RKVFV +  AFRYGREDLDVLGLTFRKDL+LA+ Q +PPL +           + LTRLQERLIKKLG +AYPF FE+P N P SVTLQPGP D GK CGVD+E+K + A+N +EK HKRNSV+L IRK+ YAP+KP PQP+AE  + F+MS   L LEASLDKE YYHGE ISVNV V NN+NKT+K++KI+VRQHADICL+N   YKC V   E +D   + +  + +CKV+ + P L+NN++KRGLALDGKLKHEDTNLASST++ +  NKE LGI+V YKVKV+LV+  G            SD+S+ELPFTL HPKP +E
Sbjct:    7 RVFKKASPNGKLTVYLGKRDFVDHVDFVDPVDGVILIDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFLANIQAFPPLPE---------EKKSLTRLQERLIKKLGEHAYPFIFEIPLNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENAEEKIHKRNSVRLVIRKVQYAPEKPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKRMKISVRQHADICLFNTAQYKCPVAVEESDD---VVAPSSTFCKVFTLTPFLANNQEKRGLALDGKLKHEDTNLASSTLLRDGANKEILGILVSYKVKVKLVVSRGGSPVMHLNLLCFSDVSVELPFTLMHPKPLEE 363          
BLAST of slc6a-8 vs. Ensembl Medaka
Match: arrb2a (arrestin beta 2 [Source:NCBI gene;Acc:101159286])

HSP 1 Score: 463.766 bits (1192), Expect = 2.646e-151
Identity = 247/450 (54.89%), Postives = 314/450 (69.78%), Query Frame = 3
Query:  156 SKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGG 1505
            S+VFKKSSPN K+T YLGKRDF+D+LD+VDPVDGV+L+DP+YLKDRKVFV +  AFRYGREDLDVLGL+FRKDLY+++ Q +PP+ +   ++ P+      +RLQ+RL+KKLG +A+PFYF +P N P SVTLQPGP D GK CGVD+E++ + A + +EK HKRNSV+L IRK+ YAP+KP PQP  E  + F+MS  SL LEASLDKE YYHGE ISVNV V NNS KT+K++KI+VRQ+ADICL++   YKC V +LE +D     SS + +CKVY + P L  NR+KRGLALDGKLKHEDTNLASSTI+ + TNKE LGI+V Y+VKV+LV+  G  D+S+ELPF L HPKP   EP +S                P+    T     S +               +L+ ++T     +H      +S DDD +FEDFARLRL G 
Sbjct:    7 SRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPVPE---ERKPN------SRLQDRLLKKLGQHAHPFYFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQLEADDQV---SSSSTFCKVYTLTPTLDKNREKRGLALDGKLKHEDTNLASSTIVKDVTNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFILMHPKPV--EPPLSR---------------PQSGRSTRRRHYSGL---------------ELVSMET-----DH------VSQDDDFVFEDFARLRLKGA 400          
BLAST of slc6a-8 vs. Ensembl Medaka
Match: slc6a2 (solute carrier family 6 member 2 [Source:NCBI gene;Acc:101172721])

HSP 1 Score: 358.221 bits (918), Expect = 1.358e-119
Identity = 198/420 (47.14%), Postives = 272/420 (64.76%), Query Frame = 2
Query: 1871 KMQNIELNESKLI--KSHXXXXXXXXXXCRTIALLAENSDESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNY-LSLLEKNNN--TNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSV 3115
            K  N+E  E +LI  K  N +   N +   T A  A     S ++E       R+ W  ++DFL S+IGFAVD +NV+RFPY+C++NGGGAFLIPY + L++  +P+FY+EL  GQY R G  T+WKICP+FKGVGYA +++  YV  YYNVIIAWSLYYL+ S +  LPW  C   WNS NC    +   S  +KN +   N FT  A+EY E  VL +++S GI +LG  +  + L L+++  I+Y  L+KGVK  GK V++TA +PYVVL  LLIRG+ L GA+ GIK ++  +   L    VWI AATQIF+S+G GF V IA++SYN F    + + ++ +AVN +TS  SGF IF+ LGYM+ +    ++ V      L+FI+YP A+STLPG  FWA++FF+ML  LG+DSS+
Sbjct:   18 KQCNVEKKEVELILVKDQNGVQYTNSTIIPTAARCAGPHGTSTDIE-------RETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYILFLVIAGMPLFYMELALGQYNREGAATVWKICPVFKGVGYAVIVIALYVGFYYNVIIAWSLYYLYSSMTAELPWLKCGHSWNSINCTDPQHINASFFDKNTSYANNKFT-PASEYYERGVLHLHESKGIEDLGLPRLELTLCLVVVVFILYFSLWKGVKSSGKVVYITATMPYVVLFVLLIRGITLPGALNGIKAYLNFSLSELNNLQVWIDAATQIFYSLGAGFGVLIAFSSYNKFDNNCYRDAILTSAVNCITSFVSGFAIFSVLGYMAQKYNMDIKAVATDGPGLVFIIYPEAISTLPGSTFWAIVFFIMLLTLGIDSSM 429          

