Alpha-int-3

Overview
NameAlpha-int-3
Smed IDSMED30032970
Length (bp)3827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-int-3 (SMED30032970) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-int-3 (SMED30032970) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-int-3 (SMED30032970) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-int-3 (SMED30032970) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032970

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30032970SMESG000034289.1 dd_Smed_v4_8943_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30032970SMESG000034289.1 dd_Smed_v4_8943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032970SMESG000034289.1 dd_Smed_v4_8943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032970SMESG000034289.1 dd_Smed_v4_8943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032970SMESG000034289.1 dd_Smed_v4_8943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032970SMESG000034289.1 dd_Smed_v4_8943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032970SMESG000034289.1 Contig48122uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032970SMESG000034289.1 Contig48122newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30032970SMESG000034289.1 dd_Smed_v4_8943_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-int-3 vs. Ensembl Human
Match: ITGA3 (integrin subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:6139])

HSP 1 Score: 174.096 bits (440), Expect = 2.671e-43
Identity = 223/915 (24.37%), Postives = 381/915 (41.64%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDSNET--TGALFSCPVTKETQDCKKFVFS------EHSNESL-LGYVVDSNSHEGLIYTCAPKFLR----SHTYVKYVEGACWEFNEMFNEVEQISNQDCL----ESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSII--NTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSP-GSCQPILTMQAVLSLPTEGEQYILHMG---NVSKFKLEIQTKNIATT-----DDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVK----------------ESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACN 2684
            ++N+D     +K    N  S FG+S+ +    +   +Y L+ GAP ++      T  TGA++ CP+T    DC++   +       H  E + LG  V S    G +  CA ++ +         + + G C+      N++E  S+ D      E   S +   E   C  G +     +  +   AP +Y  KG   N+    R+    S Y      +    Y G++M VG    +P   +IV G+P        R +      ++ +     L    V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G ++V+    M+Q+       P      LLL      S   +G+S+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+ I G+ +  P L  +G+S+ G+  D+D N YPD +VGS LS H+V +R RP+I     N+V +T +  P   D    C +      C++  V + + Y      P+Y  + T+ Y +E      +     RL F    + V  G     +    K   ++  N  + L P+ +  N SLP+ +  +  L +  +               YP+L + +    +T + F   C P   C+  L M+A     +E +Q +  +    +V K  L I   N  T+     D ++A  T ++                        L+ +   P  A Q++   F C L N F  N +                  + + + +   S Q +L P++L + V       L ++    N++ +     +++G S +   E +G  +K+   +    +  V L + +L + +P+E+S      +G++LLY    P      GN    C 
Sbjct:   32 AFNLDTRFLVVKEAG-NPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRG---NDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAP--------RHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVF----MNQAGTSFPAHP-----SLLLHGP---SGSAFGLSVASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQ-MDVDENFYPDLLVGS-LSDHIVLLRARPVI-----NIVHKTLVPRPAVLDP-ALCTATS----CVQ--VELCFAYNQSAGNPNYRRNITLAYTLEA----DRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDA-------------YPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAAFV--SEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVV---------------------PPALLLSSVRPPGACQANETIF-CELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMV----NHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVS------NGKWLLY----PTEITVHGNGSWPCR 847          
BLAST of Alpha-int-3 vs. Ensembl Human
Match: ITGA3 (integrin subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:6139])

HSP 1 Score: 173.711 bits (439), Expect = 3.007e-43
Identity = 223/915 (24.37%), Postives = 381/915 (41.64%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDSNET--TGALFSCPVTKETQDCKKFVFS------EHSNESL-LGYVVDSNSHEGLIYTCAPKFLR----SHTYVKYVEGACWEFNEMFNEVEQISNQDCL----ESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSII--NTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSP-GSCQPILTMQAVLSLPTEGEQYILHMG---NVSKFKLEIQTKNIATT-----DDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVK----------------ESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACN 2684
            ++N+D     +K    N  S FG+S+ +    +   +Y L+ GAP ++      T  TGA++ CP+T    DC++   +       H  E + LG  V S    G +  CA ++ +         + + G C+      N++E  S+ D      E   S +   E   C  G +     +  +   AP +Y  KG   N+    R+    S Y      +    Y G++M VG    +P   +IV G+P        R +      ++ +     L    V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G ++V+    M+Q+       P      LLL      S   +G+S+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+ I G+ +  P L  +G+S+ G+  D+D N YPD +VGS LS H+V +R RP+I     N+V +T +  P   D    C +      C++  V + + Y      P+Y  + T+ Y +E      +     RL F    + V  G     +    K   ++  N  + L P+ +  N SLP+ +  +  L +  +               YP+L + +    +T + F   C P   C+  L M+A     +E +Q +  +    +V K  L I   N  T+     D ++A  T ++                        L+ +   P  A Q++   F C L N F  N +                  + + + +   S Q +L P++L + V       L ++    N++ +     +++G S +   E +G  +K+   +    +  V L + +L + +P+E+S      +G++LLY    P      GN    C 
Sbjct:   32 AFNLDTRFLVVKEAG-NPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRG---NDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAP--------RHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVF----MNQAGTSFPAHP-----SLLLHGP---SGSAFGLSVASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQ-MDVDENFYPDLLVGS-LSDHIVLLRARPVI-----NIVHKTLVPRPAVLDP-ALCTATS----CVQ--VELCFAYNQSAGNPNYRRNITLAYTLEA----DRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDA-------------YPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAAFV--SEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVV---------------------PPALLLSSVRPPGACQANETIF-CELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMV----NHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVS------NGKWLLY----PTEITVHGNGSWPCR 847          
BLAST of Alpha-int-3 vs. Ensembl Human
Match: ITGA7 (integrin subunit alpha 7 [Source:HGNC Symbol;Acc:HGNC:6143])

HSP 1 Score: 169.474 bits (428), Expect = 6.928e-42
Identity = 163/561 (29.06%), Postives = 253/561 (45.10%), Query Frame = 3
Query:   57 FINFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIK-YFLIGAPFDILKDSNET--TGALFSCPVTKETQDCKKF-------VFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE-----GACWEFNEMFNEVEQISNQDCLESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQ------------YTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELD 1637
            F + +   LF   V   ++N+D+     K       S FGFS+ +    Q   + + L+GAP  +     +   TG LF+CP++ E  DC +        +  E      LG  V S    G I TCA ++       + +E     G C+  ++     +++   +  +  +   Q +E +  C  G AA  S +   L+  AP +Y  KGLL   N     +S   + L ++  +   +            Y GFS+  GK        S V G+P        R   K   V++ K   + L    ++ GE   SG+GYS+   DLN+DG  +L+VGAP+         G V+VY N     + I     PL    RL  +      +  +GISL  +GD+N+D   D+AVGAPF  DG G V+IY G S  ++ K SQ +EG+ +   ++ +G+S+ G + D+D N YPD +VGS L+   V  R RPI+ V  E  +A      P S D L++ N  G    C+ L V   Y    +    SY+ +  +DY ++ D
Sbjct:   19 FGSLLVELLFSRAV---AFNLDVMGALRKEG--EPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE-WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNI----DSSDPDQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAP--------RANHKGAVVILRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGIS----PL----RLCGSP-----DSMFGISLAVLGDLNQDGFPDIAVGAPF--DGDGKVFIYHGSSLGVVAKPSQVLEGEAVG--IKSFGYSLSG-SLDMDGNQYPDLLVGS-LADTAVLFRARPILHVSHEVSIA------PRSID-LEQPNCAGGHSVCVDLRVCFSY----IAVPSSYSPTVALDYVLDAD 531          
BLAST of Alpha-int-3 vs. Ensembl Human
Match: ITGA7 (integrin subunit alpha 7 [Source:HGNC Symbol;Acc:HGNC:6143])

HSP 1 Score: 164.081 bits (414), Expect = 3.090e-40
Identity = 158/537 (29.42%), Postives = 242/537 (45.07%), Query Frame = 3
Query:   57 FINFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIK-YFLIGAPFDILKDSNET--TGALFSCPVTKETQDCKKF-------VFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE-----GACWEFNEMFNEVEQISNQDCLESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQ------------YTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYY 1565
            F + +   LF   V   ++N+D+     K       S FGFS+ +    Q   + + L+GAP  +     +   TG LF+CP++ E  DC +        +  E      LG  V S    G I TCA ++       + +E     G C+  ++     +++   +  +  +   Q +E +  C  G AA  S +   L+  AP +Y  KGLL   N     +S   + L ++  +   +            Y GFS+  GK        S V G+P        R   K   V++ K   + L    ++ GE   SG+GYS+   DLN+DG  +L+VGAP+         G V+VY N     + I     PL    RL  +      +  +GISL  +GD+N+D   D+AVGAPF  DG G V+IY G S  ++ K SQ +EG+ +   ++ +G+S+ G + D+D N YPD +VGS L+   V  R RPI+ V  E  +A      P S D L++ N  G    C+ L V   Y
Sbjct:   19 FGSLLVELLFSRAV---AFNLDVMGALRKEG--EPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE-WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNI----DSSDPDQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAP--------RANHKGAVVILRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGIS----PL----RLCGSP-----DSMFGISLAVLGDLNQDGFPDIAVGAPF--DGDGKVFIYHGSSLGVVAKPSQVLEGEAVG--IKSFGYSLSG-SLDMDGNQYPDLLVGS-LADTAVLFRARPILHVSHEVSIA------PRSID-LEQPNCAGGHSVCVDLRVCFSY 511          
BLAST of Alpha-int-3 vs. Ensembl Human
Match: ITGA7 (integrin subunit alpha 7 [Source:HGNC Symbol;Acc:HGNC:6143])

HSP 1 Score: 159.844 bits (403), Expect = 7.198e-39
Identity = 155/528 (29.36%), Postives = 237/528 (44.89%), Query Frame = 3
Query:  165 SFFGFSLNIFTSKQNSIK-YFLIGAPFDILKDSNET--TGALFSCPVTKETQDCKKF-------VFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE-----GACWEFNEMFNEVEQISNQDCLESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL---------------LINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELD 1637
            S FGFS+ +    Q   + + L+GAP  +     +   TG LF+CP++ E  DC +        +  E      LG  V S    G I TCA ++       + +E     G C+  ++     +++   +  +  +   Q +E +  C  G AA  S +   L+  AP +Y  KG                L +  + +         L    +NS   Y GFS+  GK        S V G+P        R   K   V++ K   + L    ++ GE   SG+GYS+   DLN+DG  +L+VGAP+         G V+VY N     + I     PL    RL  +      +  +GISL  +GD+N+D   D+AVGAPF  DG G V+IY G S  ++ K SQ +EG+ +   ++ +G+S+ G + D+D N YPD +VGS L+   V  R RPI+ V  E  +A      P S D L++ N  G    C+ L V   Y    +    SY+ +  +DY ++ D
Sbjct:   50 SLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE-WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAHLDDGPYEAGGEKEQDPRLIPVPANS---YFGFSIDSGKGLVRAEELSFVAGAP--------RANHKGAVVILRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGIS----PL----RLCGSP-----DSMFGISLAVLGDLNQDGFPDIAVGAPF--DGDGKVFIYHGSSLGVVAKPSQVLEGEAVG--IKSFGYSLSG-SLDMDGNQYPDLLVGS-LADTAVLFRARPILHVSHEVSIA------PRSID-LEQPNCAGGHSVCVDLRVCFSY----IAVPSSYSPTVALDYVLDAD 535          
BLAST of Alpha-int-3 vs. Ensembl Celegans
Match: ina-1 (Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03600])

HSP 1 Score: 142.51 bits (358), Expect = 5.534e-34
Identity = 244/1077 (22.66%), Postives = 437/1077 (40.58%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPF-DILKDSNETTGALFSCPVTK-----ETQDCKKFVF--------SEHSNES--------------LLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLE-SIKSESQNYEYRNCLTG-AALKSLERKQLVLTAPYSYEGKGLL-------INNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKI-FRNPNVKSIVLGSPGISQYDSTRTQI--KFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTN------NNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSN----GQYGISLENIGDINKD--FIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMIS----PDL-----RGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDM------PFIKTSSSKRLYFENKLNTVTGGGSINCKTP-NSKSNSIINTFN--ILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPG-SCQPILTMQAVL-SLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSP--QRHLRPIVLKIKVKMVANIDLKL--LVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFS--ITTGNKKI-ACNVDILNNITNVIKTRI-----YQDIIPISKLEDVQLKKV-------------TVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            S+N+D+N+P  +  +  + + FG+S+         +   LIGAP  +  +   E  GA+++C +           C++  F        ++  NE+              L   +V   +  G    CAP  +R H    Y +GAC+E     N   Q +   C + ++ +  ++ EY  C+ G +A  + +     L     + G G+        I ++   +      N    R     + Y G+S+ +G+  F   + K I + S G ++Y      I   F Q    KL  N  +++  I G   GS +GYS+  +DLN DG D+L+VGAPF +      N  G V+VY++  + +   +H       E  L+    K L N     Q+G+S+  +G+++ D   + D AVGAPF  DG GAVYIYLG  +  I+  +K   Q+I     P+L     R +GFS+ G   D+D N YPD ++GS     V  +R+RP+I +  ++ + E  M      D  K  N       C  L + IY          +   ++ +D+  ++ M      PF +  ++ R + E       G  S N   P  S S+    T+   I  PV    +   P++     S+   + P +      L DL +YPVL +   +    + F   C    +CQ  L+++A    +P     Y+ ++G      L    +N         F                S     +T   + +   + +P+N       T +  L     E + +++     + + S   +  L+    + +V+++   +L++  +  PD   +   +    S +  EE IG  ++    + N+   +V  + +  I +P+++        G+  LYLL +P  +   T G  ++  C +       N  + ++      Q+  P  ++E  ++K+               V  N+P     +    F  K  D G   E   +  + C + +A C  V+C    +   S  + +    R+W  T IE++   + V I
Sbjct:   19 SFNLDVNAPIYR--YGPSGTNFGYSVAEHFKGDKPV--MLIGAPRGESGQTGTERAGAMYACDINTFYNGGSNHWCEQVRFEYENVEDYAKRPNETRGRTVHPLGKNDQLLASTIVSKGTKNGSALVCAP-LIRYHQTAAYPQGACYELES--NLRLQSTYATCAQKNLPTTDRHNEYGGCMEGFSAAITQDTIVTGLIGAVKWTG-GVFAKKSSANIFDSVVEKYTMNQPNGDMIRTRLVAHDYLGYSVDIGRFGFWYEDGKPITVVS-GATRYGEHGAVIFLPFIQDSSSKLTLNEDKFI--INGTAMGSAFGYSIEVVDLNGDGFDDLIVGAPFEHRSGIDGNFGGIVYVYFSQGVQRK--QH-------ESHLVFHPPKILKNPDFYSQFGLSITKLGNVDGDKSKLNDFAVGAPFAFDGAGAVYIYLGTKN--IEKFRKKPAQVIKGNDLPNLPPGGMRSFGFSLSG-GSDMDENGYPDLLIGSPSKNFVALLRSRPVISIETKHKM-EKRM-----VDIDKGVNCPRGAKTCFPLDMVIY------VDEETKRGAELVDFSSDVFMCNLEAIPF-RADTTARGFIE-------GSHSHNYSWPCGSNSHVQKRTYRQLIYLPVQESKDWITPLKFRFTVSIRNEKKPVQPPQGSQLVDLKHYPVLNKYGASYEFDVPFNTLCGEDHTCQTDLSLKAAFKDIPLTSNGYVSNVGEKDYLDLTFTVENKKEKAYQANFYLEYNEEELELPQVQGSKRMIAETIGKNIVHLPLGNPMNGASKHQFTIQFKLTRGRTEGIGKALKFMAHVNSTSQETEEELKDNKWEAEVQIIKKAELEIYGISDPDRVFFGGKA-RAESELELEEDIGTMVRHNYTIINHGPWTV-RNVEAHISWPYQLRSRFGR--GKNALYLLDVPTITTEFTDGTSEVRKCFIKQQYEYVNPAEIKLNTKYSTQETAP-HRVEH-RMKREIDEDEEEQSDDLGAVEENIPWFSTANFWNLFAIKGGD-GRPRE---VKHLSCQDNTANCFTVICHFDFIDANSA-VVIDLRARLWNATFIEDYSDVESVKI 1041          
BLAST of Alpha-int-3 vs. Ensembl Celegans
Match: pat-2 (Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot;Acc:P34446])

HSP 1 Score: 110.923 bits (276), Expect = 3.587e-24
Identity = 140/552 (25.36%), Postives = 232/552 (42.03%), Query Frame = 3
Query:  168 FFGFSLNIFTSKQNSIKYFLIGAPFDILKDSN----ETTGALFSCPVTKETQDCKK-----------------FVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE--GACWEFNEMFNEVEQISNQDC-LESIKSESQNYEYRNCLTGAALKSLERKQLV-LTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIG----KLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF-----------TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFEN-DGTGAVYIYLGDSHQIIKL-SQKIEGQMISP-DLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPF--IKTSSSKRLYFENK 1688
            +FG+SL+ F  +Q  +   ++GAP     + N       GA+++C V + T  C++                  V  E  +    G  V SN     I  CAPK+   ++  + +E  G C+     F+  E+ S+  C  E  +       Y  C   AA+   + +  V + AP  +  +G + + N  ++ +  ++ Y    +    +   G+S A G    +  +  IV G P        R     G++V+     K++ N  + V    G+  G     SV   D+N DG D++++G PF           T     Q  V   I M Q      T P    K++ +    +   G++G ++   GD+N D   D+ VGAP+   +  GAVY+  G    + +L +QKIEG  I   +++ +GFS+ G NED+D N  PD  VG+  SG+   + T+P++ V  +    E +  L    D  K C+ +G      KL      +   + TC  Y        ++E D+ F     S   R YF  K
Sbjct:   42 YFGYSLD-FYHEQKGMPVLVVGAPEAESNNPNLAGIRRPGAVYACSVNRAT--CREVHVDKMKGNLKKLNGSHLVPIEEKSHQFFGATVRSNDKHDKIVVCAPKYTYFYSKFEVIEPVGTCFYAENGFDNAEEFSS--CKQEPARHGRHRLGYGQCGFSAAVPGKKNQNRVFIGAPGVWYWQGAMFSQNIKNQTDRPNTEY---GSKEYDHDMMGYSTATGDFDGD-GIDDIVAGVP--------RGNDLHGKLVLYTSKLKMMINLTDEVSTQHGQYCGG----SVAVADVNKDGRDDIIMGCPFYTDYGSVKDAKTQERKPQYDVGKVIVMLQ------TAPGVFGKQIAVVGDDQW--GRFGHAVAAAGDLNLDGYNDVIVGAPYAGKNKQGAVYVIHGSKDGVRELPTQKIEGANIGHGNIKSFGFSLTG-NEDVDGNGMPDIAVGAWKSGNAAVLLTKPVVTVTGQ---TEPESALISVED--KNCDVDG------KLGKQACKH---INTCFKYEGKGDTPNDLEFDLRFNLDDHSPEPRAYFLQK 549          
BLAST of Alpha-int-3 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0340190)