HSP 2 Score: 93.9745 bits (232), Expect = 1.358e-119
Identity = 61/208 (29.33%), Postives = 114/208 (54.81%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQWXXXXXXXXXXXXXXXXXXFGGVVLYRIKATSWKERICLSISPNWEHRDIRSKTQFNRLKINHWITV 3777
              G +EA++TG+ D+F F    +K  R++ T       + ++L   T GG +++ L DKY+AG S+L   L+E IG  W YG+D  ++ I+QM GF   + +R+ +K+++P  +L + IA   T       L    Y +P  + ++G  +++SS++ +P +     + ++ T + ERI   I+P  EH  + ++    + K+ HW+ +
Sbjct:  428 SMGGMEAVITGLSDDFKF----LKRNRKLFTFATAFGTFLMALICVTNGGIYVLTLLDKYAAGTSILFAVLIEAIGVSWFYGVDRFSEDIEQMMGFKPGLYWRLCWKFVSPVFLLFVVIASTVTSS----GLKYGDYVFPNGANLLGWGVAMSSMLFVPFYAIYKFFSVRGT-FTERIAYCITPEHEHHKV-AEGNVRQFKLKHWLAI 625          
BLAST of slc6a-8 vs. Ensembl Medaka
Match: slc6a2 (solute carrier family 6 member 2 [Source:NCBI gene;Acc:101172721])

HSP 1 Score: 358.221 bits (918), Expect = 1.358e-119
Identity = 198/420 (47.14%), Postives = 272/420 (64.76%), Query Frame = 2
Query: 1871 KMQNIELNESKLI--KSHXXXXXXXXXXCRTIALLAENSDESKNLENHSDPQTRKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNY-LSLLEKNNN--TNMFTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSV 3115
            K  N+E  E +LI  K  N +   N +   T A  A     S ++E       R+ W  ++DFL S+IGFAVD +NV+RFPY+C++NGGGAFLIPY + L++  +P+FY+EL  GQY R G  T+WKICP+FKGVGYA +++  YV  YYNVIIAWSLYYL+ S +  LPW  C   WNS NC    +   S  +KN +   N FT  A+EY E  VL +++S GI +LG  +  + L L+++  I+Y  L+KGVK  GK V++TA +PYVVL  LLIRG+ L GA+ GIK ++  +   L    VWI AATQIF+S+G GF V IA++SYN F    + + ++ +AVN +TS  SGF IF+ LGYM+ +    ++ V      L+FI+YP A+STLPG  FWA++FF+ML  LG+DSS+
Sbjct:   18 KQCNVEKKEVELILVKDQNGVQYTNSTIIPTAARCAGPHGTSTDIE-------RETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYILFLVIAGMPLFYMELALGQYNREGAATVWKICPVFKGVGYAVIVIALYVGFYYNVIIAWSLYYLYSSMTAELPWLKCGHSWNSINCTDPQHINASFFDKNTSYANNKFT-PASEYYERGVLHLHESKGIEDLGLPRLELTLCLVVVVFILYFSLWKGVKSSGKVVYITATMPYVVLFVLLIRGITLPGALNGIKAYLNFSLSELNNLQVWIDAATQIFYSLGAGFGVLIAFSSYNKFDNNCYRDAILTSAVNCITSFVSGFAIFSVLGYMAQKYNMDIKAVATDGPGLVFIIYPEAISTLPGSTFWAIVFFIMLLTLGIDSSM 429          

HSP 2 Score: 93.9745 bits (232), Expect = 1.358e-119
Identity = 61/208 (29.33%), Postives = 114/208 (54.81%), Query Frame = 1
Query: 3154 QFGALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDEIFTVNLGTRTYTYPQWXXXXXXXXXXXXXXXXXXFGGVVLYRIKATSWKERICLSISPNWEHRDIRSKTQFNRLKINHWITV 3777
              G +EA++TG+ D+F F    +K  R++ T       + ++L   T GG +++ L DKY+AG S+L   L+E IG  W YG+D  ++ I+QM GF   + +R+ +K+++P  +L + IA   T       L    Y +P  + ++G  +++SS++ +P +     + ++ T + ERI   I+P  EH  + ++    + K+ HW+ +
Sbjct:  428 SMGGMEAVITGLSDDFKF----LKRNRKLFTFATAFGTFLMALICVTNGGIYVLTLLDKYAAGTSILFAVLIEAIGVSWFYGVDRFSEDIEQMMGFKPGLYWRLCWKFVSPVFLLFVVIASTVTSS----GLKYGDYVFPNGANLLGWGVAMSSMLFVPFYAIYKFFSVRGT-FTERIAYCITPEHEHHKV-AEGNVRQFKLKHWLAI 625          
BLAST of slc6a-8 vs. Planmine SMEST
Match: SMESG000037193.1 (SMESG000037193.1)

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 478/478 (100.00%), Postives = 478/478 (100.00%), Query Frame = 3
Query:   87 MSNNHDVDLDDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKNDP 1520
            MSNNHDVDLDDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTIKKIKIAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKNDP
Sbjct:    1 MSNNHDVDLDDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTIKKIKIAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKNDP 478          
BLAST of slc6a-8 vs. Planmine SMEST
Match: SMESG000006894.1 (SMESG000006894.1)

HSP 1 Score: 512.686 bits (1319), Expect = 6.271e-170
Identity = 268/470 (57.02%), Postives = 328/470 (69.79%), Query Frame = 3
Query:  105 VDLDDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKN 1514
            +D+D    +GT K K  ++VFKKSSPN KIT YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+HVLA FRYGR+DLDVLGLTFRKDL+L++QQ+YPP N +     P      LT+LQERLI KLGHNA PF F++PH TPASVTLQP P DNGKPCGVDYELK Y++D PD K HKRNSV+L IRKLT+A   P PQ   E+ KDF M  G +RLE SLDKEKYYHGESI+VNV VDN SNK I+KI++ V Q ADI L+    YKC+VDE+E +DGFPI   Q GWCK++ +CPLLSNNRDKRGLALDG L++EDTNLASST++NEN++ EN+GIIV+Y ++VRL+LGFGTSDI LE+PF L+HP P                              +D    ++V ND L   DS  ID D  +L                  +++ IFEDFARLRL G + N
Sbjct:    2 IDMD----EGTEK-KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSI----IP-----SLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLHVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP-----------------------------DSDFRIPNSVSND-LNPLDSNGIDTDFNKLQ--------------FKQEEEFIFEDFARLRLYGNETN 413          
BLAST of slc6a-8 vs. Planmine SMEST
Match: SMESG000006894.1 (SMESG000006894.1)

HSP 1 Score: 512.686 bits (1319), Expect = 6.611e-170
Identity = 266/462 (57.58%), Postives = 324/462 (70.13%), Query Frame = 3
Query:  129 QGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKN 1514
            +GT K K  ++VFKKSSPN KIT YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+HVLA FRYGR+DLDVLGLTFRKDL+L++QQ+YPP N +     P      LT+LQERLI KLGHNA PF F++PH TPASVTLQP P DNGKPCGVDYELK Y++D PD K HKRNSV+L IRKLT+A   P PQ   E+ KDF M  G +RLE SLDKEKYYHGESI+VNV VDN SNK I+KI++ V Q ADI L+    YKC+VDE+E +DGFPI   Q GWCK++ +CPLLSNNRDKRGLALDG L++EDTNLASST++NEN++ EN+GIIV+Y ++VRL+LGFGTSDI LE+PF L+HP P                              +D    ++V ND L   DS  ID D  +L                  +++ IFEDFARLRL G + N
Sbjct:    3 EGTEK-KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSI----IP-----SLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLHVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP-----------------------------DSDFRIPNSVSND-LNPLDSNGIDTDFNKLQ--------------FKQEEEFIFEDFARLRLYGNETN 410          
BLAST of slc6a-8 vs. Planmine SMEST
Match: SMESG000078454.1 (SMESG000078454.1)