HSP 1 Score: 202.216 bits (513), Expect = 2.821e-52
Identity = 257/1099 (23.38%), Postives = 456/1099 (41.49%), Query Frame = 3
Query:   63 NFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ----NSIKYFLIGAPFDILKDSNET-TGALFSCPVTKETQDCKKFVFSEHSN----------------ESLLGYVVDSNSHE-----GLIYTCAPKFLRSHTYVKYVEGACWEFNE--MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLL----INNNFYSRENSRS-SNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVI-GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMIS---PD---LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKL----SVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISL---PIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGS-CQPILTMQAVLSL-PTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATF-------ECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSL---LGFSSITGEEKIGP----------KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDG-QYLLYLLRIPKFSITTGNKKIACN-VDILNNITNVIKTRIYQDIIPISKL------------------------------EDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            N   L +    +  +++N++   P +K  + +  S FG+S+   T  +    N     L+GAP D  +  N T +GAL+ CP+T+   DC++ +     N                +  +G  V SN  +     G +  CA +++      +Y +G C+       F EV    ++ C +    + Q+ +Y  C  G +   L+   +VL +P  Y  +G +    +   +  R+ +   S++    +   KY Y G S+  G+ F +    S   G+P        R++   GQVVI  K  +N +    ++ GE FGS +GY +   D+N D   +L+V AP  FT    G V+VY NI+         T+P+  +  L LT   +    ++G++L NIGD+NKD  +DLAVGAP+E  G G VYIYLG S  +  K +QKI+   +    P+   +R +G SI G N DLD N+YPD ++G+  S   V +  RPII +       E     P +   L    SN   + C       S+  Y              ++T D+  +    F     +KR    +++  V   G   C+       +  NT +I  PV      SL   P+  +    LN                    P+L++ + ++     F   C     C+  L ++   ++  + G +Y L + + ++ ++ I   N+A    + A+   + + + A    + +  P   T  S        S  N    D  TF       + + P++ I  +   I+ N + + + P+R  R   L++ V   A ++ +    P+   Y   S+   +  ++ T  E  GP             FTI    N   S     +++I++P+ +  +P      QYLLYL ++P   ++ G   +A   V+ LN  +   +   Y       ++                              +D Q  +  V  +  +     + + + P+ S++ +  + ++IV +DC +G+  CV + CD+  +   S E  +    R+W  TL+  + + + V I
Sbjct:   18 NLGILIILQCVLTCYNFNLEQRLPIVK--YGHPHSHFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNTTHSGALWRCPMTQRFDDCEQVITDGRRNFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEV----HEPC-KGRPVQRQHEDYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGH---MSYAAGAP--------RSE-GHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKTEGGAVYVYQNIQ--------DTLPM--KYTLKLTGPLE---SRFGLALANIGDLNKDNCEDLAVGAPYE--GNGVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISG-NTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPASN---LTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKFSRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKA--NTRDIQTPVRFRLKYSLVEPPLADSALVRLN--------------------PILDQTQAHVDFEGTFQKDCGDDDLCESNLIIRVEPNITESSGNEYTLIL-DETELEVRINVSNLA----DSAYEAQLFIAHQAGVSYVATKKPTNATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPSEKI--MLFHIFANTTSKLVGPERPERD--LRVNVVRRAKLNFRGWAIPEQSFYSGSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIF---NEGPSTAPKVQMVIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLASGSRENPAYLSAPAQMRMFPSQSRHSFNKSLIHSQRSYYSSSHRDDHSDDTQSNRNRVRRSFLERVTRLERLMYDPESSNAAN-GKKQDIVELDCNKGATNCVRIECDILNMPALS-EAQVVVKARLWNSTLVSEYPRVERVRI 1042          
BLAST of Alpha-int-3 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0073732)

HSP 1 Score: 201.445 bits (511), Expect = 3.516e-52
Identity = 257/1099 (23.38%), Postives = 456/1099 (41.49%), Query Frame = 3
Query:   63 NFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ----NSIKYFLIGAPFDILKDSNET-TGALFSCPVTKETQDCKKFVFSEHSN----------------ESLLGYVVDSNSHE-----GLIYTCAPKFLRSHTYVKYVEGACWEFNE--MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLL----INNNFYSRENSRS-SNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVI-GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMIS---PD---LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKL----SVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISL---PIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGS-CQPILTMQAVLSL-PTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATF-------ECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSL---LGFSSITGEEKIGP----------KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDG-QYLLYLLRIPKFSITTGNKKIACN-VDILNNITNVIKTRIYQDIIPISKL------------------------------EDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            N   L +    +  +++N++   P +K  + +  S FG+S+   T  +    N     L+GAP D  +  N T +GAL+ CP+T+   DC++ +     N                +  +G  V SN  +     G +  CA +++      +Y +G C+       F EV    ++ C +    + Q+ +Y  C  G +   L+   +VL +P  Y  +G +    +   +  R+ +   S++    +   KY Y G S+  G+ F +    S   G+P        R++   GQVVI  K  +N +    ++ GE FGS +GY +   D+N D   +L+V AP  FT    G V+VY NI+         T+P+  +  L LT   +    ++G++L NIGD+NKD  +DLAVGAP+E  G G VYIYLG S  +  K +QKI+   +    P+   +R +G SI G N DLD N+YPD ++G+  S   V +  RPII +       E     P +   L    SN   + C       S+  Y              ++T D+  +    F     +KR    +++  V   G   C+       +  NT +I  PV      SL   P+  +    LN                    P+L++ + ++     F   C     C+  L ++   ++  + G +Y L + + ++ ++ I   N+A    + A+   + + + A    + +  P   T  S        S  N    D  TF       + + P++ I  +   I+ N + + + P+R  R   L++ V   A ++ +    P+   Y   S+   +  ++ T  E  GP             FTI    N   S     +++I++P+ +  +P      QYLLYL ++P   ++ G   +A   V+ LN  +   +   Y       ++                              +D Q  +  V  +  +     + + + P+ S++ +  + ++IV +DC +G+  CV + CD+  +   S E  +    R+W  TL+  + + + V I
Sbjct:   18 NLGILIILQCVLTCYNFNLEQRLPIVK--YGHPHSHFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNTTHSGALWRCPMTQRFDDCEQVITDGRRNFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEV----HEPC-KGRPVQRQHEDYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGH---MSYAAGAP--------RSE-GHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKTEGGAVYVYQNIQ--------DTLPM--KYTLKLTGPLE---SRFGLALANIGDLNKDNCEDLAVGAPYE--GNGVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISG-NTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPASN---LTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKFSRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKA--NTRDIQTPVRFRLKYSLVEPPLADSALVRLN--------------------PILDQTQAHVDFEGTFQKDCGDDDLCESNLIIRVEPNITESSGNEYTLIL-DETELEVRINVSNLA----DSAYEAQLFIAHQAGVSYVATKKPTNATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPSEKI--MLFHIFANTTSKLVGPERPERD--LRVNVVRRAKLNFRGWAIPEQSFYSGSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIF---NEGPSTAPKVQMVIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLASGSRENPAYLSAPAQMRMFPSQSRHSFNKSLIHSQRSYYSSSHRDDHSDDTQSNRNRVRRSFLERVTRLERLMYDPESSNAAN-GKKQDIVELDCNKGATNCVRIECDILNMPALS-EAQVVVKARLWNSTLVSEYPRVERVRI 1042          
BLAST of Alpha-int-3 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0310647)

HSP 1 Score: 197.593 bits (501), Expect = 7.135e-51
Identity = 259/1110 (23.33%), Postives = 458/1110 (41.26%), Query Frame = 3
Query:   63 NFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ----NSIKYFLIGAPFDILKDSNET-TGALFSCPVTKETQDCKKFVFS-------------------------EHSNESLLGYVVDSNSHE-----GLIYTCAPKFLRSHTYVKYVEGACWEFNE--MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLL----INNNFYSRENSRSSNYLKFRNSNS---KYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVI-GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMIS---PD---LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKL----SVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISL---PIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGS-CQPILTMQAVLSL-PTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATF-------ECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSL---LGFSSITGEEKIGP----------KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDG-QYLLYLLRIPKFSITTGNKKIACN-VDILNNITNVIKTRIYQDIIPISKL------------------------------EDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            N   L +    +  +++N++   P +K  + +  S FG+S+   T  +    N     L+GAP D  +  N T +GAL+ CP+T+   DC++ +                           E   +  +G  V SN  +     G +  CA +++      +Y +G C+       F EV    ++ C +    + Q+ +Y  C  G +   L+   +VL +P  Y  +G +    +   +  R+  +++ Y    + NS   KY Y G S+  G+ F +    S   G+P        R++   GQVVI  K  +N +    ++ GE FGS +GY +   D+N D   +L+V AP  FT    G V+VY NI+         T+P+  +  L LT   +    ++G++L NIGD+NKD  +DLAVGAP+E  G G VYIYLG S  +  K +QKI+   +    P+   +R +G SI G N DLD N+YPD ++G+  S   V +  RPII +       E     P +   L    SN   + C       S+  Y              ++T D+  +    F     +KR    +++  V   G   C+       +  NT +I  PV      SL   P+  +    LN                    P+L++ + ++     F   C     C+  L ++   ++  + G +Y L + + ++ ++ I   N+A    + A+   + + + A    + +  P   T  S        S  N    D  TF       + + P++ I  +   I+ N + + + P+R  R   L++ V   A ++ +    P+   Y   S+   +  ++ T  E  GP             FTI    N   S     +++I++P+ +  +P      QYLLYL ++P   ++ G   +A   V+ LN  +   +   Y       ++                              +D Q  +  V  +  +     + + + P+ S++ +  + ++IV +DC +G+  CV + CD+  +   S E  +    R+W  TL+  + + + V I
Sbjct:   18 NLGILIILQCVLTCYNFNLEQRLPIVK--YGHPHSHFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNTTHSGALWRCPMTQRFDDCEQVITDGRRTNGAYEINKHFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEV----HEPC-KGRPVQRQHEDYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRD--KTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGH---MSYAAGAP--------RSE-GHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKTEGGAVYVYQNIQ--------DTLPM--KYTLKLTGPLE---SRFGLALANIGDLNKDNCEDLAVGAPYE--GNGVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISG-NTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPASN---LTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKFSRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKA--NTRDIQTPVRFRLKYSLVEPPLADSALVRLN--------------------PILDQTQAHVDFEGTFQKDCGDDDLCESNLIIRVEPNITESSGNEYTLIL-DETELEVRINVSNLA----DSAYEAQLFIAHQAGVSYVATKKPTNATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPSEKI--MLFHIFANTTSKLVGPERPERD--LRVNVVRRAKLNFRGWAIPEQSFYSGSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIF---NEGPSTAPKVQMVIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLASGSRENPAYLSAPAQMRMFPSQSRHSFNKSLIHSQRSYYSSSHRDDHSDDTQSNRNRVRRSFLERVTRLERLMYDPESSNAAN-GKKQDIVELDCNKGATNCVRIECDILNMPALS-EAQVVVKARLWNSTLVSEYPRVERVRI 1051          
BLAST of Alpha-int-3 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0073731)

HSP 1 Score: 171.4 bits (433), Expect = 8.511e-43
Identity = 227/971 (23.38%), Postives = 403/971 (41.50%), Query Frame = 3
Query:  369 VDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNE--MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLL----INNNFYSRENSRS-SNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVI-GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMIS---PD---LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKL----SVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISL---PIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGS-CQPILTMQAVLSL-PTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATF-------ECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSL---LGFSSITGEEKIGP----------KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDG-QYLLYLLRIPKFSITTGNKKIACN-VDILNNITNVIKTRIYQDIIPISKL------------------------------EDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            + +N   G +  CA +++      +Y +G C+       F EV    ++ C +    + Q+ +Y  C  G +   L+   +VL +P  Y  +G +    +   +  R+ +   S++    +   KY Y G S+  G+ F +    S   G+P        R++   GQVVI  K  +N +    ++ GE FGS +GY +   D+N D   +L+V AP  FT    G V+VY NI+         T+P+  +  L LT   +    ++G++L NIGD+NKD  +DLAVGAP+E  G G VYIYLG S  +  K +QKI+   +    P+   +R +G SI G N DLD N+YPD ++G+  S   V +  RPII +       E     P +   L    SN   + C       S+  Y              ++T D+  +    F     +KR    +++  V   G   C+       +  NT +I  PV      SL   P+  +    LN                    P+L++ + ++     F   C     C+  L ++   ++  + G +Y L + + ++ ++ I   N+A    + A+   + + + A    + +  P   T  S        S  N    D  TF       + + P++ I  +   I+ N + + + P+R  R   L++ V   A ++ +    P+   Y   S+   +  ++ T  E  GP             FTI    N   S     +++I++P+ +  +P      QYLLYL ++P   ++ G   +A   V+ LN  +   +   Y       ++                              +D Q  +  V  +  +     + + + P+ S++ +  + ++IV +DC +G+  CV + CD+  +   S E  +    R+W  TL+  + + + V I
Sbjct:   47 LQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEV----HEPC-KGRPVQRQHEDYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGH---MSYAAGAP--------RSE-GHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKTEGGAVYVYQNIQ--------DTLPM--KYTLKLTGPLE---SRFGLALANIGDLNKDNCEDLAVGAPYE--GNGVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISG-NTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPASN---LTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKFSRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKA--NTRDIQTPVRFRLKYSLVEPPLADSALVRLN--------------------PILDQTQAHVDFEGTFQKDCGDDDLCESNLIIRVEPNITESSGNEYTLIL-DETELEVRINVSNLA----DSAYEAQLFIAHQAGVSYVATKKPTNATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPSEKI--MLFHIFANTTSKLVGPERPERD--LRVNVVRRAKLNFRGWAIPEQSFYSGSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIF---NEGPSTAPKVQMVIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLASGSRENPAYLSAPAQMRMFPSQSRHSFNKSLIHSQRSYYSSSHRDDHSDDTQSNRNRVRRSFLERVTRLERLMYDPESSNAAN-GKKQDIVELDCNKGATNCVRIECDILNMPALS-EAQVVVKARLWNSTLVSEYPRVERVRI 945          
BLAST of Alpha-int-3 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0310648)

HSP 1 Score: 171.014 bits (432), Expect = 1.108e-42
Identity = 229/973 (23.54%), Postives = 405/973 (41.62%), Query Frame = 3
Query:  369 VDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNE--MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLL----INNNFYSRENSRSSNYLKFRNSNS---KYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVI-GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMIS---PD---LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKL----SVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISL---PIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGS-CQPILTMQAVLSL-PTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATF-------ECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSL---LGFSSITGEEKIGP----------KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDG-QYLLYLLRIPKFSITTGNKKIACN-VDILNNITNVIKTRIYQDIIPISKL------------------------------EDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            + +N   G +  CA +++      +Y +G C+       F EV    ++ C +    + Q+ +Y  C  G +   L+   +VL +P  Y  +G +    +   +  R+  +++ Y    + NS   KY Y G S+  G+ F +    S   G+P        R++   GQVVI  K  +N +    ++ GE FGS +GY +   D+N D   +L+V AP  FT    G V+VY NI+         T+P+  +  L LT   +    ++G++L NIGD+NKD  +DLAVGAP+E  G G VYIYLG S  +  K +QKI+   +    P+   +R +G SI G N DLD N+YPD ++G+  S   V +  RPII +       E     P +   L    SN   + C       S+  Y              ++T D+  +    F     +KR    +++  V   G   C+       +  NT +I  PV      SL   P+  +    LN                    P+L++ + ++     F   C     C+  L ++   ++  + G +Y L + + ++ ++ I   N+A    + A+   + + + A    + +  P   T  S        S  N    D  TF       + + P++ I  +   I+ N + + + P+R  R   L++ V   A ++ +    P+   Y   S+   +  ++ T  E  GP             FTI    N   S     +++I++P+ +  +P      QYLLYL ++P   ++ G   +A   V+ LN  +   +   Y       ++                              +D Q  +  V  +  +     + + + P+ S++ +  + ++IV +DC +G+  CV + CD+  +   S E  +    R+W  TL+  + + + V I
Sbjct:   56 LQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEV----HEPC-KGRPVQRQHEDYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRD--KTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGH---MSYAAGAP--------RSE-GHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKTEGGAVYVYQNIQ--------DTLPM--KYTLKLTGPLE---SRFGLALANIGDLNKDNCEDLAVGAPYE--GNGVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISG-NTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPASN---LTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKFSRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKA--NTRDIQTPVRFRLKYSLVEPPLADSALVRLN--------------------PILDQTQAHVDFEGTFQKDCGDDDLCESNLIIRVEPNITESSGNEYTLIL-DETELEVRINVSNLA----DSAYEAQLFIAHQAGVSYVATKKPTNATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPSEKI--MLFHIFANTTSKLVGPERPERD--LRVNVVRRAKLNFRGWAIPEQSFYSGSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIF---NEGPSTAPKVQMVIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLASGSRENPAYLSAPAQMRMFPSQSRHSFNKSLIHSQRSYYSSSHRDDHSDDTQSNRNRVRRSFLERVTRLERLMYDPESSNAAN-GKKQDIVELDCNKGATNCVRIECDILNMPALS-EAQVVVKARLWNSTLVSEYPRVERVRI 954          
BLAST of Alpha-int-3 vs. Ensembl Zebrafish
Match: itga3a (integrin, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090805-3])