HSP 1 Score: 471.47 bits (1212), Expect = 5.795e-154
Identity = 253/452 (55.97%), Postives = 314/452 (69.47%), Query Frame = 3
Query:  147 KETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNK--VEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTXXXXXXAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRL 1496
            K  ++VFKKSS NGKIT Y+GKRD+++  D++DP+DGVVLIDPDY+KDR+VFVHVLAAFRYGREDLDVLGLTFRKDLYL  QQ+YP +     + DK  D SN  LTRLQ RL++KLG NAY FYF LP N+PASVTLQP P D GKPCGVDYELK YVA + ++K  KR+ VKLAIRKLT+A + P+  P+ EI+K+F +S G + ++ASLDK+ Y+HGESISV V VDN+S KTIKKIK+ V Q ADI L+    YKC++DE+E E  FPI   QTGW   + +CPLLSNNR KRGLALDGKL+HEDTNLASST++    N E+LGIIV YKV+++L+LGF +SDI LELPF L+HP P   E +++  T++ L   K+ +                                      T  DN    + +     DDDLIF DFARL+L
Sbjct:    8 KGGTRVFKKSSLNGKITVYIGKRDYLERNDHIDPIDGVVLIDPDYVKDRRVFVHVLAAFRYGREDLDVLGLTFRKDLYLDYQQLYPKIENENCDLDKQQDQSN-SLTRLQARLMQKLGTNAYAFYFNLPRNSPASVTLQPAPEDVGKPCGVDYELKVYVAKSFEDKTQKRSCVKLAIRKLTFAFNGPNIPPTDEIIKEFRLSSGKVIMDASLDKQTYFHGESISVTVSVDNSSTKTIKKIKLQVLQIADIMLFTRAVYKCVIDEVESEKFFPINPGQTGWNVTFSMCPLLSNNRHKRGLALDGKLRHEDTNLASSTVVQSKDNIEDLGIIVSYKVRIKLILGFTSSDIQLELPFNLTHPNP---EEDLTVNTYDGLDIFKNSL--------------------------------------TFTDNYEPISSQ--AEQDDDLIFVDFARLKL 415          
BLAST of slc6a-8 vs. Planmine SMEST
Match: SMESG000072792.1 (SMESG000072792.1)

HSP 1 Score: 350.903 bits (899), Expect = 2.969e-114
Identity = 178/354 (50.28%), Postives = 252/354 (71.19%), Query Frame = 2
Query: 2060 SIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLCALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVIIAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNM--FTDSATEYLENNVLMVNQSSGIGNLGPLKWNMAXXXXXXXXXXXXXXFKGVKFLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDVWIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFSGFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVIFFLMLFNLGLDSSV 3115
            SIIGFAVD +NV+RFPYICF+NGGGAFLIPYF  L+  A+P+FY+EL+ GQ+ + G + IWKICPLF+GVG A  +++F VALYYNVI  W  Y+LF SF+ +LPW  C    ++ +C  + +YL      N++    ++ S+ EY E  VL V++SSGIG+LG  +W +    L +++I+Y+ + +G+K  GK V+VT +LPYV+L  LLI G+ML GA  GI  FITPNF +L   +VWI AA QIF+SVG GF VH+AYASYN  +     +C+    VNS TSL +GFV+F+YLGY+S+ ++  ++ VV    +L+F +YP A++T+ G +FW+++FFL+L NLGLDS++
Sbjct:    2 SIIGFAVDLANVWRFPYICFKNGGGAFLIPYFAMLVFGAVPLFYMELILGQFHQKGAIGIWKICPLFQGVGVAQNMISFIVALYYNVINGWCFYFLFKSFTYSLPWMTCHPNISTSHCINMEDYLMKNYSRNSSGAVNYSISSLEYFERVVLQVHKSSGIGDLGLPRWELVSCTLGVFVILYITIRRGIKSSGKVVYVTVLLPYVLLIVLLINGLMLPGAKNGIVRFITPNFSILAHTEVWIEAAVQIFYSVGAGFGVHLAYASYNRLNNKCFRDCVATVIVNSGTSLLAGFVVFSYLGYISYLLKDDIDNVVTHGPSLVFQIYPFAIATIRGSSFWSIMFFLLLINLGLDSAM 355          

HSP 2 Score: 83.1889 bits (204), Expect = 2.969e-114
Identity = 69/213 (32.39%), Postives = 118/213 (55.40%), Query Frame = 1
Query: 3160 GALEALLTGILDEFDFVFKKMKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLLECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQLFTDE-------IFTVNLGTRTYTYPQWXXXXXXXXXXXXXXXXXXFGGVVLYRIKATSWKERICLSISPNWEHRDIRSKTQFNRLKINHWITV 3777
            G +E+++TG+ D     +K +K +R++ + ++L   +  S+P  T GG ++  L D+++AG SLL  +L++ IG  W YG++      KQM G+   I +RI +K++ P  ILAI I    +          F   L  + Y +P WS+IIG  ISLSS++MIPIF   +   I   ++ +    +I+P WE    +   ++ R ++ HWI++
Sbjct:  356 GGIESVVTGLHDVIPIHWKIIK-RRDVLSLIVLIFAFLGSIPVVTNGGIYVFTLLDRHAAGTSLLFGALMQAIGVAWFYGLNQFCSDCKQMLGYSPSIFWRICWKFLAPSFILAIVICSTVSMTRLSYPFGCFHPELNMKEYEFPSWSVIIGWGISLSSMIMIPIFA--IWNWIHYKNFYK----AITPIWEQD--QKFERYKRKRLAHWISM 559          
The following BLAST results are available for this feature:
BLAST of slc6a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARRB11.369e-15556.35arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711][more]
ARRB12.234e-15555.70arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711][more]
ARRB21.489e-15254.59arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712][more]
ARRB28.452e-14852.19arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712][more]
ARRB24.566e-13951.75arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712][more]
back to top
BLAST of slc6a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arr-12.918e-14654.66Beta-arrestin arr-1 [Source:UniProtKB/Swiss-Prot;... [more]
dat-11.908e-10648.10Sodium-dependent dopamine transporter [Source:Uni... [more]
mod-51.202e-10245.21Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-112.981e-9541.35Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
snf-32.294e-7836.67Sodium- and chloride-dependent betaine transporter... [more]
back to top
BLAST of slc6a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
krz9.536e-15154.86gene:FBgn0040206 transcript:FBtr0305268[more]
krz9.536e-15154.86gene:FBgn0040206 transcript:FBtr0085877[more]
DAT6.646e-11947.06gene:FBgn0034136 transcript:FBtr0087125[more]
DAT9.988e-11947.06gene:FBgn0034136 transcript:FBtr0330002[more]
SerT5.016e-11750.00gene:FBgn0010414 transcript:FBtr0072362[more]
back to top
BLAST of slc6a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrb2b1.248e-15857.17arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426... [more]
arrb13.631e-15555.80arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-... [more]
arrb2a2.201e-15254.75arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
arrb2a3.169e-15153.91arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
slc6a21.007e-12145.35solute carrier family 6 member 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc6a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARRB13.468e-13755.48arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB13.373e-13656.06arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB15.127e-13655.94arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB16.137e-13655.51arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB19.674e-13655.28arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
back to top
BLAST of slc6a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arrb11.367e-15456.12arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473][more]
Arrb11.944e-15455.48arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473][more]
Arrb17.918e-15455.36arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473][more]
Arrb29.006e-15054.11arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474][more]
Arrb29.006e-15054.11arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474][more]
back to top