HSP 1 Score: 188.734 bits (478), Expect = 3.953e-48
Identity = 284/1149 (24.72%), Postives = 484/1149 (42.12%), Query Frame = 3
Query:   60 INFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKY-FLIGAPFDILKD--SNETTGALFSCPVTKETQDCKKFVFSEHSNES---LLGYVVDS----------NSHEGLIYTCAPKFLRSHTYVKYVEGACW-EFNEMFNEVEQISNQDCLESIK-SESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYL----KFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENS----LEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRGYGFSIFG----KNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYF-ENKLNTVTGGGSINCKTPNSKSNSI---INTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT--IHFGVGCS-PGSCQPILTMQAVLS-------LPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTY--IILTYDAKKINLFSNNPD-------RKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSK-------LLIYFPWEISGNPTE-TDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRV---VAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQN 3299
            +    +F+     L  ++N+D++   +K       S FG S+ +     N  ++  L+GAP +  +   S   TG +++CP++ +++DC +      + E    L  YV+D           +   G +  C  +++R+ T    + G C+   N++   +     Q   E     E+QN E   CL G +  ++   ++   AP  +  +G     N +S+ ++ +  +     K  +S     Y G+S  V +        ++V G+P        R + K G V++ +++++     ++    + GE  GS +G SV  +DLNNDG  +L+VGAPF      +  G V+VY N   S  N          +  ++LT  K   +  +G+S+  IGD+N+D  QD AVGAP+ +  TG V I+ G    I +  SQ I+G+    D+ G GF  FG    +  D+D N YPD  VGS L   VV +R+RP+I +  +N    T M +     +L+ C      + CI+  V   Y Y   T   S   + T+ Y +E D    ++S S R+ F +N     TG  S+N   P+   +S+   + +  I   V+              + L+VS V         L DLS +PV+ + ++ LT    IH    C     C+  L M A  +       L  E  Q   +  ++ K KL +   N+ + +  KA   Y  I+       ++  S NP          +S  S L+  +  P  + Q      E       I    + I   + +  +S Q  LRP+   + V+ +      L+  P        +++G S++     IG  ++F I        SV +S K       L + F W     P+   + ++LLYL  I      TG  +  C   +   I N +   + +      K ++V                +S+    + + +  G     E   +++C +G+ARC    C   PLS       L    R+W  T++E++ + K V +   V         + L+    N K   +I    V +   VA  L    P      ++ II++V +GV++L  IVI+L+KC FF+R N
Sbjct:    9 LRLTLVFVLSAARLCQAFNLDVSFAVVKEGKTAG-SLFGLSVALHEQVVNEKRHMLLVGAPKEKAESGLSANETGDVYACPISADSKDCARLNLISSNPEDKPDLKNYVIDGMWLGVSIVSQSQPGGRVVACGHRYIRNFTSNFRMIGRCYVRGNDLQLNLSDYQWQSYDEICDPREAQNSEGM-CLLGMS-AAVTFSEIFFGAPGCFNWQG-----NIFSKWHNPADEFHLLKSKLPDSRKGNIYIGYSTIVDQDVLVKGKDTVVTGAP--------RDEAK-GSVMMAEVLKSGGSGEVKIKVTVTGEQVGSYFGNSVAVVDLNNDGWKDLIVGAPFYFDRKMDKGGAVYVYMNQNGSFRN----------KSDVVLTGPK---DSGFGMSVVAIGDVNQDGFQDFAVGAPYHS--TGRVSIWTGSKTGISQEPSQVIDGK----DIPGGGFQTFGYSISRGLDVDRNGYPDIAVGS-LDDRVVLLRSRPVIHL--KNTFTVTPMVI-----NLEDC------VACIEAKVCFSYTYS--TGTASSQKAVTLQYTVEADQ---QSSRSPRVSFLDNNKGKYTGKMSVN---PSGDCHSLKLELASKTIQDKVSAII-----------FQLSVSVVDPPPSGGKMLEDLSAFPVISQ-RDALTGRAEIHIQKACGLDNKCESNLQMTAAFTDEKNTPFLMQEDHQIFNYTTDIKKLKLLVNVSNVPS-EGRKAEDAYNAILNITIPSSLSFSSLNPKLPSTLNGDPSSGGSYLLCTLGDPFKSNQ--RVEIEITFETSGISIDMQEIETELQLSTLSDQNDLRPLSRVLLVEYILQPLFNLI--PYFRAEFSGNVVGESAMKSTSDIGSPVEFNI--------SVDISGKPLGNLGFLEVVFQW-----PSAVANEKWLLYLSEIQ----MTGTSESFC---VAKGIVNPLNLTVSERKSRRRKRDEV----------------LSESKLAMSQKTRQGQNKPRE---VLNCTKGTARCQTFSC---PLSAMKTSAMLTVRARVWNSTMLEDY-RAKGVSVQGSVM--------LTLKTDKKNIKMNNNIREFTVEIDPAVAEELPYEAP------LWIIIVSVLSGVVMLGVIVILLWKCGFFKRAN 1025          
BLAST of Alpha-int-3 vs. Ensembl Zebrafish
Match: itga4 (integrin alpha 4 [Source:ZFIN;Acc:ZDB-GENE-110411-108])

HSP 1 Score: 182.956 bits (463), Expect = 2.666e-47
Identity = 189/682 (27.71%), Postives = 301/682 (44.13%), Query Frame = 3
Query:   72 FLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPF--DILKDSNETTGALFSCPVTKE---------TQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPK-----FLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYE--YRNCLTGAALKSLERKQLVLTAPYS--YEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIK-LSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFD-SLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSK-----RLYFE-NKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIH----FGVGCSPGSCQPILTMQAVLSLP 2015
            F  L+++ +L   YN+D+  P + +    N S FG+S+ +    +N+  + L+GAP        + ++ GA+++C +             Q C +   +E+ N+  LG  +   + +G +  C  +     +       K   G C+ F+        I     +   K   + +   Y +C  G +  S     +V+ AP +  + G  L++N       ++ S+ Y+   +      Y G+S++ G  F +P    IV G+P   Q++ T      G+  I ++  N+L+ V    G+  GS YG SV A+DLN DG+ +L+VGAP   +    G+V+VY N    Q   E K      E    L      +  ++G ++ N+GDI+ D   D+A+GAP E+D  GA+YIY G    I +  SQ+I G ++  + R +G S+ G   D+DSN YPD  VG+ LS   V  RTRP+++V A        M LP S + S+ +C  NGQ   CIK+ V                  K I   IEL          K     R YF  N  + VT G         +K   +   F+  F      +I  PI   +K+ L    V +R+L           P+L++ K+ L N I     F   CS  +C   L + A L LP
Sbjct:   17 FGILWYLLILCDCYNLDVEHPLVFNG--PNGSLFGYSVLLHQHNENT--WLLVGAPVANSSFYPNIKSPGAIYNCSMLNSQCEQLPVGGVQRCGRHCLAENDNQ-WLGVSLSRQASKGHVLACGHRWKNVFYSSKDNQNKLPHGVCFRFSPDLKHASHI-----IPCYKDHQRRFGEGYGSCQAGIS-NSFTEDLMVMGAPGTSYWTGSVLVVNTT-----SNISAAYVDDDSDVLYGSYLGYSVSAGH-FLDPQSTEIVGGAP---QHEQT------GKAYIFRIEGNTLKIVNKTKGKTLGSYYGASVCAVDLNADGLSDLLVGAPMFSSVREEGRVYVYIN----QGEAELK------EADFELVGSDSYA-ARFGETIINLGDIDDDGYPDVAIGAPQEDDLRGAIYIYNGRRSGIARSFSQRITGSLLGNNFRMFGQSVSG-GVDIDSNNYPDVAVGAFLSDSAVVFRTRPVVKVDAV-------MLLPESLNRSVAQCTENGQPAVCIKVRVCF------------RVRGKQIPGNIELKYNLTADVHHKEGFPSRFYFSGNGTSNVTAG------RVKAKHEQLTCVFHQAFMKKDVRDIFTPIHFEVKYELGEHRVVQRDLGDLPALK----PILQQ-KDELDNVIKNKTIFARYCSWENCSTNLQVSARLVLP 630          
BLAST of Alpha-int-3 vs. Ensembl Zebrafish
Match: itga4 (integrin alpha 4 [Source:ZFIN;Acc:ZDB-GENE-110411-108])

HSP 1 Score: 183.726 bits (465), Expect = 1.456e-46
Identity = 189/682 (27.71%), Postives = 301/682 (44.13%), Query Frame = 3
Query:   72 FLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPF--DILKDSNETTGALFSCPVTKE---------TQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPK-----FLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYE--YRNCLTGAALKSLERKQLVLTAPYS--YEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIK-LSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFD-SLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSK-----RLYFE-NKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIH----FGVGCSPGSCQPILTMQAVLSLP 2015
            F  L+++ +L   YN+D+  P + +    N S FG+S+ +    +N+  + L+GAP        + ++ GA+++C +             Q C +   +E+ N+  LG  +   + +G +  C  +     +       K   G C+ F+        I     +   K   + +   Y +C  G +  S     +V+ AP +  + G  L++N       ++ S+ Y+   +      Y G+S++ G  F +P    IV G+P   Q++ T      G+  I ++  N+L+ V    G+  GS YG SV A+DLN DG+ +L+VGAP   +    G+V+VY N    Q   E K      E    L      +  ++G ++ N+GDI+ D   D+A+GAP E+D  GA+YIY G    I +  SQ+I G ++  + R +G S+ G   D+DSN YPD  VG+ LS   V  RTRP+++V A        M LP S + S+ +C  NGQ   CIK+ V                  K I   IEL          K     R YF  N  + VT G         +K   +   F+  F      +I  PI   +K+ L    V +R+L           P+L++ K+ L N I     F   CS  +C   L + A L LP
Sbjct:   17 FGILWYLLILCDCYNLDVEHPLVFNG--PNGSLFGYSVLLHQHNENT--WLLVGAPVANSSFYPNIKSPGAIYNCSMLNSQCEQLPVGGVQRCGRHCLAENDNQ-WLGVSLSRQASKGHVLACGHRWKNVFYSSKDNQNKLPHGVCFRFSPDLKHASHI-----IPCYKDHQRRFGEGYGSCQAGIS-NSFTEDLMVMGAPGTSYWTGSVLVVNTT-----SNISAAYVDDDSDVLYGSYLGYSVSAGH-FLDPQSTEIVGGAP---QHEQT------GKAYIFRIEGNTLKIVNKTKGKTLGSYYGASVCAVDLNADGLSDLLVGAPMFSSVREEGRVYVYIN----QGEAELK------EADFELVGSDSYA-ARFGETIINLGDIDDDGYPDVAIGAPQEDDLRGAIYIYNGRRSGIARSFSQRITGSLLGNNFRMFGQSVSG-GVDIDSNNYPDVAVGAFLSDSAVVFRTRPVVKVDAV-------MLLPESLNRSVAQCTENGQPAVCIKVRVCF------------RVRGKQIPGNIELKYNLTADVHHKEGFPSRFYFSGNGTSNVTAG------RVKAKHEQLTCVFHQAFMKKDVRDIFTPIHFEVKYELGEHRVVQRDLGDLPALK----PILQQ-KDELDNVIKNKTIFARYCSWENCSTNLQVSARLVLP 630          
BLAST of Alpha-int-3 vs. Ensembl Zebrafish
Match: itga4 (integrin alpha 4 [Source:ZFIN;Acc:ZDB-GENE-110411-108])

HSP 1 Score: 183.726 bits (465), Expect = 1.456e-46
Identity = 189/682 (27.71%), Postives = 301/682 (44.13%), Query Frame = 3
Query:   72 FLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPF--DILKDSNETTGALFSCPVTKE---------TQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPK-----FLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYE--YRNCLTGAALKSLERKQLVLTAPYS--YEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIK-LSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFD-SLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSK-----RLYFE-NKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIH----FGVGCSPGSCQPILTMQAVLSLP 2015
            F  L+++ +L   YN+D+  P + +    N S FG+S+ +    +N+  + L+GAP        + ++ GA+++C +             Q C +   +E+ N+  LG  +   + +G +  C  +     +       K   G C+ F+        I     +   K   + +   Y +C  G +  S     +V+ AP +  + G  L++N       ++ S+ Y+   +      Y G+S++ G  F +P    IV G+P   Q++ T      G+  I ++  N+L+ V    G+  GS YG SV A+DLN DG+ +L+VGAP   +    G+V+VY N    Q   E K      E    L      +  ++G ++ N+GDI+ D   D+A+GAP E+D  GA+YIY G    I +  SQ+I G ++  + R +G S+ G   D+DSN YPD  VG+ LS   V  RTRP+++V A        M LP S + S+ +C  NGQ   CIK+ V                  K I   IEL          K     R YF  N  + VT G         +K   +   F+  F      +I  PI   +K+ L    V +R+L           P+L++ K+ L N I     F   CS  +C   L + A L LP
Sbjct:   17 FGILWYLLILCDCYNLDVEHPLVFNG--PNGSLFGYSVLLHQHNENT--WLLVGAPVANSSFYPNIKSPGAIYNCSMLNSQCEQLPVGGVQRCGRHCLAENDNQ-WLGVSLSRQASKGHVLACGHRWKNVFYSSKDNQNKLPHGVCFRFSPDLKHASHI-----IPCYKDHQRRFGEGYGSCQAGIS-NSFTEDLMVMGAPGTSYWTGSVLVVNTT-----SNISAAYVDDDSDVLYGSYLGYSVSAGH-FLDPQSTEIVGGAP---QHEQT------GKAYIFRIEGNTLKIVNKTKGKTLGSYYGASVCAVDLNADGLSDLLVGAPMFSSVREEGRVYVYIN----QGEAELK------EADFELVGSDSYA-ARFGETIINLGDIDDDGYPDVAIGAPQEDDLRGAIYIYNGRRSGIARSFSQRITGSLLGNNFRMFGQSVSG-GVDIDSNNYPDVAVGAFLSDSAVVFRTRPVVKVDAV-------MLLPESLNRSVAQCTENGQPAVCIKVRVCF------------RVRGKQIPGNIELKYNLTADVHHKEGFPSRFYFSGNGTSNVTAG------RVKAKHEQLTCVFHQAFMKKDVRDIFTPIHFEVKYELGEHRVVQRDLGDLPALK----PILQQ-KDELDNVIKNKTIFARYCSWENCSTNLQVSARLVLP 630          
BLAST of Alpha-int-3 vs. Ensembl Zebrafish
Match: itga6a (integrin, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-050309-23])

HSP 1 Score: 169.859 bits (429), Expect = 3.533e-42
Identity = 276/1150 (24.00%), Postives = 469/1150 (40.78%), Query Frame = 3
Query:   69 IFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKY-FLIGAP--FDILKDSNETTGALFSCPVTKETQDCKKFVFS-------EHSNESLLGYVVDSNSHEGLIYTCAPKFLR-----SHTYVKYVEGACWEFNEMFNEVEQISNQDC--LESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL--------------LINNNFY--SRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNN--NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTID---YEIELDMP----FIKTSSSKRLYFENKLNTVTGGGSINC-KTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNN--LTNTIHFGVGCSPGS-CQPILTMQAVLS-----------LPTEGEQYILHMGNVSKFKLEIQTKN-----------IATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQN-SVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGN-YKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
            + +F + V     ++N+D  +   KS      S FGFS+ +    Q   K   LIGAP    +       TG L+SC +T    DC +  F        E+     +G  V S    G I TCA ++ R     +    + + G C+  ++  + ++  S++D    +     ++ +E +  C  G AA  + +   ++  AP +Y  KG+              L ++  Y    EN    N +    +NS   Y GFS+  G          IV G+P  +   +     K G++      E+ LE      G    S +GY V  +DLN DG  ++VVGAP  F  +    G V+VY N    ++       P+          +    +  +G+S+ENIGD+N D  +D+AVGAP+ + G G+VYIY G +  I  K +Q +EG+  +  +  +G+S+ G N DLD N+YPD  VGS LS  V   R++ +I +  +  V       P   D  KK   N     C+ +     Y     T  P    S T +   Y  +L +P    F+  +   + Y       + G     C KT     + I +              ++PIE+++  ++  ++  KR      L      P+L+    N  LT       GC   + CQ  L +Q               LP E    ++ + +     LE+  +N           ++  DD+ ++  +  L  + K +   +N          G  +  +S +        TF  +L    I    + + I++ +E  S Q  L  +  K KV +   + ++ +  P    Y    + G S++  EE++G  +++   + N  +      ++ L I +P E S       G++LLYL++I     T   + + C+ +      N +K R    I    +LE+ +      P+   K+   +D+ K                  ++ C  G ARCV + C   PL        +    R+W  T +E+F  Y   Y+DI      +V   + L V   N   K P+    +VR+         P   +   + I++AV AG+++LA +V++L+KC FF+R
Sbjct:   12 LCVFSWLVWTSASAFNLDTQNVLRKSG--QPGSLFGFSIALHRQLQPHDKTILLIGAPKARALSNQGANVTGGLYSCDITTHPNDCSRVDFDNDVDVRVENKENQWMGVTVQSQGPGGKIVTCAHRYQRLLFPNTPQEARDITGRCYMLSQDLS-IDNQSDEDGGNWKFCDGRTRGHERFGACQQGLAATFTKDYHYVIFGAPGAYNWKGIVRIEQKNNTLLEMGLFDDGPYEVGDENRLDPNLVPV-PANS---YLGFSLDSGHSITEKGKLIIVSGAPRANHSGAVVFLRKEGELSSMLTPEHILE------GPGLASSFGYDVAVVDLNGDGWQDVVVGAPQFFQRDEEVGGAVYVYIN----KAGRWRDVTPV---------RLNGTKDSMFGLSVENIGDVNLDSFEDIAVGAPYADSGFGSVYIYHGSADGISTKPAQILEGKQHNTKM--FGYSLAG-NMDLDHNSYPDLAVGS-LSDTVFIYRSKNVISIKKDIKVT------PKEIDLTKKTCGNS---ICLTVEACFSYRANPTTYNPKITISCTFEAEWYRRKLGLPSRVVFLDKTEIDQDYQSTGTLELRGQNKKACYKTKLRLQDGIRDKLR-----------AIPIEVSV--AIQSAKRGKRQSSLPQLV-----PILDSTVPNKTLTEVNFLKEGCGTDNICQSNLNLQYRFCYRESKQDIFPPLPLENGVPVISLSDQKDIALEVTVRNRNGDDAHEAKLVSHFDDSLSYSGFRSLRTNDKHVICAANQNGSLADCELGNPFKRDSEV--------TFYIILSTGKISLETKEVEIDLQLETTSSQEGLSKVKAKAKVVIELLLSVQGVAKPSQV-YFGGEVKGMSAMKKEEEVGSLIEYEFRVINLGKPLKSFGTASLNIQWPKESSV------GKWLLYLMKIN----TRDLQLVTCSPE---REINPLKLREDSSIRKKRELEERR------PSEGNKISLFTDKRKH----------------KILSC-SGDARCVEIKC---PLQGLDSTAVIVLKSRLWNSTFLEDFASYN--YLDI------IVKASISLDVSAKNIVLKNPET---QVRLTVFPETTATPFGGVP-WWIILVAVLAGILMLALLVLLLWKCGFFKR 1044          
BLAST of Alpha-int-3 vs. Ensembl Xenopus
Match: ITGA3 (integrin subunit alpha 3 [Source:NCBI gene;Acc:100494331])

HSP 1 Score: 175.637 bits (444), Expect = 6.018e-44
Identity = 268/1102 (24.32%), Postives = 468/1102 (42.47%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDSNET--TGALFSCPVTKETQDCKKFVFSEHSNES-------LLGYVVDSNSHEGLIYTCAPKFL----------RSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNN----NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTN-TIHFGVGC-SPGSCQPILTMQ---AVLSLPTEGEQYILHM-GNVSKFKLEIQTKNI--ATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNAT--FECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQ-YREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTE-TDGQYLLYLLRIPKFSITTGNKKIACNV--DILNNIT-NVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
            ++N+D   P +K   +     FGFS+++    +   +Y L+ GAP D    S +   TGAL++CP+T  T DC +      S+          LG  V S   +G +  C  ++           R      Y+ G   E NE  ++ +   N+ C  +   ++       C  G +        +   AP +Y  +G   +N    R+ +     + +  +N+   Y G+++ V     + +  ++V  +P        R + K G V +  + +N +    V+ G+  GS +G ++   DLNNDG  ++VVGAP+  +      G V+VY N+    +           +K  ++      S   +G +L NIGDIN+D   DLAVGAPF  DG G VYIY  ++    +  SQ I+G  ++ ++  +G+S+ G   D+D N YPD +VGS L+  +  +R+RP+I +         D ++  +     KC++      CI + V   Y     T   +Y  + T+ Y +E D          R+ F+     V  G       P++K  ++     +L   N+   +  PI I++K+S+   E   R+ +        N+PVL   ++N     IHF   C S   C+  L MQ    V + P      ILH   +V+K  L +   N   AT+  + A    + +T    ++   S  P    +    +I  +  P    Q    T  FE +     I      +   + +  +S Q  L     K+ V     I     V P + Q Y   +++G S++   + +G  ++F+  + N  +    L++ L I F W     P E  +G++LLY   +    + TG +K AC+   D++N +  NV +T + +    I +  DV+                              ++    +  ++ C  G A CV   C   PL+      T+    R+W  T +E++     V++      +   +  +   VP  N K     V+  V +  + L++P PPA L  ++ II++V +G++LL  I+++L+K  FF R
Sbjct:   24 AFNLDTRFPVLKEAGVPG-GLFGFSVSLHRQSEGEQRYLLLSGAPQDAAAPSVKANRTGALYACPITSSTNDCFRVPIDPESDPQNNIIENMWLGVTVASQGPDGRVLVCGHRYTSVRWSGEEDQRRMIGKCYIRGNNLELNED-DDWQTYHNELCDPNSDFDATGM----CQMGIS-GGFTSNMVYFGAPGAYTWQG---SNFILQRDTAWDLKEIYYPTNNTFNIYMGYTVQVNSRVLHKDQVTVVSSAP--------RWESK-GAVFLLDVQKNIMVVKHVLNGQQVGSYFGSAIALADLNNDGWQDIVVGAPYYFDRKEEIGGAVYVYNNVAGFFN-----------DKAAMVLHGSSFSG--FGFALANIGDINQDGFTDLAVGAPF--DGLGKVYIYNSNADGPKQEPSQVIDGSQVA-NISTFGYSLSG-GLDVDDNAYPDLLVGS-LTDRIALLRSRPVINI-------SKDFKVTPTLVDPSKCSNTS----CIDVLVCFSYTLS--TGNAAYRKNITLQYTLEAD----HDRRPPRVKFQGASGAVYQG---LFSMPDTKCQNV----QLLLLDNIRDKLH-PISISLKYSILEREARGRSAVRSLD----NFPVLSEDQSNFQELEIHFQKECGSDNVCRSNLQMQYEYVVGNAPLVNGSQILHYDSSVNKVNLNVIVTNFPSATSPADDAHEAVLNITI-PPELFFSSVRPPLACTLKETIICELGFPFKRNQKAEITIVFEVV----GISLKTREVVAGLQLSTLSKQDDLHEEYAKLLVDYTLKISFS--VQPSHIQTYFSGNVMGESAMKTVQDVGSPVEFSFTVINYGEPLTSLAT-LFIAFNW-----PHEVANGKWLLYPTEV---LVNTGTEK-ACHPSGDVINPLNLNVSETLVKRRRRQIDETPDVRTL---------------------------AAVRRESSEAVLKCSGGGATCVHFSC---PLNDMQSRATISMRGRVWNSTFLEDYRNVDRVWV------MGGAELYLKTDVPTINMKS--QFVTFSVSI-DSELEEP-PPAELP-LWLIIVSVVSGIVLLGIIILLLWKIGFFHR 1001          
BLAST of Alpha-int-3 vs. Ensembl Xenopus
Match: ITGA3 (integrin subunit alpha 3 [Source:NCBI gene;Acc:100494331])

HSP 1 Score: 171.014 bits (432), Expect = 1.849e-42
Identity = 265/1104 (24.00%), Postives = 466/1104 (42.21%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDSNET--TGALFSCPVTKETQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVK----------------YVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNN----NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNN---LTNTIHFGVGC-SPGSCQPILTMQ---AVLSLP---TEGEQYILHMGNVSKFKLEIQTKNI--ATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQ-YREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTE-TDGQYLLYLLRIPKFSITTGNKKIACNV--DILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQN 3299
            ++N+D   P +K   +     FGFS+++    +   +Y L+ GAP D    S +   TGAL++CP+T  T DC +      S           + H  L + C P  +  H Y                  Y+ G   E NE  ++ +   N+ C  +   ++       C  G +        +   AP +Y  +G   +N    R+ +     + +  +N+   Y G+++ V     + +  ++V  +P   +++S       G V +  + +N +    V+ G+  GS +G ++   DLNNDG  ++VVGAP+  +      G V+VY N+    +           +K  ++      S   +G +L NIGDIN+D   DLAVGAPF  DG G VYIY  ++    +  SQ I+G  ++ ++  +G+S+ G   D+D N YPD +VGS L+  +  +R+RP+I +         D ++  +     KC++      CI + V   Y     T   +Y  + T+ Y +E D          R+ F+     V  G       P++K  ++     +L   N+   +  PI I++K+S+   E   R+     +  L N+PVL   ++N   L  +IHF   C S   C+  L MQ    V + P     G Q + +  +V+K  L +   N   AT+  + A    + +T   +   LF ++    ++TS   I  V             FE +     I      +   + +  +S Q  L     K+ V     I     V P + Q Y   +++G S++   + +G  ++F+  + N  +    L++ L I F W     P E  +G++LLY   +    + TG +K AC+   D++N +            + +S L  + +++               +I   P      ++    +  ++ C  G A CV   C   PL+      T+    R+W  T    FL+ K +   + +    L  + V +                      + L++P PPA L  ++ II++V +G++LL  I+++L+KC FFRR N
Sbjct:   21 AFNLDTRFPVLKEAGVPG-GLFGFSVSLHRQSEGEQRYLLLSGAPQDAAAPSVKANRTGALYACPITSSTNDCFRVPIDPESK--------CKDPHGTLQFLCHPCQVCGHRYTSVRWSGEEDQRRMIGKCYIRGNNLELNED-DDWQTYHNELCDPNSDFDATGM----CQMGIS-GGFTSNMVYFGAPGAYTWQG---SNFILQRDTAWDLKEIYYPTNNTFNIYMGYTVQVNSRVLHKDQVTVVSSAP---RWESK------GAVFLLDVQKNIMVVKHVLNGQQVGSYFGSAIALADLNNDGWQDIVVGAPYYFDRKEEIGGAVYVYNNVAGFFN-----------DKAAMVLHGSSFSG--FGFALANIGDINQDGFTDLAVGAPF--DGLGKVYIYNSNADGPKQEPSQVIDGSQVA-NISTFGYSLSG-GLDVDDNAYPDLLVGS-LTDRIALLRSRPVINI-------SKDFKVTPTLVDPSKCSNTS----CIDVLVCFSYTLS--TGNAAYRKNITLQYTLEAD----HDRRPPRVKFQGASGAVYQG---LFSMPDTKCQNV----QLLLLDNIRDKLH-PISISLKYSILEREARGRS----AVRSLDNFPVLSEDQSNFQELEVSIHFQKECGSDNVCRSNLQMQYEYVVGNAPLSKVNGSQILHYDSSVNKVNLNVIVTNFPSATSPADDAHEAVLNITIPPE---LFFSSVRPVSATSPAEITIV-------------FEVV----GISLKTREVVAGLQLSTLSKQDDLHEEYAKLLVDYTLKISFS--VQPSHIQTYFSGNVMGESAMKTVQDVGSPVEFSFTVINYGEPLTSLAT-LFIAFNW-----PHEVANGKWLLYPTEV---LVNTGTEK-ACHPSGDVINPLN-----------LNVSVLFSIFIQR-------------RRQIDETPDVRTLAAVRRESSEAVLKCSGGGATCVHFSC---PLNDMQSRATISMRGRVWNST----FLEVKKILNPVTIQPAALAIFSVSID---------------------SELEEP-PPAELP-LWLIIVSVVSGIVLLGIIILLLWKCGFFRRAN 964          
BLAST of Alpha-int-3 vs. Ensembl Xenopus
Match: ITGA4 (integrin subunit alpha 4 [Source:NCBI gene;Acc:100487924])

HSP 1 Score: 169.474 bits (428), Expect = 3.934e-42
Identity = 190/710 (26.76%), Postives = 310/710 (43.66%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETT-GALFSCPVTKE--------------TQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYV---KYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNY--EYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKN----EDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLK-KCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYF--ENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVK---NNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYI-LHMGNVSKFKLEIQTKNIATTDDNKAFRTYIIL 2135
            SYNID +SP +     +  S FGFS+ + ++   +  + ++GAP       N T  GA+  C + +                  C K    E  N+ L   +   ++ +G I  C  ++   H  +   K   G C+     F    ++S + C    K   + +   Y +C  G +   +E   +V+ AP S+   G +   N  + EN+  S Y+   N+     Y G+S+  G  FR PN   ++ G+P          Q + G+  I    E  L  +    G+  GS +G +V A+DLN DG+ +L+VGAP   T    G+VFVY N                +E+     S   L   ++G ++ N+GDI+ D  +D+A+ AP E D  GAVYIY G    I    SQ+++G        GYG  +FG++     D+D N Y D  +G+ LS   V +RTRP+I       V +  ++LP + +  + +C  NG   P + ++V+I + Y  L   P Y     + Y I  D+   K+ +  R YF      + ++G  +I+ K+ N K++         F      +I  PI +   + L    V KR+            PVL++ +   N +TN +HF   C+  +C   L +   LS P   E  + L +G +    + I   N      + AF+T + L
Sbjct:   32 SYNIDESSPVVFKG--SQGSLFGFSVVLHSNGDGN--WIVVGAPQSSWTTKNVTNPGAILKCRIEQNPNGSCDVLELGNLNGAKCGKTCKEEQDNQWLGVSLSRQSTKDGQILACGHRWKNIHFMLSDHKLPYGVCYGIPANFRT--ELSKRIC-PCYKDHVRKFGDSYGSCQAGISTFYVE-DVIVMGAPGSFYWTGSIFVYN--TTENTIKS-YVDLNNAVKFGSYLGYSVGAGH-FRTPNSYEVIGGAP---------QQEQTGKAYIFTYEEKQLVILFEAGGKKLGSYFGAAVCAVDLNGDGLSDLLVGAPMQSTIREEGRVFVYMNTGGGA-----------MEELQFELSGSDLYAARFGDTIANLGDIDNDGFEDVAIAAPQEGDLEGAVYIYNGREKGITPSFSQRLQGSKF-----GYGLRMFGQSISNVLDIDGNGYNDVAIGAFLSDSAVLLRTRPVI-------VIDASLKLPMTVNKTRFECMENG--APAVCMNVTICFAYKGLDV-PGYI---VMYYNITSDVR-RKSGTPARFYFVSNGTSDVMSGTMNIHQKSGNCKTHKA-------FMRKDTRDIFTPIHMESSYYLGKHIVSKRSADDLQPLQ----PVLQQKEGKGNVITNKVHFARHCTLLNCSADLQITGKLSFPKPFESKLYLAVGGMKSLMINITLFN----GGDDAFQTVLQL 675          
BLAST of Alpha-int-3 vs. Ensembl Xenopus
Match: ITGA4 (integrin subunit alpha 4 [Source:NCBI gene;Acc:100487924])

HSP 1 Score: 169.859 bits (429), Expect = 4.115e-42
Identity = 193/710 (27.18%), Postives = 312/710 (43.94%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETT-GALFSCPVTKE--------------TQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYV---KYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNY--EYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKN----EDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLK-KCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYF--ENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVK---NNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYI-LHMGNVSKFKLEIQTKNIATTDDNKAFRTYIIL 2135
            SYNID +SP +     +  S FGFS+ + ++   +  + ++GAP       N T  GA+  C + +                  C K    E  N+ L   +   ++ +G I  C  ++   H  +   K   G C+     F    ++S + C    K   + +   Y +C  G +   +E   +V+ AP S+   G +   N  + EN+  S Y+   N+     Y G+S+  G  FR PN   ++ G+P          Q + G+  I    E  L  +    G+  GS +G +V A+DLN DG+ +L+VGAP   T    G+VFVY N           T    +E+     S   L   ++G ++ N+GDI+ D  +D+A+ AP E D  GAVYIY G    I    SQ+++G        GYG  +FG++     D+D N Y D  +G+ LS   V +RTRP+I       V +  ++LP + +  + +C  NG   P + ++V+I + Y  L   P Y     + Y I  D+   K+ +  R YF      + ++G  +I+ K+ N K++         F      +I  PI +   + L    V KR+            PVL++ +   N +TN +HF   C+  +C   L +   LS P   E  + L +G +    + I   N    DD  AF+T + L
Sbjct:   32 SYNIDESSPVVFKG--SQGSLFGFSVVLHSNGDGN--WIVVGAPQSSWTTKNVTNPGAILKCRIEQNPNGSCDVLELGNLNGAKCGKTCKEEQDNQWLGVSLSRQSTKDGQILACGHRWKNIHFMLSDHKLPYGVCYGIPANFRT--ELSKRIC-PCYKDHVRKFGDSYGSCQAGISTFYVE-DVIVMGAPGSFYWTGSIFVYN--TTENTIKS-YVDLNNAVKFGSYLGYSVGAGH-FRTPNSYEVIGGAP---------QQEQTGKAYIFTYEEKQLVILFEAGGKKLGSYFGAAVCAVDLNGDGLSDLLVGAPMQSTIREEGRVFVYMN-----------TGGGAMEELQFELSGSDLYAARFGDTIANLGDIDNDGFEDVAIAAPQEGDLEGAVYIYNGREKGITPSFSQRLQGSKF-----GYGLRMFGQSISNVLDIDGNGYNDVAIGAFLSDSAVLLRTRPVI-------VIDASLKLPMTVNKTRFECMENG--APAVCMNVTICFAYKGLDV-PGYI---VMYYNITSDVR-RKSGTPARFYFVSNGTSDVMSGTMNIHQKSGNCKTHKA-------FMRKDTRDIFTPIHMESSYYLGKHIVSKRSADDLQPLQ----PVLQQKEGKGNVITNKVHFARHCTLLNCSADLQITGKLSFPKPFESKLYLAVGGMKSLMINITLFN--GGDD--AFQTVLQL 675          
BLAST of Alpha-int-3 vs. Ensembl Xenopus
Match: ITGA4 (integrin subunit alpha 4 [Source:NCBI gene;Acc:100487924])

HSP 1 Score: 169.474 bits (428), Expect = 4.202e-42
Identity = 193/710 (27.18%), Postives = 312/710 (43.94%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETT-GALFSCPVTKE--------------TQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYV---KYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNY--EYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKN----EDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLK-KCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYF--ENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVK---NNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYI-LHMGNVSKFKLEIQTKNIATTDDNKAFRTYIIL 2135
            SYNID +SP +     +  S FGFS+ + ++   +  + ++GAP       N T  GA+  C + +                  C K    E  N+ L   +   ++ +G I  C  ++   H  +   K   G C+     F    ++S + C    K   + +   Y +C  G +   +E   +V+ AP S+   G +   N  + EN+  S Y+   N+     Y G+S+  G  FR PN   ++ G+P          Q + G+  I    E  L  +    G+  GS +G +V A+DLN DG+ +L+VGAP   T    G+VFVY N           T    +E+     S   L   ++G ++ N+GDI+ D  +D+A+ AP E D  GAVYIY G    I    SQ+++G        GYG  +FG++     D+D N Y D  +G+ LS   V +RTRP+I       V +  ++LP + +  + +C  NG   P + ++V+I + Y  L   P Y     + Y I  D+   K+ +  R YF      + ++G  +I+ K+ N K++         F      +I  PI +   + L    V KR+            PVL++ +   N +TN +HF   C+  +C   L +   LS P   E  + L +G +    + I   N    DD  AF+T + L
Sbjct:   32 SYNIDESSPVVFKG--SQGSLFGFSVVLHSNGDGN--WIVVGAPQSSWTTKNVTNPGAILKCRIEQNPNGSCDVLELGNLNGAKCGKTCKEEQDNQWLGVSLSRQSTKDGQILACGHRWKNIHFMLSDHKLPYGVCYGIPANFRT--ELSKRIC-PCYKDHVRKFGDSYGSCQAGISTFYVE-DVIVMGAPGSFYWTGSIFVYN--TTENTIKS-YVDLNNAVKFGSYLGYSVGAGH-FRTPNSYEVIGGAP---------QQEQTGKAYIFTYEEKQLVILFEAGGKKLGSYFGAAVCAVDLNGDGLSDLLVGAPMQSTIREEGRVFVYMN-----------TGGGAMEELQFELSGSDLYAARFGDTIANLGDIDNDGFEDVAIAAPQEGDLEGAVYIYNGREKGITPSFSQRLQGSKF-----GYGLRMFGQSISNVLDIDGNGYNDVAIGAFLSDSAVLLRTRPVI-------VIDASLKLPMTVNKTRFECMENG--APAVCMNVTICFAYKGLDV-PGYI---VMYYNITSDVR-RKSGTPARFYFVSNGTSDVMSGTMNIHQKSGNCKTHKA-------FMRKDTRDIFTPIHMESSYYLGKHIVSKRSADDLQPLQ----PVLQQKEGKGNVITNKVHFARHCTLLNCSADLQITGKLSFPKPFESKLYLAVGGMKSLMINITLFN--GGDD--AFQTVLQL 675          
BLAST of Alpha-int-3 vs. Ensembl Mouse
Match: Itga3 (integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602])