BLAST of slc6a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R562|ARRB1_MACFA3.277e-15557.02Beta-arrestin-1 OS=Macaca fascicularis OX=9541 GN=... [more]
sp|P29066|ARRB1_RAT9.454e-15555.70Beta-arrestin-1 OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|P49407|ARRB1_HUMAN1.073e-15455.70Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1 P... [more]
sp|P17870|ARRB1_BOVIN2.573e-15455.48Beta-arrestin-1 OS=Bos taurus OX=9913 GN=ARRB1 PE=... [more]
sp|Q8BWG8|ARRB1_MOUSE1.360e-15355.48Beta-arrestin-1 OS=Mus musculus OX=10090 GN=Arrb1 ... [more]
back to top
BLAST of slc6a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK120.000e+0100.00Slc6a-8 OS=Schmidtea mediterranea OX=79327 GN=slc6... [more]
A0A1I8FTU60.000e+063.20Arrestin_C domain-containing protein OS=Macrostomu... [more]
A0A1I8J0I00.000e+063.20Arrestin_C domain-containing protein OS=Macrostomu... [more]
A0A1V1FN690.000e+063.75Beta-arrestin OS=Ambigolimax valentianus OX=133834... [more]
A0A2T7NC680.000e+065.86Arrestin_C domain-containing protein OS=Pomacea ca... [more]
back to top
BLAST of slc6a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrb2a4.138e-15554.13arrestin red cell [Source:NCBI gene;Acc:103028079][more]
arrb14.651e-15264.80arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-... [more]
arrb2a1.109e-14851.12arrestin red cell [Source:NCBI gene;Acc:103028079][more]
arrb2b6.222e-14060.61arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426... [more]
slc6a38.296e-11747.52solute carrier family 6 member 3 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a9.906e-10344.74solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b4.970e-9448.04solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.11.306e-7242.99pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000004302.19.142e-5954.59pep scaffold:Pmarinus_7.0:GL490722:800:6194:-1 gen... [more]
ENSPMAT00000001684.19.984e-5843.24pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
back to top
BLAST of slc6a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO435351.537e-12967.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315453.294e-10744.67Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO397073.855e-10541.49Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO323561.010e-10242.74Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO401511.649e-10144.68Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
back to top
BLAST of slc6a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrb2a1.595e-15354.85arrestin beta 2 [Source:NCBI gene;Acc:101159286][more]
arrb17.410e-15262.60arrestin beta 1 [Source:NCBI gene;Acc:101163309][more]
arrb2a2.646e-15154.89arrestin beta 2 [Source:NCBI gene;Acc:101159286][more]
slc6a21.358e-11947.14solute carrier family 6 member 2 [Source:NCBI gene... [more]
slc6a21.358e-11947.14solute carrier family 6 member 2 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037193.10.000e+0100.00SMESG000037193.1[more]
SMESG000006894.16.271e-17057.02SMESG000006894.1[more]
SMESG000006894.16.611e-17057.58SMESG000006894.1[more]
SMESG000078454.15.795e-15455.97SMESG000078454.1[more]
SMESG000072792.12.969e-11450.28SMESG000072792.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032979
GenBankAKN21428.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032979 ID=SMED30032979|Name=slc6a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=4025bp
TTTCACTTATGACTATTAGTTTTTGAAATCAAAAAATGGCGTTTTAATAT
TATTTATTATTTCATTGAATAATTATATATTAATACATGTCTAATAATCA
CGATGTAGATCTAGATGATATTAAGAAGCAAGGCACTAGTAAGGAAAAAG
AAACATCAAAAGTTTTTAAGAAAAGTAGTCCAAATGGAAAAATTACTGCT
TATCTGGGTAAACGAGATTTTATAGATTATCTCGACTATGTGGACCCAGT
TGATGGTGTAGTATTGATTGATCCAGATTATTTAAAGGATCGAAAAGTAT
TTGTTCATGTTCTGGCAGCTTTTAGATACGGTCGTGAAGATCTAGATGTA
TTGGGTTTAACGTTTCGAAAGGATTTATATCTTGCATCCCAGCAAGTTTA