HSP 1 Score: 208.379 bits (529), Expect = 2.631e-54
Identity = 252/1041 (24.21%), Postives = 435/1041 (41.79%), Query Frame = 3
Query:  105 FSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDIL--KDSNETTGALFSCPVTKETQDCKKFVFSEHSN-------ESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVE------QISNQDCLESIKSE--SQNYEYRN---CLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQ-YTGFSMAVGKIFRNP-NVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIE-------LDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSPGS-CQPILTMQAV-LSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYIN----------------ISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYID 3050
            F++N+D     +K   +N  S FG+S+ +    +   +Y L+ GAP D+    D    TGA++ CP+T    DC++   SE S+       +  LG  V S    G +  CA      H Y K +     +   M  +        Q+   D  ++  +E  + N +Y     C  G +     +  +   AP +Y  KG   N+    R++   S Y  +R S  +   Y G+++ VG    +P ++ ++V G+P        R Q      ++ +     L+   V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G V+V+    M+Q+       P      LLL      S   +GIS+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+ I G+ +  P L  +G+S+ GK  D+D N YPD +VGS LS H+V +R RP+I +    +VA      P   D    C +      C++  V + + Y      P+Y  + T+ Y +E         + F ++ SS    F +   T       +C+T   +   + N  + L P+ +  N SLP+ +  +  L +  +               YPVL + +    +T +HF   C P + C   L M+A  LS   +    + +  +  K  L I   N  ++          +LT +                  S L+ +   P    Q++N T  C L N F  N +  + I                 + +   S Q +L+P++L ++V       L L+    N++ +     +++G +++   E +G  +K+   +         L + +L + +P+E+      T+G++LLY   I   S    N    C      N+ N +   +      ++ L   + ++   P      P ++             +  + ++  ++ C  G ARCV + C   PL   S    +    R+W  T IE++  +  V +D
Sbjct:   31 FAFNLDTRFLVVKEA-VNPGSLFGYSVALHRQTERQQRYLLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIEDMWLGVTVASQGPAGRVLVCA------HRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTYHNEMCNSNTDYLQTGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKDWDLSEY-SYRGSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAP--------RHQHMGAVFLLKQESGGDLQRKQVLKGTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVF----MNQAGASFPDQP-----SLLLHGP---SRSAFGISIASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSGGLLRQPQQIIHGEKLGLPGLATFGYSLSGK-MDVDENLYPDLLVGS-LSDHIVLLRARPVINILHRTLVAR-----PAVLDP-ALCTATS----CVQ--VELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVFHGFFSMPET-------HCQT--LELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGLRSLDA-------------YPVLNQAQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLQPLSRLQYSRDTKKLFLSINVTNSPSSQRAGEDAHEALLTLE----------------VPSALLLSSVRPSGTCQANNETILCELGNPFKRNQRMELLIAFEVIGVTLHTRDLPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLM----NHRLQSFFGGTVMGEAAMKTAEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEV------TNGKWLLYPTEITIHS----NGSWPCQPS--GNLVNPLNLTLSDP--GVTPLSPQRRRRQLDPGGDQSSPPVT-----------LAAAKKAKSETVLTCSNGRARCVWLEC---PLPDTSNITNVTVKARVWNSTFIEDYKDFDRVRVD 953          
BLAST of Alpha-int-3 vs. Ensembl Mouse
Match: Itga3 (integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602])

HSP 1 Score: 207.994 bits (528), Expect = 3.713e-54
Identity = 252/1041 (24.21%), Postives = 435/1041 (41.79%), Query Frame = 3
Query:  105 FSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDIL--KDSNETTGALFSCPVTKETQDCKKFVFSEHSN-------ESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVE------QISNQDCLESIKSE--SQNYEYRN---CLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQ-YTGFSMAVGKIFRNP-NVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIE-------LDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSPGS-CQPILTMQAV-LSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYIN----------------ISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYID 3050
            F++N+D     +K   +N  S FG+S+ +    +   +Y L+ GAP D+    D    TGA++ CP+T    DC++   SE S+       +  LG  V S    G +  CA      H Y K +     +   M  +        Q+   D  ++  +E  + N +Y     C  G +     +  +   AP +Y  KG   N+    R++   S Y  +R S  +   Y G+++ VG    +P ++ ++V G+P        R Q      ++ +     L+   V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G V+V+    M+Q+       P      LLL      S   +GIS+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+ I G+ +  P L  +G+S+ GK  D+D N YPD +VGS LS H+V +R RP+I +    +VA      P   D    C +      C++  V + + Y      P+Y  + T+ Y +E         + F ++ SS    F +   T       +C+T   +   + N  + L P+ +  N SLP+ +  +  L +  +               YPVL + +    +T +HF   C P + C   L M+A  LS   +    + +  +  K  L I   N  ++          +LT +                  S L+ +   P    Q++N T  C L N F  N +  + I                 + +   S Q +L+P++L ++V       L L+    N++ +     +++G +++   E +G  +K+   +         L + +L + +P+E+      T+G++LLY   I   S    N    C      N+ N +   +      ++ L   + ++   P      P ++             +  + ++  ++ C  G ARCV + C   PL   S    +    R+W  T IE++  +  V +D
Sbjct:   31 FAFNLDTRFLVVKEA-VNPGSLFGYSVALHRQTERQQRYLLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIEDMWLGVTVASQGPAGRVLVCA------HRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTYHNEMCNSNTDYLQTGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKDWDLSEY-SYRGSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAP--------RHQHMGAVFLLKQESGGDLQRKQVLKGTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVF----MNQAGASFPDQP-----SLLLHGP---SRSAFGISIASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSGGLLRQPQQIIHGEKLGLPGLATFGYSLSGK-MDVDENLYPDLLVGS-LSDHIVLLRARPVINILHRTLVAR-----PAVLDP-ALCTATS----CVQ--VELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVFHGFFSMPET-------HCQT--LELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGLRSLDA-------------YPVLNQAQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLQPLSRLQYSRDTKKLFLSINVTNSPSSQRAGEDAHEALLTLE----------------VPSALLLSSVRPSGTCQANNETILCELGNPFKRNQRMELLIAFEVIGVTLHTRDLPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLM----NHRLQSFFGGTVMGEAAMKTAEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEV------TNGKWLLYPTEITIHS----NGSWPCQPS--GNLVNPLNLTLSDP--GVTPLSPQRRRRQLDPGGDQSSPPVT-----------LAAAKKAKSETVLTCSNGRARCVWLEC---PLPDTSNITNVTVKARVWNSTFIEDYKDFDRVRVD 953          
BLAST of Alpha-int-3 vs. Ensembl Mouse
Match: Itga3 (integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602])

HSP 1 Score: 194.126 bits (492), Expect = 7.821e-50
Identity = 243/1005 (24.18%), Postives = 415/1005 (41.29%), Query Frame = 3
Query:  210 SIKYFLIGAPFDIL--KDSNETTGALFSCPVTKETQDCKKFVFSEHSN-------ESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVE------QISNQDCLESIKSE--SQNYEYRN---CLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQ-YTGFSMAVGKIFRNP-NVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIEL-------DMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSPGS-CQPILTMQAV-LSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYIN----------------ISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYID 3050
            S    L GAP D+    D    TGA++ CP+T    DC++   SE S+       +  LG  V S    G +  CA      H Y K +     +   M  +        Q+   D  ++  +E  + N +Y     C  G +     +  +   AP +Y  KG   N+    R++   S Y  +R S  +   Y G+++ VG    +P ++ ++V G+P        R Q      ++ +     L+   V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G V+V+    M+Q+       P      LLL      S   +GIS+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+ I G+ +  P L  +G+S+ GK  D+D N YPD +VGS LS H+V +R RP+I +    +VA      P   D    C +      C++  V + + Y      P+Y  + T+ Y +E         + F ++ SS    F +   T       +C+T   +   + N  + L P+ +  N SLP+ +  +  L +  +               YPVL + +    +T +HF   C P + C   L M+A  LS   +    + +  +  K  L I   N  ++          +LT +                  S L+ +   P    Q++N T  C L N F  N +  + I                 + +   S Q +L+P++L ++V       L L+    N++ +     +++G +++   E +G  +K+   +         L + +L + +P+E+      T+G++LLY   I   S    N    C      N+ N +   +      ++ L   + ++   P      P ++             +  + ++  ++ C  G ARCV + C   PL   S    +    R+W  T IE++  +  V +D
Sbjct:   35 SFSSLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIEDMWLGVTVASQGPAGRVLVCA------HRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTYHNEMCNSNTDYLQTGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKDWDLSEY-SYRGSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAP--------RHQHMGAVFLLKQESGGDLQRKQVLKGTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVF----MNQAGASFPDQP-----SLLLHGP---SRSAFGISIASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSGGLLRQPQQIIHGEKLGLPGLATFGYSLSGK-MDVDENLYPDLLVGS-LSDHIVLLRARPVINILHRTLVAR-----PAVLDP-ALCTATS----CVQ--VELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVFHGFFSMPET-------HCQT--LELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGLRSLDA-------------YPVLNQAQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLQPLSRLQYSRDTKKLFLSINVTNSPSSQRAGEDAHEALLTLEVP----------------SALLLSSVRPSGTCQANNETILCELGNPFKRNQRMELLIAFEVIGVTLHTRDLPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLM----NHRLQSFFGGTVMGEAAMKTAEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEV------TNGKWLLYPTEITIHS----NGSWPCQPS--GNLVNPLNLTLSDP--GVTPLSPQRRRRQLDPGGDQSSPPVT-----------LAAAKKAKSETVLTCSNGRARCVWLEC---PLPDTSNITNVTVKARVWNSTFIEDYKDFDRVRVD 922          
BLAST of Alpha-int-3 vs. Ensembl Mouse
Match: Itga4 (integrin alpha 4 [Source:MGI Symbol;Acc:MGI:96603])

HSP 1 Score: 169.859 bits (429), Expect = 2.873e-42
Identity = 193/703 (27.45%), Postives = 306/703 (43.53%), Query Frame = 3
Query:   69 IFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFD--ILKDSNETTGALFSCPVTK--------------ETQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPK-----FLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQL-VLTAPYSYEGKGLL----INNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLK-KCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNN--LTNTIHFGVGCSPGSCQPILTMQAVLSL--PTEGEQYILHMGNVSKFKLEI 2075
            + L  F VP  + SYN+D  +  +      + + FG+S+ + +    S ++ ++GAP    +   S    GA++ C + K                + C K    E  N+ L   +       G I TC  +     +++S    K   G C+    M +++    ++      K  ++ +        A + S   + L V+ AP S    G +    I  N Y     R  N +KF +      Y G+S+  G  FR+P+   +V G+P   Q          G+  I  + EN L  V  + G+  GS +G SV A+DLN DG  +L+VGAP   T    G+VFVY N  M    +E +        R+L+ S K  +  ++G S+ N+GDI+ D  +D+A+GAP E+D  GAVYIY G    I    SQ+IEGQ IS  LR +G SI G+  D D+N Y D  VG+  S   V +RTRP++       + E  +  P S +  K  C  NG    C+ L++   Y   ++   P Y     + Y + LD+     S S+  +F N  + V   GSI   +   K  +     +  F      +I  PI +   + L    + KRN            P+L++ K    +   I+F   C+  +C   L + A +    P E + Y L +G++    L +
Sbjct:   21 MLLLYFGVPTGH-SYNLDPENALLYQG--PSGTLFGYSVVLHS--HGSKRWLIVGAPTASWLSNASVVNPGAIYRCGIRKNPNQTCEQLQLGSPSGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYMKSDN--KLPTGICYV---MPSDLRTELSKRMAPCYKDYTRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGTVFVYNITTNQYKAFVDRQ-NQVKFGS------YLGYSVGAGH-FRSPHTTEVVGGAPQHEQ---------IGKAYIFSIDENELNIVYEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGMGAVMVEME--------RVLVGSDKYAA--RFGESIANLGDIDNDGFEDIAIGAPQEDDLRGAVYIYNGRVDGISSTYSQRIEGQQISKSLRMFGQSISGQI-DADNNGYVDVAVGAFQSDSAVLLRTRPVV-------IVEASLSHPESVNRTKFDCTENGLPSVCMHLTLCFSYKGKEV---PGYI---VLFYNVSLDVHRKAESPSRFYFFSNGTSDVI-TGSIRVSSSGEKCRT-----HQAFMRKDVRDILTPIHVEATYHLGHHVITKRNTEEFPPLQ----PILQQKKEKDVIRKMINFARFCAYENCSADLQVSAKVGFLKPYENKTY-LAVGSMKTIMLNV 661          
BLAST of Alpha-int-3 vs. Ensembl Mouse
Match: Itga6 (integrin alpha 6 [Source:MGI Symbol;Acc:MGI:96605])

HSP 1 Score: 169.859 bits (429), Expect = 3.431e-42
Identity = 290/1148 (25.26%), Postives = 476/1148 (41.46%), Query Frame = 3
Query:   66 FIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ-NSIKYFLIGAPFD---ILKDSNETTGALFSCPVTKETQDCKKFVF-------SEHSNESLLGYVVDSNSHEGLIYTCAPKF-LRSHTYVKY----VEGACWEFNEMFNEVEQISNQD---CLESIKSESQNYEYRNCLTG-AALKSLERKQLVLTAPYSYEGKGLLI----NNNFYSRENSRSSNYLKFRNSNSKYQ--------YTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIF-GEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQV----FVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPS-YASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHF-GVGCSPGS-CQPILTMQAVLSLPTEGEQ----YILHMGNVSKFKLEIQTK---NIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAV-NSPLNARQSDNAT-FECMLPNDFIENVKESIY----------------INISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKF---TIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLP--NISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
             ++L    +  L  ++N+D     +     +  S FGFSL +    Q    +  L+GAP      L+ +N T G L+SC +T     C +  F       SE   +  +G  V S    G + TCA ++  R H   K     + G C+  ++     + +   D   C   ++   +   + +C  G AA  + +   +V  AP +Y  KG++     NN F+         Y     ++            Y GFS+  GK   + +  + V G+P        R       V++ + ++++      IF GE   S +GY V  +DLN DG  ++V+GAP   + +G+V    +VY N +   SN+  K I L+  K           +  +GIS++NIGDIN+D   D+AVGAP+  D  G V+IY G    II K +Q +EG   SP    +G+SI G N DLD N+YPD  VGS LS  V   R+RP+I +     V       P   D  +K         C+K+     Y     T  PS Y    +I   +E +    K+  S R+ F N+ +       +   T N +         +    N+   +  PI IT   S+ + E   R  ++         P+L   +     T +HF   GC   + C   L ++       EG Q    Y+     + +  L+ Q      I  T+     R       DA +  L +  PD  T ++   + A     L+   + N +  +C L N F  N   + Y                IN+ +E  S Q +L PI  K KV +   + +  +  P    Y   +++G  ++  E+++G  +++    I L   ++N  + ++ L I +P EIS      +G++LLYL+++     + G ++I C                     P +++  ++LK+        +LP   I D  KF        S+        ++C   + RCV + C   PL     + +L    R+W  T +E +   K  Y+DI      L+   + +     N  KLP     +VRV      K     S    + I++AV AG+++LA +V +L+KC FF+R
Sbjct:    9 LLYLSAGLLARLGTAFNLDTREDNVIRKSGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRT-GGLYSCDITSRGP-CTRIEFDNDADPMSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEK---FGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAP--------RANHSGAVVLLKRDMKSAHLLPEYIFDGEGLASSFGYDVAVVDLNADGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGKWSNV--KPIRLNGTK-----------DSMFGISVKNIGDINQDGYPDIAVGAPY--DDLGKVFIYHGSPTGIITKPTQVLEG--TSP---YFGYSIAG-NMDLDRNSYPDLAVGS-LSDSVTIFRSRPVINILKTITVT------PNRIDLRQKSMCGSPSGICLKVKACFEY-----TAKPSGYNPPISILGILEAEKERRKSGLSSRVQFRNQGSEPKYTQEL---TLNRQKQRACMEETLWLQENIRDKLR-PIPITA--SVEIQEPSSRRRVNSLPEV---LPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGT-REGNQDKFSYLPIQKGIPELVLKDQKDIALEITVTNSPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQV-YFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLKN--LGTATLNIQWPKEIS------NGKWLLYLMKVE----SKGLEQIVCE--------------------PHNEINYLKLKESHNSRKKRELPEKQIDDSRKF--------SLFPERKYQTLNC-SVNVRCVNIRC---PLRGLDSKASLVLRSRLWNSTFLEEY--SKLNYLDI------LLRASIDVTAAAQNI-KLPH-AGTQVRVTVFP-SKTVAQYSGVAWWIILLAVLAGILMLALLVFLLWKCGFFKR 1044          
BLAST of Alpha-int-3 vs. UniProt/SwissProt
Match: sp|P17852|ITA3_CRIGR (Integrin alpha-3 OS=Cricetulus griseus OX=10029 GN=ITGA3 PE=1 SV=3)

HSP 1 Score: 212.231 bits (539), Expect = 1.225e-54
Identity = 278/1137 (24.45%), Postives = 477/1137 (41.95%), Query Frame = 3
Query:   33 PNDLKFMEFINFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDSNET--TGALFSCPVTKETQDCKKFVFSEHSN-------ESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVE------QISNQDCLESIKSE--SQNYEYRN---CLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKI-EGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKT----SSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSPGS-CQPILTMQAV-LSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSN-NPDRKTSTSSGLIYAVNSPL--NARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGS-------ISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLP-----DIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
            P D  +M  +  + L +       F++N+D     +K   +N  S FG+S+ +    +   +Y L+ GAP D+      T  TGA++ CP+T    DC++   SE S+       +  LG  V S    G +  CA      H Y + +     +   M  +        Q+   D  ++  +E  + N +Y     C  G +     +  +   AP +Y  KG   N+    R++   S Y    + +    Y G+++ VG    +P   ++V G+P        R Q      ++ +     L+   V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G V+V+    M+Q+       P      LLL      S   +GIS+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+I  G  +  P L  +G+S+ GK  D+D N+YPD +VGS LS H+V +R RP+I +    +VA      P   D    C       P   + V + + Y      PSY  + T+ Y +E D          + S+   F   L+        +C+T   +   + N  + L P+ +  N SLP+ +  +  L +  +               YPVL + +    +T +HF   C P + C   L M+A  +S   +    + +  +  K  L I   N  + +         +LT +     L S+  P      +  ++  + +P   N R      FE +       ++K  + ++ S    S Q +L+P+ L ++V       L L+ T     +   +++G + +   E +G  +K+   +         L + +L + +P+E+      T+G++LLY    P   I   N+   C      N+ N           P++ +       ++ P + P  P      + L    D GS         + ++  ++ C  G ARCV + C   P+   S    +    R+W  T IE++  +  V +D    W  L    +   +P  N +        DI S  V  + A ++          ++ +++AVSAG++LL  I+I+L+KC FF+R
Sbjct:    9 PGDPGWM--LGALALMVAASGRFAFAFNLDTRFLVVKEA-VNPGSLFGYSVALHRQTERQQRYLLLAGAPRDLSVADGYTNRTGAVYLCPLTALKDDCERMDISEKSDPDHHIIEDMWLGVTVASQGPAGRVLVCA------HRYTQVLWSGMEDQRRMVGKCYVRGNDLQLDPGDDWQTYHNEMCNSNTDYLQTGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKDWDLSEYSYKGSEDQGNLYIGYTVQVGSAVLHPTYITVVAGAP--------RHQHMGAVFLLSQESGGDLKRKQVLEGTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVF----MNQAGTSFPDQP-----SLLLHGP---SRSAFGISIASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSGGLLRQPQQIVHGDKLGLPGLSTFGYSLSGKM-DVDDNSYPDLLVGS-LSDHIVLLRARPVINILQRTLVAR-----PAVLDP-SLCT------PTSCVQVELCFAYNQSAGNPSYRRNITLAYTLEADRDRRPPRLRFARSQSAVFHGFLSMP----ETHCQT--LELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGMRSL-------------DAYPVLNQAQALENHTEVHFQKECGPDNKCDSNLQMRAAFVSEQLQPLSRLQYSRDTKKLFLSINVTNTPSRERAGEDAHEALLTLEVPPALLLSSVRPSGTCQANETILCELGNPFKRNQRMELLIAFEVIGVTLHTRDLKAQLQLSTS----SHQDNLQPMTLILQVDYTLQASLSLM-THRLQSFFGGTVMGEAGMKTVEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEV------TNGKWLLY----PTEIIIHSNESWPCQPP--GNLVN-----------PLNLI-------LSDPGDKPHSPQ--RRRRQLDPGGDQGSPPVTLAAAKKAKSETVLTCASGRARCVWLEC---PIPDTSNVTNVTVKARVWNSTFIEDYRDFDRVRVD---GWATLF---LRTSIPTINMENKTTWFSVDIDSELVEELPAEIE----------LWLVLVAVSAGLLLLGLIIILLWKCGFFKR 1021          
BLAST of Alpha-int-3 vs. UniProt/SwissProt
Match: sp|Q62470|ITA3_MOUSE (Integrin alpha-3 OS=Mus musculus OX=10090 GN=Itga3 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.597e-53
Identity = 252/1041 (24.21%), Postives = 435/1041 (41.79%), Query Frame = 3
Query:  105 FSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDIL--KDSNETTGALFSCPVTKETQDCKKFVFSEHSN-------ESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVE------QISNQDCLESIKSE--SQNYEYRN---CLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQ-YTGFSMAVGKIFRNP-NVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIE-------LDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSPGS-CQPILTMQAV-LSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYIN----------------ISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYID 3050
            F++N+D     +K   +N  S FG+S+ +    +   +Y L+ GAP D+    D    TGA++ CP+T    DC++   SE S+       +  LG  V S    G +  CA      H Y K +     +   M  +        Q+   D  ++  +E  + N +Y     C  G +     +  +   AP +Y  KG   N+    R++   S Y  +R S  +   Y G+++ VG    +P ++ ++V G+P        R Q      ++ +     L+   V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G V+V+    M+Q+       P      LLL      S   +GIS+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+ I G+ +  P L  +G+S+ GK  D+D N YPD +VGS LS H+V +R RP+I +    +VA      P   D    C +      C++  V + + Y      P+Y  + T+ Y +E         + F ++ SS    F +   T       +C+T   +   + N  + L P+ +  N SLP+ +  +  L +  +               YPVL + +    +T +HF   C P + C   L M+A  LS   +    + +  +  K  L I   N  ++          +LT +                  S L+ +   P    Q++N T  C L N F  N +  + I                 + +   S Q +L+P++L ++V       L L+    N++ +     +++G +++   E +G  +K+   +         L + +L + +P+E+      T+G++LLY   I   S    N    C      N+ N +   +      ++ L   + ++   P      P ++             +  + ++  ++ C  G ARCV + C   PL   S    +    R+W  T IE++  +  V +D
Sbjct:   31 FAFNLDTRFLVVKEA-VNPGSLFGYSVALHRQTERQQRYLLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIEDMWLGVTVASQGPAGRVLVCA------HRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTYHNEMCNSNTDYLQTGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKDWDLSEY-SYRGSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAP--------RHQHMGAVFLLKQESGGDLQRKQVLKGTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVF----MNQAGASFPDQP-----SLLLHGP---SRSAFGISIASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSGGLLRQPQQIIHGEKLGLPGLATFGYSLSGK-MDVDENLYPDLLVGS-LSDHIVLLRARPVINILHRTLVAR-----PAVLDP-ALCTATS----CVQ--VELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVFHGFFSMPET-------HCQT--LELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGLRSLDA-------------YPVLNQAQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLQPLSRLQYSRDTKKLFLSINVTNSPSSQRAGEDAHEALLTLE----------------VPSALLLSSVRPSGTCQANNETILCELGNPFKRNQRMELLIAFEVIGVTLHTRDLPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLM----NHRLQSFFGGTVMGEAAMKTAEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEV------TNGKWLLYPTEITIHS----NGSWPCQPS--GNLVNPLNLTLSDP--GVTPLSPQRRRRQLDPGGDQSSPPVT-----------LAAAKKAKSETVLTCSNGRARCVWLEC---PLPDTSNITNVTVKARVWNSTFIEDYKDFDRVRVD 953          
BLAST of Alpha-int-3 vs. UniProt/SwissProt
Match: sp|Q24247|ITA1_DROME (Integrin alpha-PS1 OS=Drosophila melanogaster OX=7227 GN=mew PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 3.524e-51
Identity = 257/1099 (23.38%), Postives = 456/1099 (41.49%), Query Frame = 3
Query:   63 NFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ----NSIKYFLIGAPFDILKDSNET-TGALFSCPVTKETQDCKKFVFSEHSN----------------ESLLGYVVDSNSHE-----GLIYTCAPKFLRSHTYVKYVEGACWEFNE--MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLL----INNNFYSRENSRS-SNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVI-GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMIS---PD---LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKL----SVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISL---PIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGS-CQPILTMQAVLSL-PTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATF-------ECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSL---LGFSSITGEEKIGP----------KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDG-QYLLYLLRIPKFSITTGNKKIACN-VDILNNITNVIKTRIYQDIIPISKL------------------------------EDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            N   L +    +  +++N++   P +K  + +  S FG+S+   T  +    N     L+GAP D  +  N T +GAL+ CP+T+   DC++ +     N                +  +G  V SN  +     G +  CA +++      +Y +G C+       F EV    ++ C +    + Q+ +Y  C  G +   L+   +VL +P  Y  +G +    +   +  R+ +   S++    +   KY Y G S+  G+ F +    S   G+P        R++   GQVVI  K  +N +    ++ GE FGS +GY +   D+N D   +L+V AP  FT    G V+VY NI+         T+P+  +  L LT   +    ++G++L NIGD+NKD  +DLAVGAP+E  G G VYIYLG S  +  K +QKI+   +    P+   +R +G SI G N DLD N+YPD ++G+  S   V +  RPII +       E     P +   L    SN   + C       S+  Y              ++T D+  +    F     +KR    +++  V   G   C+       +  NT +I  PV      SL   P+  +    LN                    P+L++ + ++     F   C     C+  L ++   ++  + G +Y L + + ++ ++ I   N+A    + A+   + + + A    + +  P   T  S        S  N    D  TF       + + P++ I  +   I+ N + + + P+R  R   L++ V   A ++ +    P+   Y   S+   +  ++ T  E  GP             FTI    N   S     +++I++P+ +  +P      QYLLYL ++P   ++ G   +A   V+ LN  +   +   Y       ++                              +D Q  +  V  +  +     + + + P+ S++ +  + ++IV +DC +G+  CV + CD+  +   S E  +    R+W  TL+  + + + V I
Sbjct:   18 NLGILIILQCVLTCYNFNLEQRLPIVK--YGHPHSHFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNTTHSGALWRCPMTQRFDDCEQVITDGRRNFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEV----HEPC-KGRPVQRQHEDYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGH---MSYAAGAP--------RSE-GHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKTEGGAVYVYQNIQ--------DTLPM--KYTLKLTGPLE---SRFGLALANIGDLNKDNCEDLAVGAPYE--GNGVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISG-NTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPASN---LTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKFSRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKA--NTRDIQTPVRFRLKYSLVEPPLADSALVRLN--------------------PILDQTQAHVDFEGTFQKDCGDDDLCESNLIIRVEPNITESSGNEYTLIL-DETELEVRINVSNLA----DSAYEAQLFIAHQAGVSYVATKKPTNATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPSEKI--MLFHIFANTTSKLVGPERPERD--LRVNVVRRAKLNFRGWAIPEQSFYSGSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIF---NEGPSTAPKVQMVIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLASGSRENPAYLSAPAQMRMFPSQSRHSFNKSLIHSQRSYYSSSHRDDHSDDTQSNRNRVRRSFLERVTRLERLMYDPESSNAAN-GKKQDIVELDCNKGATNCVRIECDILNMPALS-EAQVVVKARLWNSTLVSEYPRVERVRI 1042          
BLAST of Alpha-int-3 vs. UniProt/SwissProt
Match: sp|F1MMS9|ITA3_BOVIN (Integrin alpha-3 OS=Bos taurus OX=9913 GN=ITGA3 PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 8.357e-48
Identity = 217/898 (24.16%), Postives = 377/898 (41.98%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDSNET--TGALFSCPVTKETQDCKKFVFSEHSN------ESLLGYVVDSNSHEGLIYTCAPKFL----------RSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGG----GSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSPGS-CQPILTMQAV-LSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSN-NPDRKTSTSSGLIYAVNSPL--NARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACN 2684
            ++N+D     +K    N  S FG+S+ +    +   +Y L+ GAP D+      T  TGA++ CP+T    DC++    E SN      +  LG  V S    G +  CA ++           R      YV G   E +   ++ +   N+ C     S +   E   C  G +     +  +   AP +Y  KG   N+    R++   S Y      +    Y G++M VG    +P   +IV G+P        R Q      ++ +     L    V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G ++++ N +   S  +H ++ L    R             +G S+ +IGD+N+D  QD+AVGAPFE  G G VYIY G S  +++  Q+ I G+ +  P L  +G+S+ G+  D+D N YPD +VGS LS  +V +R RP+I +  + +VA+  +  P +F +   C           + V + + Y      P+Y  + T+ Y +E D    +     RL+F    + V  G      + C+T   +   + N  + L P+ +  N SLP+ +  +  L +  +               YPVL + +    +T + F   C   + C   L M+A  +S   +    + +  ++ K  L I   N  +           +LT +     L S+  P      +  ++  + +P   N R      FE +        ++  + ++ S    S Q  LRP+ L + V       L ++    N++ +     +++G S +   E +G  +K+   +    +    L + +L + +P+E+S      +G++LLY    P      GN    C 
Sbjct:   32 AFNLDTRFLVVKEAG-NPGSLFGYSVALHRQTERQQRYLLLAGAPRDLAVPDGYTNRTGAVYLCPLTAHKNDCERMDIKEKSNPNHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDAR-DDWQTYHNEMC----NSNTDYLETGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKDWDLSEYSYKDPEDQGNLYIGYTMQVGSAILHPTNITIVTGAP--------RHQHVGAVFLLSQEAGGDLRRRQVLEGTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYIFMN-QAGTSFPDHPSLLLHGPSR-----------SAFGFSVASIGDVNQDGFQDIAVGAPFE--GLGKVYIYHGSSRGLLRQPQQVIHGEQLGLPGLATFGYSLSGQM-DVDENFYPDLLVGS-LSDRIVLLRARPVINILHKTLVAKPSILDP-AFCTATSC-----------VQVELCFAYNQSAGNPNYRRNITLAYTLEAD----RDRRPPRLHFARSQSAVFHGFFSMPEMRCQT--LELLLMDNVRDKLRPITISMNYSLPLRLPDRPQLGLGSLDA-------------YPVLNQAQALENHTEVQFQKECGQDNRCDSNLQMRAAFVSELGQRLSRLQYRRDLRKLLLSINVTNTPSRKRAGEDAHEALLTLEVPPTLLLSSVRPPGACQANETIVCELGNPFKRNQRMELLIAFEVIGVTLHTRELQAQLQLSTS----SHQDDLRPMTLPLLVDYTLQASLSMV----NHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLAALGTLVLGLEWPYEVS------NGKWLLY----PTEITVHGNGSWHCQ 846          
BLAST of Alpha-int-3 vs. UniProt/SwissProt
Match: sp|P26006|ITA3_HUMAN (Integrin alpha-3 OS=Homo sapiens OX=9606 GN=ITGA3 PE=1 SV=5)