TCCTCCACTTAACAAAGTTGAATTCGATAAAACTCCTGATATTTCCAATC
GTAAACTAACAAGACTCCAAGAAAGATTAATTAAGAAACTAGGCCACAAT
GCTTATCCGTTTTATTTTGAGTTACCTCATAATACCCCTGCATCCGTAAC
ACTTCAACCAGGCCCAAACGATAATGGAAAGCCTTGTGGTGTTGACTACG
AATTAAAGACATATGTTGCCGATAATCCCGACGAAAAAGCTCACAAGAGA
AATTCCGTAAAACTAGCAATTAGAAAATTGACTTATGCTCCAGATAAACC
GTCTCCTCAACCATCGGCTGAAATCGTAAAGGATTTCATCATGAGCCCTG
GATCATTGAGATTGGAAGCGTCTTTGGATAAAGAAAAATATTATCACGGC
GAATCGATCTCAGTAAATGTTCTGGTGGATAACAATTCCAACAAAACGAT
AAAGAAAATTAAAATTGCCGTGCGCCAGCATGCGGATATTTGTCTATATA
ATGCTACGAGTTATAAATGTTTAGTTGATGAATTAGAATTTGAAGACGGA
TTTCCTATTTATTCCAGTCAGACAGGTTGGTGTAAAGTGTATAAAGTTTG
TCCACTGTTGAGCAACAACCGAGACAAAAGGGGTTTGGCTCTGGATGGTA
AATTGAAACATGAAGATACAAATTTGGCTTCCTCTACAATAATAAATGAA
AATACCAACAAAGAAAATCTTGGCATTATTGTTCAATATAAAGTCAAAGT
TCGACTTGTACTAGGATTCGGAACAAGTGATATATCACTAGAGTTACCTT
TCACATTGAGTCACCCGAAACCGGCTGATGAAGAACCAAACATGAGCAAT
TTCACATTTGAAGACCTTCATAGCAATAAGTCCAAAATCCAATCACCTGA
GATTATTTCAAAAACTGATGTTAATACCGAATCAAATGTGCCCAATGACA
AATTATTAGAGTCAGATTCCAGAATTATTGACCCAGATTTGATACAGCTT
GATACTTCTTGTGATAATCGAAACCATACAAATAAAGAAAACATTTTATC
AGCTGATGATGATTTAATTTTTGAGGATTTTGCTCGTCTCAGATTAACTG
GTGGTGATAAAAATGATCCATGACCACGACCAGCACCTCTTCATCGTCCT
TGTTTTTTATAATAAATTATTTTCTATCATCATTATGATTTTTGTGATTA
TTATATAATTATTATTATTATTATTATCGGATTTTGATTAATTAAATGCA
GTTTTCAAACGAATTATTAGAATAAATAAATTTTTATCACATATTTGATC
TAGGCATTGATTTATCGTGGATTTTTGTTGAAATTTCAGTAGATTTATGC
CATAACAAAATTCATTACGGACTTTCTCTATGATGCAAAATTGTCGCAAT
CTGATTGGTTCTCATTGAATATTCATATTTTCAAAGTCTATATGTACTAT
CGAAGTTGTAAAAATAATTCAAAATGCAGAATATAGAACTAAATGAAAGC
AAACTGATTAAATCTCACAATAATATCAACAATGAAAATCCTTCAAATTG
TCGAACAATCGCACTTTTGGCGGAAAATTCAGATGAATCAAAAAATTTGG
AAAACCATTCAGATCCCCAAACAAGAAAACATTGGGCAAGCCAATTAGAT
TTTCTGTTTTCCATTATTGGATTTGCAGTTGATTTCTCCAATGTATTCAG
ATTTCCTTATATTTGCTTTCAAAACGGTGGAGGAGCTTTTCTTATTCCAT
ATTTCGTTACTTTATTGTTGTGCGCTTTGCCGATGTTTTACATTGAATTG
TTGTTTGGACAATACATGCGATGTGGAGGTTTGACAATCTGGAAAATTTG
CCCATTATTTAAAGGAGTTGGATATGCGTCAGTTTTATTAAACTTTTACG
TGGCTTTATATTACAATGTAATAATAGCGTGGTCGCTTTATTATTTGTTT
GTGTCCTTCTCTCCAACTCTTCCTTGGACAGTTTGCGATAAATGGTGGAA
TTCAGAAAACTGTTATTTCATTTCCAATTATTTAAGTTTGCTTGAAAAAA
ATAACAACACCAATATGTTTACTGATTCAGCAACCGAATACTTAGAAAAT
AATGTTCTGATGGTTAATCAAAGCAGTGGAATTGGAAATTTGGGTCCGTT
GAAGTGGAACATGGCATTGTCATTGCTTCTTTTGTATATAATTATTTATT
TGTGCTTATTTAAAGGAGTTAAATTCTTGGGAAAAGCTGTTTGGGTAACT
GCTATTTTACCCTATGTAGTACTTGCAGCACTTCTCATTCGTGGCGTTAT
GTTGGAAGGAGCAGTTGAAGGAATAAAGTACTTCATTACTCCTAATTTTA
AAATGTTGCTAAAACCGGATGTTTGGATCGCAGCAGCTACTCAGATTTTC
TTTTCAGTTGGAGTAGGGTTCAGTGTTCATATAGCATATGCGTCGTACAA
CAATTTTCACACTCCGGTTCACAACAACTGCTTGATAGCTGCAGCAGTCA
ATAGTTTGACAAGTTTATTTTCCGGATTTGTTATTTTTGCTTATTTGGGA
TACATGAGCCATCAAATGCGCAAACCTTTGGAAAAAGTCGTAAACGGAAA
TCTTACTCTTATTTTTATCGTTTATCCGCTTGCCTTATCAACTCTTCCCG
GTGGAAACTTTTGGGCAGTCATATTTTTTCTGATGCTTTTCAATCTTGGC
CTGGATAGTTCGGTTCGGGCAAGTATAATATTAAATTTTGAACTAATTTA
TTTCAGTTCGGAGCCCTTGAAGCTTTACTAACCGGTATTCTGGATGAATT
TGATTTCGTATTTAAAAAAATGAAATACAAAAGAGAAATTACAACTGCTG
TAATGTTAACAATTTTGTATTTTTTGTCACTACCTAATACAACTTATGGA
GGATTTTTTCTCATTCAACTTTATGATAAATACAGTGCTGGTCCAAGTCT
TTTAGCTGTTTCATTACTCGAATGTATCGGGTTTATATGGATTTACGGAA
TTGATAATACGGCTGACATTATTAAACAAATGAATGGTTTTGATCTGCAC
ATCATATTTAGGATCTTATTCAAATATATCACTCCCTTTGCGATTCTAGC
AATCACAATTGCACAGTTATTTACTGATGAAATTTTTACTGTTAATCTCG
GAACTCGTACTTACACTTATCCCCAGTGGAGTATAATAATTGGGAAAATT
ATTAGTCTCAGTTCAATAATGATGATCCCGATATTTGGCGGCGTGGTCCT
CTACCGAATAAAAGCTACCTCGTGGAAAGAAAGAATTTGTCTGTCGATCT
CCCCAAATTGGGAGCATCGTGACATAAGATCAAAGACCCAATTTAATAGA
TTAAAAATCAACCACTGGATAACTGTGTGAATATTTTGTATCATATATCT
CGCTTGTTTATAAAGTTTTATGTTAAATTTAATTTCAATTGTTGTTTTGC
ATAAGTTAAAGTGTAAGTGATATAGTTACTGAGAACGAGAGGTGGTGGAT
CATATAGAAATTCATATATAAATACAAGACGTTCATGTTTCTTACCCACT
GCTTGCTGCGCTACAATGAAAAGTTTACAAAGACCAGTTGAGAAATGCTT
TTTAAGAATCTATCAGTTGGGTAAG
back to top

protein sequence of SMED30032979-orf-1

>SMED30032979-orf-1 ID=SMED30032979-orf-1|Name=SMED30032979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=436bp
MQNIELNESKLIKSHNNINNENPSNCRTIALLAENSDESKNLENHSDPQT
RKHWASQLDFLFSIIGFAVDFSNVFRFPYICFQNGGGAFLIPYFVTLLLC
ALPMFYIELLFGQYMRCGGLTIWKICPLFKGVGYASVLLNFYVALYYNVI
IAWSLYYLFVSFSPTLPWTVCDKWWNSENCYFISNYLSLLEKNNNTNMFT
DSATEYLENNVLMVNQSSGIGNLGPLKWNMALSLLLLYIIIYLCLFKGVK
FLGKAVWVTAILPYVVLAALLIRGVMLEGAVEGIKYFITPNFKMLLKPDV
WIAAATQIFFSVGVGFSVHIAYASYNNFHTPVHNNCLIAAAVNSLTSLFS
GFVIFAYLGYMSHQMRKPLEKVVNGNLTLIFIVYPLALSTLPGGNFWAVI
FFLMLFNLGLDSSVRASIILNFELIYFSSEPLKLY*
back to top

protein sequence of SMED30032979-orf-2

>SMED30032979-orf-2 ID=SMED30032979-orf-2|Name=SMED30032979-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=479bp
MSNNHDVDLDDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLD
YVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLA
SQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNT
PASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTY
APDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNN
SNKTIKKIKIAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCK
VYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQ
YKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSK
IQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNK
ENILSADDDLIFEDFARLRLTGGDKNDP*
back to top

protein sequence of SMED30032979-orf-3

>SMED30032979-orf-3 ID=SMED30032979-orf-3|Name=SMED30032979-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=187bp
MKYKREITTAVMLTILYFLSLPNTTYGGFFLIQLYDKYSAGPSLLAVSLL
ECIGFIWIYGIDNTADIIKQMNGFDLHIIFRILFKYITPFAILAITIAQL
FTDEIFTVNLGTRTYTYPQWSIIIGKIISLSSIMMIPIFGGVVLYRIKAT
SWKERICLSISPNWEHRDIRSKTQFNRLKINHWITV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR000698Arrestin
IPR011022Arrestin_C-like
IPR014752Arrestin_C
IPR014753Arrestin_N
IPR011021Arrestin-like_N
IPR017864Arrestin_CS
IPR014756Ig_E-set
IPR000175Na/ntran_symport
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0006836neurotransmitter transport
Vocabulary: molecular function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000698ArrestinPRINTSPR00309ARRESTINcoord: 79..97
score: 80.98
coord: 42..64
score: 67.46
coord: 182..199
score: 56.45
coord: 310..328
score: 82.17
IPR000698ArrestinPANTHERPTHR11792ARRESTINcoord: 23..475
IPR011022Arrestin C-terminal-like domainSMARTSM01017Arrestin_C_2coord: 220..379
e-value: 4.3E-34
score: 129.2
IPR011022Arrestin C-terminal-like domainPFAMPF02752Arrestin_Ccoord: 221..378
e-value: 2.4E-28
score: 99.2
IPR014753Arrestin, N-terminalGENE3DG3DSA:2.60.40.840coord: 18..203
e-value: 1.7E-83
score: 280.5
IPR014752Arrestin, C-terminalGENE3DG3DSA:2.60.40.640coord: 207..445
e-value: 2.0E-78
score: 264.9
IPR011021Arrestin-like, N-terminalPFAMPF00339Arrestin_Ncoord: 37..200
e-value: 1.3E-32
score: 112.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..420
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availablePANTHERPTHR11792:SF17KURTZ ARRESTINcoord: 23..475
IPR017864Arrestin, conserved sitePROSITEPS00295ARRESTINScoord: 79..97
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 24..202
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 204..386