HSP 1 Score: 173.711 bits (439), Expect = 1.444e-42
Identity = 223/915 (24.37%), Postives = 381/915 (41.64%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDSNET--TGALFSCPVTKETQDCKKFVFS------EHSNESL-LGYVVDSNSHEGLIYTCAPKFLR----SHTYVKYVEGACWEFNEMFNEVEQISNQDCL----ESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQK-IEGQMIS-PDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSII--NTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGCSP-GSCQPILTMQAVLSLPTEGEQYILHMG---NVSKFKLEIQTKNIATT-----DDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVK----------------ESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYRE---DSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACN 2684
            ++N+D     +K    N  S FG+S+ +    +   +Y L+ GAP ++      T  TGA++ CP+T    DC++   +       H  E + LG  V S    G +  CA ++ +         + + G C+      N++E  S+ D      E   S +   E   C  G +     +  +   AP +Y  KG   N+    R+    S Y      +    Y G++M VG    +P   +IV G+P        R +      ++ +     L    V+ G   G+ +G ++   DLNNDG  +L+VGAP+         G ++V+    M+Q+       P      LLL      S   +G+S+ +IGDIN+D  QD+AVGAPFE  G G VYIY   S  +++  Q+ I G+ +  P L  +G+S+ G+  D+D N YPD +VGS LS H+V +R RP+I     N+V +T +  P   D    C +      C++  V + + Y      P+Y  + T+ Y +E      +     RL F    + V  G     +    K   ++  N  + L P+ +  N SLP+ +  +  L +  +               YP+L + +    +T + F   C P   C+  L M+A     +E +Q +  +    +V K  L I   N  T+     D ++A  T ++                        L+ +   P  A Q++   F C L N F  N +                  + + + +   S Q +L P++L + V       L ++    N++ +     +++G S +   E +G  +K+   +    +  V L + +L + +P+E+S      +G++LLY    P      GN    C 
Sbjct:   32 AFNLDTRFLVVKEAG-NPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRG---NDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTS-GGFTQNTVYFGAPGAYNWKG---NSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAP--------RHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVF----MNQAGTSFPAHP-----SLLLHGP---SGSAFGLSVASIGDINQDGFQDIAVGAPFE--GLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQ-MDVDENFYPDLLVGS-LSDHIVLLRARPVI-----NIVHKTLVPRPAVLDP-ALCTATS----CVQ--VELCFAYNQSAGNPNYRRNITLAYTLEA----DRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDA-------------YPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAAFV--SEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVV---------------------PPALLLSSVRPPGACQANETIF-CELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMV----NHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVS------NGKWLLY----PTEITVHGNGSWPCR 847          
BLAST of Alpha-int-3 vs. TrEMBL
Match: A0A1P8CUU3 (Alpha-int-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1684.85 bits (4362), Expect = 0.000e+0
Identity = 840/859 (97.79%), Postives = 844/859 (98.25%), Query Frame = 3
Query:  744 MAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKRRWK 3320
            MAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGD HQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIK  + + LYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRN LSDDLADLSNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQ KNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFEC+LPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKF+IALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYK        KVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKRRWK
Sbjct:    1 MAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDRHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKPFAGRCLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNFLSDDLADLSNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQMKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECLLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFSIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYK--------KVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKRRWK 851          
BLAST of Alpha-int-3 vs. TrEMBL
Match: A0A068YDF9 (Integrin alpha ps OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000782500 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.166e-63
Identity = 283/1157 (24.46%), Postives = 501/1157 (43.30%), Query Frame = 3
Query:  204 QNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVFSEHSNE---------SLLGYVVDSNSHEG--LIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAA---LKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYL---KFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQ-VVIGKLIENS-----LEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNN--------------------GQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLS-NGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMP--------CIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDM---------PFIKTSSSK-----RLYFENKLNTVTGG-------GSINCKTPNSKSNSII------------------------NTFNILFPVNLFF------NISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPD---RKTSTSSGL-IYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIV-----LKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGP-KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSIT----TGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVP-KLPNISD--EIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKR 3311
            QN+ +  ++GAPFD        +G+++ CP   ++  C++  F  H +           L G+ + +   E   L   C+P+     T   +V G C+ F+ + N    +    CL +I   S++ + R CL GA+     +     +V  +PY    KG+ + NN       R ++      +    S    +    +       P V   V G+PG+ Q     TQ + G   V+  +IE       +  V ++ G  FGS +G++V  +DL+ DG D+LVVGAPF                         G ++V+WN    Q      T   D     ++     LS    +G S+ ++GDI++D I D AVGAP++ +G GAV IY G   + I L +Q +    ++  ++G+GFS+     DLD+N YPD  VG+  S  +   R RP+I+V    +  +    +    DSL+ C  + Q +P        C+ + V   + + DL  C    + +TI   + L +          F   +SSK       +F  ++  V           S +  TP + S+ ++                           +   PV L F      ++S PI   +KW L+          S   ADL NYP+    +N   + I FG  C    C PIL  Q   S+  + +  ++ +G+     +E++   +     + ++ T +  +Y  + ++L +N  +   R +    GL +    +PL+  +         +    +    ++  IN +I A SP+   + +      + +KVKM  N+ +   + PD   Y  +   G     GE KIG  ++   + ++N  ++S++ +S+L+I +P+E +   TE +G+ L YLL  P  + T      N  I C+   L+ + N    R+++ + P  + + V    + +P++ P + P +    EI+ +P   +   +S       + C+ G  RCVP+VCDLGPLS ++G +T +   R+W +T+ ++F       + +   W       V   +  G+     D  S  + +   N  +P+P    ++   I +AV  G++LLA ++IIL+K  FF R+   +R
Sbjct:    2 QNNGEGIIVGAPFD------NNSGSIYWCPY--KSNQCRRVNFDIHKSAHYSYSKLGNELFGFSLSTLPKERNRLAVACSPRLSYEVTGNLFVTGGCFAFDNVLNNPSFLGASSCL-NIPEASRSIDLRFCLDGASSAYFHNTYTDLIVSGSPYYQFAKGIGLVNNVTKFNPVRKTDIAYVGDYSLLGSSSVLSDRVYSSASDSERPIVS--VFGAPGVPQ-----TQDREGSGFVVLHVIEKGPNQIVIPQVKILHGNRFGSRFGHAVALIDLDCDGWDDLVVGAPFEQLPGTSVALQRDFDLHGVHSAPVFGCIYVFWN----QRRHLPSTTAFDSTSVQVIWPPPSLSFKSGFGSSITSLGDIDRDGIDDFAVGAPYD-EGGGAVLIYHGSKSRRIGLPTQILNATELTDSMKGFGFSLSSGGLDLDNNGYPDLAVGAPNSDKIAVFRARPVIKVEIFVLREDGSSHIGERLDSLEVCTRDTQILPGYWAPRVHCMNMKVLATFTHLDLVPC----ARRTIPVRLLLTINPPDHWLNEEFTNKTSSKTETPVASFFGERVLKVGDPEVGEFYQRSYDAATPPANSDEVLPFLLLNSLMAICREPGDTNKPPSPAELDQATPVRLAFRDVDLVDLSSPIRFGVKWLLDAPS------PSSPFADLINYPINNPRENTGQSLITFGNECESRKCNPILLPQFEYSVTRDRDGPVVFVGDDEFQSVEVKA-TVTNRGRDPSYATSVYASYPEELLDLSTNQHELNHRVSLVRPGLALCHFGNPLSVGEGATCALRFKVLGQQLMKAPKNFTINSTI-ASSPKFPPKMLASATDSITVKVKMSVNVSVTGEILPDAAYYSGNVTDGILINNGENKIGSTRLLIRVRVQNLRKHSLVPNSRLIIDWPYETADIITEENGKLLFYLLEKPYITKTDLPIASNTTIVCDSRALDRLVNPYNYRVFRSLAPQPRGDPVATAPIDLPSSHPTEYPPLKSNLEIEKMPDQGNVKRVS-----TTLSCYNGQLRCVPIVCDLGPLSYRTGMLTFEMPARLWDNTMRQDFKDIFMTSVQLTATW----RASVTFTIDAGDK----DHTSGNLELKIFNDMEPEPVYPKNMPLYIGLAVFTGLLLLAILIIILWKAKFFERKKFKQR 1112          
BLAST of Alpha-int-3 vs. TrEMBL
Match: A0A068WCN4 (Integrin alpha ps OS=Echinococcus granulosus OX=6210 GN=EgrG_000782500 PE=3 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.009e-60
Identity = 282/1150 (24.52%), Postives = 492/1150 (42.78%), Query Frame = 3
Query:  204 QNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVFSEHSNE---------SLLGYVVDSNSHEG--LIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINN--NFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENS-----LEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNN--------------------GQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLS-NGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGD-SHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMP--------CIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDM---------PFIKTSSSK-----RLYFENKLNTVTGG-------GSINCKTPNSKSNSII------------------------NTFNILFPVNLFF------NISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPD----RKTSTSSGL-IYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMS--PQRHLRPIV--LKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGP-KMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFS----ITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVP-KLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKR 3311
            QN+ +  ++GAPFD        +G+++ CP   ++  C++  F  H +           L G+ + +   E   L   C+P+     T   +V G C+ F+ +      +    CL +I   S++ + R CL GA+          L       G+  L+NN   F     +  +    +    S    +    +       P V   V G+PG+ Q   T  +   G VV+  +IE       +  V V+ G  FGS +G++V  +DL+ DG D+LVVGAPF                         G ++V+WN    Q      T   D     ++     LS    +G S+ ++GDI+ D I D AVGAP++ +G GAV IY G  S +I   +Q +    ++  + G+GFS+     DLD+N YPD  VG+  S  +   R RP+I++    +  +    +    DSL+ C  + Q +P        C+ + V   + + D   C    + +TI   + L +          F   +SSK       +F  ++  V           S +  TP + S+ ++                           +   PV L F      ++S PI   +KW L+          S   ADL NYP+    +N   + I FG  C    C PIL  Q   S+  + +  ++ +G+     +E++   +     + ++ T +  +Y  + ++L S NP     R +    GL +    +PL+  +         +    +    ++  IN +I +    P + L P    + +KVKM  N+ +   + PD   Y  +   G     GE KIG  ++   + ++N  ++S++ +S+L+I +P+E +   TE +G+ L YLL  P  +     T  N  I C+   L+ + N    R+++ + P  + + V    + +P++ P + P +   ++F  K  D G++        + C+ G  RCVP+VCDLGPLS ++G +T +   R+W +T+ ++F       + +   W       V   +  G+     D  S  + +   N  +P+P    ++   I +AV AG++LLA ++IIL+K  FF R+   +R
Sbjct:    2 QNNGEGIIVGAPFD------NNSGSIYWCPY--KSNQCRRVNFDIHKSAHYSYSKLGNELFGFSLSTLPKERNRLAVACSPRLSYEVTGNLFVTGGCFAFDNVLINPSFLGASSCL-NIPEASRSIDLRFCLDGASSAYFHNTYTDLIV----SGRIGLVNNVTKFNPVRKTDIAYVGDYSLLGSSSVLSDRVYSSASDSERPIVS--VFGAPGVPQ---TWDREGSGFVVL-NVIEKGPNQIVIPQVKVLHGNRFGSRFGHAVALIDLDCDGWDDLVVGAPFEQLPGTSVALQRDLDLHSVHSAPVFGCIYVFWN----QRRHLPSTTAFDSTSVQVIWPPPSLSFKSGFGSSITSLGDIDHDGIDDFAVGAPYD-EGGGAVLIYHGSKSRRIGAPTQILNATELTDSMEGFGFSLSSGGLDLDNNGYPDLAVGAPNSDKIAVFRARPVIKLEIFVLREDGSSHIGERLDSLEVCTRDTQILPGYWAPRVHCMNMKVLATFTHLDPVPC----ARRTIPVRLLLTINPPDHWLNEEFTNKNSSKMEIPVASFFGEQVLKVGDPEVGEFYRRSYDAATPPANSDEVLPFLLLNSLMAVCREPGATNKPPSPAELDQATPVRLAFRDVDLVDLSSPIRFGVKWLLDAPS------PSSPFADLINYPINNPRENTGQSLITFGNECESRKCNPILLPQFEYSVTRDRDGPVVRVGDDEFQSVEVKA-TVTNRGRDPSYATSVYASYPEELLDL-STNPHELNHRASLVRPGLALCHFGNPLSVGEGATCALRFKVLGQQLMKAPKNFTINSTITSSPKFPPKMLAPATDSITVKVKMSVNVSVTGEILPDAAYYSGNVTDGILINNGENKIGSTRLLIRVRVQNLRKHSLVPNSRLIIDWPYETADIITEENGKLLFYLLEKPYITKTDLPTASNTTIVCDSRALDRLVNPYNYRVFRSLAPQPRGDPVATAPIDLPSSHPTEYPPLKSNLEF-EKMPDQGNVKRVSTT--LSCYNGQLRCVPIVCDLGPLSYRTGILTFEMPARLWDNTMRQDFKDIFMTSVQLTATW----RASVTFTIDAGDK----DHTSDNLELKIFNDMEPEPVYPKNMPLYIGLAVFAGLLLLAILIIILWKAKFFERKKFKQR 1104          
BLAST of Alpha-int-3 vs. TrEMBL
Match: A0A1S3R6S0 (integrin alpha-3-like isoform X3 OS=Salmo salar OX=8030 GN=LOC106600863 PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.095e-59
Identity = 287/1130 (25.40%), Postives = 486/1130 (43.01%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFL-IGAPFDILKD---SNETTGALFSCPVTKETQDCKK---------FVFSEHSNESL-LGYVVDSNSHEG-LIYTCAPKFLRSHTYVKYVE--GACW-EFNEM-FNEVE-QISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKG-----LLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNN----NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRGYGFSIFG----KNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFE-NKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMK---WSLNVSEVPKRNXXXXXXXXXXNYPVLERVK-NNLTNTIHFGVGCS-PGSCQPILTMQAVLS------LPT-EGEQYILHMGNVSKFKLEIQTKNIAT-----TDDNKAFRTYII---LTYDAKKINLFSNNPDRKTSTSSGLIYA-VNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYF--PWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI----------DIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
             +N+D+  P +K       S FGFS+ +        +Y L +GAP +  +    +NET G +++CPV     DC +          +  E   E + LG  V S    G  I TC  +F++ H  +K  +  G C+   N++ +NE +    N D + S   +       N    AA+   E   +++ AP S+E +G      +  N  Y  + S   N+      N ++ Y G+S+A G+   + N  ++V G+P  ++ D+  + I   +        + L+    + GE  GS +G S+   DLNNDG ++L+VGAPF  +      G V+VY N      +   K+  +          ++   +  +G+++  IGD+N+D  QD AVGAPF   GTG VYI+ G +  I +  SQ I+G+    D+ G GF  FG       D+D N YPD +VGS L   V  +R RP+I +     V       P   D  K C++      C+++ V   Y     T    +  + T+ Y +E D+    T  + R+ F+ N L++ TG  S+    P++K  +            L   ++ PI   ++   +SLNVS     +     L +L  +PVL   K +++   IHF   C    +CQ  L M+A  +       P+ +G Q + +  NV K  L ++  N  +      D + A     I   L Y A +  L++N+P  K S    ++   + +P  + Q D    + +     I      I   + +  +S Q +L+P+ L + V+   +    L     +  +  + ++G S +     +G  ++FT  + N     +     L + F  PWE++      +G++LLYL  I     T G     C       I N +K      ++P SK    + ++ +     P+ P  S  +K   K S             +DC  G+A CV  +C   PL   +   T+    R+W  T++E++ +   V +          D P   +     +  L +        P++         A  Q P        ++ II++  AGV+LLA I+++++KC FFRR
Sbjct:   30 GFNLDVRFPVVKEGKTPG-SLFGFSVALHKQMVGEKRYLLLVGAPKEKAESGVKANET-GDVYTCPVNVAQSDCTRMNLIGSDPDLIEGEDRVEDMWLGVTVASQRQPGGRILTCGHRFVKLHGVLKLRQMIGKCYIRGNDLNYNETDMHWQNPDQVCSHTKDITGEVMCNMGISAAITDTE---VIVGAPGSFEWQGNVHVSWMNPNVIYDTKRSSFPNF-----GNRRHIYIGYSVAEGRGLLSQNQDTVVTGAPKDNKDDAKGSVILTVKKKSTSGDGDQLKPYLTLRGEQMGSYFGNSLAVADLNNDGWNDLIVGAPFYFDRKKELGGAVYVYMN---ENGSFRQKSSII----------LRGPRDSAFGMAVAAIGDVNQDGFQDFAVGAPFH--GTGRVYIWTGSAEGISREPSQVIDGE----DIAGGGFKTFGYSINGGLDVDENRYPDMVVGS-LDDRVALLRARPVIHLIKTLEVT------PEIVDP-KDCDN------CVEVKVCFSYTLS--TGANDFRKNVTVKYTVEADL----TRHNHRVRFQDNGLDSYTGFLSM----PSAKCKT------------LRLGLASPIRDKVEPVVFSLNVSLHEGHSKARQSLQNLDAFPVLSEGKASHVKKEIHFQKACGLDNTCQSNLQMKAEFANEEQTPFPSHDGHQILQYSANVKKVMLVVEVTNFPSPGKPAEDAHNAMLNVTIPPSLIYSAFRSKLWNNSPAIKCSAEDMVVLCELGNPFTSNQMDQV--QIIFQTSEISLDTREIRSTLQLSTLSKQSNLQPLPLVMMVEYTLDTSFALAQYTGHTHFSGE-IMGESGMKTASDVGSPVEFTFKV-NVFGKPLGNLGNLEVEFDWPWEVA------NGKWLLYLTEIQ----TKGTSDSHCVPP--GAIVNPLKL-----MLPESKARRRKREEGSTEEVHPREPQASLNLKGTRKKS-----------FKLDCVTGAAHCVKFIC---PLRNMNNTATIIVRARVWNSTMLEDYREAWRVTVNGKATLKLVTDKPTIRMNTESTEFTLNID-------PELGEE------ATYQVP--------LWIIIVSAVAGVLLLAFIILLMWKCGFFRR 1038          
BLAST of Alpha-int-3 vs. TrEMBL
Match: A0A1S3R7F9 (integrin alpha-3-like isoform X1 OS=Salmo salar OX=8030 GN=LOC106600863 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.342e-59
Identity = 287/1132 (25.35%), Postives = 487/1132 (43.02%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFL-IGAPFDILKD---SNETTGALFSCPVTKETQDCKK---------FVFSEHSNESL-LGYVVDSNSHEG-LIYTCAPKFLRSHTYVKYVE--GACW-EFNEM-FNEVE-QISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKG-----LLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNN----NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRGYGFSIFG----KNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFE-NKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMK---WSLNVSEVPKRNXXXXXXXXXXNYPVLERVK-NNLTNTIHFGVGCS-PGSCQPILTMQAVLS------LPT-EGEQYILHMGNVSKFKLEIQTKNIAT-----TDDNKAFRTYII---LTYDAKKINLFSNNPDRKTSTSSGLIYA-VNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYF--PWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI----------DIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQN 3299
             +N+D+  P +K       S FGFS+ +        +Y L +GAP +  +    +NET G +++CPV     DC +          +  E   E + LG  V S    G  I TC  +F++ H  +K  +  G C+   N++ +NE +    N D + S   +       N    AA+   E   +++ AP S+E +G      +  N  Y  + S   N+      N ++ Y G+S+A G+   + N  ++V G+P  ++ D+  + I   +        + L+    + GE  GS +G S+   DLNNDG ++L+VGAPF  +      G V+VY N      +   K+  +          ++   +  +G+++  IGD+N+D  QD AVGAPF   GTG VYI+ G +  I +  SQ I+G+    D+ G GF  FG       D+D N YPD +VGS L   V  +R RP+I +     V       P   D  K C++      C+++ V   Y     T    +  + T+ Y +E D+    T  + R+ F+ N L++ TG  S+    P++K  +            L   ++ PI   ++   +SLNVS     +     L +L  +PVL   K +++   IHF   C    +CQ  L M+A  +       P+ +G Q + +  NV K  L ++  N  +      D + A     I   L Y A +  L++N+P  K S    ++   + +P  + Q D    + +     I      I   + +  +S Q +L+P+ L + V+   +    L     +  +  + ++G S +     +G  ++FT  + N     +     L + F  PWE++      +G++LLYL  I     T G     C       I N +K      ++P SK    + ++ +     P+ P  S  +K   K S             +DC  G+A CV  +C   PL   +   T+    R+W  T++E++ +   V +          D P   +     +  L +        P++         A  Q P        ++ II++  AGV+LLA I+++++KC FF+R N
Sbjct:   30 GFNLDVRFPVVKEGKTPG-SLFGFSVALHKQMVGEKRYLLLVGAPKEKAESGVKANET-GDVYTCPVNVAQSDCTRMNLIGSDPDLIEGEDRVEDMWLGVTVASQRQPGGRILTCGHRFVKLHGVLKLRQMIGKCYIRGNDLNYNETDMHWQNPDQVCSHTKDITGEVMCNMGISAAITDTE---VIVGAPGSFEWQGNVHVSWMNPNVIYDTKRSSFPNF-----GNRRHIYIGYSVAEGRGLLSQNQDTVVTGAPKDNKDDAKGSVILTVKKKSTSGDGDQLKPYLTLRGEQMGSYFGNSLAVADLNNDGWNDLIVGAPFYFDRKKELGGAVYVYMN---ENGSFRQKSSII----------LRGPRDSAFGMAVAAIGDVNQDGFQDFAVGAPFH--GTGRVYIWTGSAEGISREPSQVIDGE----DIAGGGFKTFGYSINGGLDVDENRYPDMVVGS-LDDRVALLRARPVIHLIKTLEVT------PEIVDP-KDCDN------CVEVKVCFSYTLS--TGANDFRKNVTVKYTVEADL----TRHNHRVRFQDNGLDSYTGFLSM----PSAKCKT------------LRLGLASPIRDKVEPVVFSLNVSLHEGHSKARQSLQNLDAFPVLSEGKASHVKKEIHFQKACGLDNTCQSNLQMKAEFANEEQTPFPSHDGHQILQYSANVKKVMLVVEVTNFPSPGKPAEDAHNAMLNVTIPPSLIYSAFRSKLWNNSPAIKCSAEDMVVLCELGNPFTSNQMDQV--QIIFQTSEISLDTREIRSTLQLSTLSKQSNLQPLPLVMMVEYTLDTSFALAQYTGHTHFSGE-IMGESGMKTASDVGSPVEFTFKV-NVFGKPLGNLGNLEVEFDWPWEVA------NGKWLLYLTEIQ----TKGTSDSHCVPP--GAIVNPLKL-----MLPESKARRRKREEGSTEEVHPREPQASLNLKGTRKKS-----------FKLDCVTGAAHCVKFIC---PLRNMNNTATIIVRARVWNSTMLEDYREAWRVTVNGKATLKLVTDKPTIRMNTESTEFTLNID-------PELGEE------ATYQVP--------LWIIIVSAVAGVLLLAFIILLMWKCGFFKRPN 1040          
BLAST of Alpha-int-3 vs. Ensembl Cavefish
Match: itga6a (integrin subunit alpha 6 [Source:NCBI gene;Acc:103030583])

HSP 1 Score: 189.889 bits (481), Expect = 1.410e-48
Identity = 289/1168 (24.74%), Postives = 481/1168 (41.18%), Query Frame = 3
Query:   66 FIFLFLFHVPVLYF----SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ-NSIKYFLIGAPFD--ILKDSNETTGALFSCPVTKETQDCKKFVFS-------EHSNESLLGYVVDSNSHEGLIYTCAPKFLR-----SHTYVKYVEGACWEFNEMFNEVEQISNQDC--LESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL---------LINNNFYSR------ENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENS--LEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNT---VTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNI-SLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERV--KNNLTNTIHFGVGCSPGS-CQPILTMQAVLS-----------LPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKA---FRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYI----------------NISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVI-------------YAIIIAVSAGVILLATIVIILYKCNFFRR 3293
            F+    +  P+L +    ++N+D  +   K    +  S FGFS+ +    Q    +  LIGAP    +       TG L+SC +T  T DC +  F        E      +G  V S    G I TCA ++ R     S    + + G C+  ++  + ++  S++D    +  +  ++ +E +  C  G AA  + +   L+  AP +Y  KG+         L+   FY        + SR +  L    +NS   Y GFS+  G          +V G+P        R       +++GK  E S  L  V ++ G    S +GY V  +DLN DG +++VVGAP     +G+V     I M+++      +P+          +    +  +G+ +E IGDIN D   D+AVGAP+ + G+G VYIY G +  I  K +Q +EG+     ++ +G+S+ G N DLD N+YPD  VGS LS  V   R+RP+I +  E  V       P   D  KK   N      I L+V   + Y      P+Y+    I Y +E +    K     R+ F++K  T       GS+  K  N ++        +    N+   + ++PIE+++   +  ++  KR     +L      PVL+      N T       GC   + CQ  L +Q               LP +    ++ + +     LE+  +N    D ++A    +   +L+Y       F ++ +  +S    +I   N   N  Q+D     C L N F  + + + YI                ++ +E  S Q  LR +  K KV +   + ++ +  P    Y    + G S++  EE +G  + +   + N  +      +  L I +P E S       G++LLYL++I    +    ++I C+ +   N+  + + R  +      +    +  K +V T+  K   +S                         C  G ARCV + C L  L   S +I L+   R+W  T IE F  Y   Y+D+      +V   + L V   N      IV          L+ P+    L V              + I++AV AG+++LA +V++L+KC FF+R
Sbjct:    7 FVGFSWWISPLLLWTGAAAFNLDTQTVLRKDG--DPGSLFGFSIALHRQLQPEDRRILLIGAPRAKALAYQRANITGGLYSCDITAHTDDCNRIEFDNEADAQKESKENQWMGVTVQSQGPGGKIVTCAHRYQRRLFVNSPQESRDITGRCYVLSQDLS-IDSQSDEDGGNWKFCEGRARGHERFGACQQGLAAAFTNDYHYLIFGAPGAYNWKGIVRVEQKNNTLLEMGFYDDGPYEVGDESRLNPELVPVPANS---YLGFSLDSGHSITEKGKLIVVSGAP--------RANHSGAVILLGKEGEVSSMLSPVYILEGPGLASSFGYDVAVVDLNGDGWEDIVVGAPQFFQRDGEVGGAVYIYMNRAGKWSSVVPI---------RLNGTKDSMFGLVVEKIGDINLDSYDDIAVGAPYADGGSGRVYIYHGSADGINTKAAQVLEGKQHG--IKMFGYSLAG-NMDLDENSYPDLAVGS-LSDSVFIYRSRPVITMTKEIKVT------PREIDLTKKTCGN-----SICLNVEACFTYK--ANPPTYSPKLRISYTLEAESVRRKQGMPSRVSFQDKKPTDQDFQSTGSLELKGQNKRA---CYKTKLRLQENIKDKLRAIPIEVSV--DIASAKRGKRQNSLPELV-----PVLDSSLPSKNSTEVNFLKEGCGTDNICQSNLHLQYRFCYRESNQDIFPPLPVKNGVAVVSLSDQKDIALEVTVRNRNGDDAHEAKLVGQFGDLLSYSG-----FRSHRNSMSSKDKQVICVANQ--NGSQAD-----CELGNPFKRDSEVTFYIILSTARISLNTTEVEVDLQLETTSLQEGLRKVRAKAKVMIELLLSVQGIAKPSQV-YFGGVVKGESAMKSEEDVGSLIDYEFRVINLGKPLKSFGTAYLNIQWPKETS------TGRWLLYLVKINSKEL----EEIKCSPEKEINLLGLTE-RSSRKKREAEESRSTETSKTSVFTDQRKYKTLS-------------------------CL-GDARCVEIKCPLLNLD-SSADIILRS--RLWNATFIEEFSSYN--YLDV------IVHASISLNVSAKN------IV----------LKNPETQVRLTVFPENTVAHYGGVPWWIILVAVLAGILMLALLVLLLWKCGFFKR 1047          
BLAST of Alpha-int-3 vs. Ensembl Cavefish
Match: itga6a (integrin subunit alpha 6 [Source:NCBI gene;Acc:103030583])

HSP 1 Score: 189.889 bits (481), Expect = 1.410e-48
Identity = 289/1168 (24.74%), Postives = 481/1168 (41.18%), Query Frame = 3
Query:   66 FIFLFLFHVPVLYF----SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ-NSIKYFLIGAPFD--ILKDSNETTGALFSCPVTKETQDCKKFVFS-------EHSNESLLGYVVDSNSHEGLIYTCAPKFLR-----SHTYVKYVEGACWEFNEMFNEVEQISNQDC--LESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL---------LINNNFYSR------ENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENS--LEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNT---VTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNI-SLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERV--KNNLTNTIHFGVGCSPGS-CQPILTMQAVLS-----------LPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKA---FRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYI----------------NISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVI-------------YAIIIAVSAGVILLATIVIILYKCNFFRR 3293
            F+    +  P+L +    ++N+D  +   K    +  S FGFS+ +    Q    +  LIGAP    +       TG L+SC +T  T DC +  F        E      +G  V S    G I TCA ++ R     S    + + G C+  ++  + ++  S++D    +  +  ++ +E +  C  G AA  + +   L+  AP +Y  KG+         L+   FY        + SR +  L    +NS   Y GFS+  G          +V G+P        R       +++GK  E S  L  V ++ G    S +GY V  +DLN DG +++VVGAP     +G+V     I M+++      +P+          +    +  +G+ +E IGDIN D   D+AVGAP+ + G+G VYIY G +  I  K +Q +EG+     ++ +G+S+ G N DLD N+YPD  VGS LS  V   R+RP+I +  E  V       P   D  KK   N      I L+V   + Y      P+Y+    I Y +E +    K     R+ F++K  T       GS+  K  N ++        +    N+   + ++PIE+++   +  ++  KR     +L      PVL+      N T       GC   + CQ  L +Q               LP +    ++ + +     LE+  +N    D ++A    +   +L+Y       F ++ +  +S    +I   N   N  Q+D     C L N F  + + + YI                ++ +E  S Q  LR +  K KV +   + ++ +  P    Y    + G S++  EE +G  + +   + N  +      +  L I +P E S       G++LLYL++I    +    ++I C+ +   N+  + + R  +      +    +  K +V T+  K   +S                         C  G ARCV + C L  L   S +I L+   R+W  T IE F  Y   Y+D+      +V   + L V   N      IV          L+ P+    L V              + I++AV AG+++LA +V++L+KC FF+R
Sbjct:    7 FVGFSWWISPLLLWTGAAAFNLDTQTVLRKDG--DPGSLFGFSIALHRQLQPEDRRILLIGAPRAKALAYQRANITGGLYSCDITAHTDDCNRIEFDNEADAQKESKENQWMGVTVQSQGPGGKIVTCAHRYQRRLFVNSPQESRDITGRCYVLSQDLS-IDSQSDEDGGNWKFCEGRARGHERFGACQQGLAAAFTNDYHYLIFGAPGAYNWKGIVRVEQKNNTLLEMGFYDDGPYEVGDESRLNPELVPVPANS---YLGFSLDSGHSITEKGKLIVVSGAP--------RANHSGAVILLGKEGEVSSMLSPVYILEGPGLASSFGYDVAVVDLNGDGWEDIVVGAPQFFQRDGEVGGAVYIYMNRAGKWSSVVPI---------RLNGTKDSMFGLVVEKIGDINLDSYDDIAVGAPYADGGSGRVYIYHGSADGINTKAAQVLEGKQHG--IKMFGYSLAG-NMDLDENSYPDLAVGS-LSDSVFIYRSRPVITMTKEIKVT------PREIDLTKKTCGN-----SICLNVEACFTYK--ANPPTYSPKLRISYTLEAESVRRKQGMPSRVSFQDKKPTDQDFQSTGSLELKGQNKRA---CYKTKLRLQENIKDKLRAIPIEVSV--DIASAKRGKRQNSLPELV-----PVLDSSLPSKNSTEVNFLKEGCGTDNICQSNLHLQYRFCYRESNQDIFPPLPVKNGVAVVSLSDQKDIALEVTVRNRNGDDAHEAKLVGQFGDLLSYSG-----FRSHRNSMSSKDKQVICVANQ--NGSQAD-----CELGNPFKRDSEVTFYIILSTARISLNTTEVEVDLQLETTSLQEGLRKVRAKAKVMIELLLSVQGIAKPSQV-YFGGVVKGESAMKSEEDVGSLIDYEFRVINLGKPLKSFGTAYLNIQWPKETS------TGRWLLYLVKINSKEL----EEIKCSPEKEINLLGLTE-RSSRKKREAEESRSTETSKTSVFTDQRKYKTLS-------------------------CL-GDARCVEIKCPLLNLD-SSADIILRS--RLWNATFIEEFSSYN--YLDV------IVHASISLNVSAKN------IV----------LKNPETQVRLTVFPENTVAHYGGVPWWIILVAVLAGILMLALLVLLLWKCGFFKR 1047          
BLAST of Alpha-int-3 vs. Ensembl Cavefish
Match: itga3b (integrin alpha-3-like [Source:NCBI gene;Acc:103040573])

HSP 1 Score: 181.8 bits (460), Expect = 4.183e-46
Identity = 260/1023 (25.42%), Postives = 433/1023 (42.33%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLI-GAPFDILKDS---NETTGALFSCPVTKETQDCKKF--VFSEHSNESL----LGYVVDSNSHE--GLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNC---------------LTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIK-LSQKIEGQMI-SPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYF-ENKLNTVTGGGSINCKTPNSKSNSIINTF-NILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVL---ERVKNNLTNTIHFGVGC-SPGSCQPILTMQAVLS----LP---TEGEQYILHMGNVSKFKLEIQTKNIAT--TDDNKAFRTYIILTYDA--KKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTET-DGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENF 3023
             +NIDL  P +K       SFFGFS+      Q   KY L+ GAP +    +   NET GA++SCP+T +  DC +   + S  S+E +    LG  V S   +  G +  C       H YVK V G   E   M  +   +   D     + + QN+ Y  C               ++G   KS     +  T  Y ++G  + +     S  NS   N         +  Y G+S+       +    ++V G+P     D +R     G V +  +  + L     I GE  GS +G S+   DLNND  ++L+VGAPF         G V+V+ N   S              K+++L  MK      +GI++  IGDIN+D  QD AVGAPF   G+G VYI+ G    I+K  SQ IEG  + S   + +G+S+ G   D+D N YPD +VGS L   +  +R RP+I+      ++ T    P   D L +C        C+  +V + + Y      P + +  ++ Y +E D    +   + R+ F + KLNT TG  + +  T      S+ +   N L PV    N+SL +E          +VP ++ L +       +PVL   +RV       I+F   C +   C   L ++   +    +P    +  Q + +  +V K  L ++  N+     +   A +  + LT     K   L     D + + +  +I  + +P  + +  N  F   +    I    + I   + +  +S Q  L P+ + + V+        +  + +N  +    ++G S +     +G  +KF   +  + +    + + L + F W     P E  +G++LLYL  I    +TTG  +  C  D    I N +   + +        ++ +  K  +  N+P+    ++  + L        +S  +   L+DC + +ARCV   C L  +S  S EIT++   R+W  T++E++
Sbjct:   21 GFNIDLRFPVVKEGKTKG-SFFGFSVAQHKQTQKGEKYLLLTGAPREKAPSNLKVNET-GAVYSCPITSDVADCTRMDIITSTDSSEMIEGMWLGVTVASQRDQPDGRVLACG------HRYVKVVPGGIEEQRRMVGKC-YVRGNDLTYDNRDDWQNHPYEVCNHNFDMEKEGMCNMGISGGMTKS--DVYIGCTGSYLWQGN-VHVTWRDTSPGNSWDYNDRDLGQQAKRNSYMGYSVTEETKLLDGTEFTLVTGAP----RDESR-----GSVTLAAVGNSDLVVKVTIPGEQVGSYFGSSIAVTDLNNDNWNDLIVGAPFYFDRYKEQGGAVYVFMNENGSFGG-----------KKMVLKGMK---GSGFGIAVAAIGDINQDGFQDFAVGAPFH--GSGKVYIWTGSKEGIMKDPSQVIEGNSVGSGGFQTFGYSLSG-GMDMDGNKYPDILVGS-LDDRIALLRARPVIQ------LSRTFTVEPKIVDPL-QCKD-----ACV--TVKMCFAYTLSNGNPDFKNKISVKYTVEAD----RALRNPRVQFTDTKLNTNTGVLTFSSSTCQELKLSVTDQIKNKLDPVVFLLNVSL-VE---------PDVPAQSSLQNLDV----FPVLSSQQRVTEKA--EINFQKECGADNKCSSNLQVKKEFANESQVPFSSNDKGQMMEYDNSVVKLTLLLEVSNLPEPGREAEDAHQAMLNLTIPPTLKYSGLRPQGIDIQCTANVTVICDLGNPFKSNKQINFHF---IFQTSITLYTDQIQTQLQLSTLSEQSDLNPVSITLNVRNNIAPSFTIDNSVEN-TFFSGKVMGESGMKTISDVGSPVKFVFKVSVSGEPLGEMGT-LFVVFDW-----PVEVLNGKWLLYLTEI----LTTGTSEQRCVPD--GQIVNPLNLTLSE--------KNSKRNKRDLDVNLPQ----TEAARTL--------LSPRKESHLLDCSKQTARCVTFSCPLTNMS-TSAEITVR--ARVWNTTMLEDY 931          
BLAST of Alpha-int-3 vs. Ensembl Cavefish
Match: itga6a (integrin subunit alpha 6 [Source:NCBI gene;Acc:103030583])

HSP 1 Score: 163.31 bits (412), Expect = 3.044e-40
Identity = 168/604 (27.81%), Postives = 266/604 (44.04%), Query Frame = 3
Query:   66 FIFLFLFHVPVLYF----SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQ-NSIKYFLIGAPFD--ILKDSNETTGALFSCPVTKETQDCKKFVFS-------EHSNESLLGYVVDSNSHEGLIYTCAPKFLR-----SHTYVKYVEGACWEFNEMFNEVEQISNQDC--LESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL---------LINNNFYSR------ENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENS--LEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQI-IKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNT---VTGGGSINCKTPNSKS 1745
            F+    +  P+L +    ++N+D  +   K    +  S FGFS+ +    Q    +  LIGAP    +       TG L+SC +T  T DC +  F        E      +G  V S    G I TCA ++ R     S    + + G C+  ++  + ++  S++D    +  +  ++ +E +  C  G AA  + +   L+  AP +Y  KG+         L+   FY        + SR +  L    +NS   Y GFS+  G          +V G+P        R       +++GK  E S  L  V ++ G    S +GY V  +DLN DG +++VVGAP     +G+V     I M+++      +P+          +    +  +G+ +E IGDIN D   D+AVGAP+ + G+G VYIY G +  I  K +Q +EG+     ++ +G+S+ G N DLD N+YPD  VGS LS  V   R+RP+I +  E  V       P   D  KK   N      I L+V   + Y      P+Y+    I Y +E +    K     R+ F++K  T       GS+  K  N ++
Sbjct:    7 FVGFSWWISPLLLWTGAAAFNLDTQTVLRKDG--DPGSLFGFSIALHRQLQPEDRRILLIGAPRAKALAYQRANITGGLYSCDITAHTDDCNRIEFDNEADAQKESKENQWMGVTVQSQGPGGKIVTCAHRYQRRLFVNSPQESRDITGRCYVLSQDLS-IDSQSDEDGGNWKFCEGRARGHERFGACQQGLAAAFTNDYHYLIFGAPGAYNWKGIVRVEQKNNTLLEMGFYDDGPYEVGDESRLNPELVPVPANS---YLGFSLDSGHSITEKGKLIVVSGAP--------RANHSGAVILLGKEGEVSSMLSPVYILEGPGLASSFGYDVAVVDLNGDGWEDIVVGAPQFFQRDGEVGGAVYIYMNRAGKWSSVVPI---------RLNGTKDSMFGLVVEKIGDINLDSYDDIAVGAPYADGGSGRVYIYHGSADGINTKAAQVLEGKQHG--IKMFGYSLAG-NMDLDENSYPDLAVGS-LSDSVFIYRSRPVITMTKEIKVT------PREIDLTKKTCGN-----SICLNVEACFTYK--ANPPTYSPKLRISYTLEAESVRRKQGMPSRVSFQDKKPTDQDFQSTGSLELKGQNKRA 570          
BLAST of Alpha-int-3 vs. Ensembl Cavefish
Match: itga6b (integrin alpha-6-like [Source:NCBI gene;Acc:103030335])

HSP 1 Score: 160.614 bits (405), Expect = 1.972e-39
Identity = 240/1015 (23.65%), Postives = 423/1015 (41.67%), Query Frame = 3
Query:  225 LIGAPF--DILKDSNETTGALFSCPVTKETQDCKKFVF-------SEHSNESLLGYVVDSNSHEGLIYTCAPKFLR-----SHTYVKYVEGACWEFNEMFNEVEQISNQDC-LESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL---------LINNNFYSRENSRSSNYLKFRNSNS----KYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVG--VIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNN--GQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLG-DSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKK-CNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVT---GGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVL--ERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLS-----------LPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIK---------VKMVANIDLKLLVT------PDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACN----VDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            L+GAP    + K  ++ TG L++C VT     C +  F       SE+ +   +G  V S    G I TCA ++ R     +    + + G C+  ++     E   ++    +  +  ++ +E + +C  G +A  + +   LV  AP ++  KG+         L+   FY  +      Y      ++       Y GFS+  GK+        +V G+P ++   +         V++ K  E S + +   ++ GE   S +GY +  +D+N D   +LVVGAP  F  N++  G ++VY N   + +N              + T +    +  +G+S+E++GDIN D   D+A+GAP+E+ G G+VYIY G DS   +K +Q ++G+ +  +++ +G+S+ G N DLD+N YPD  +GS LS  +   R RP++ +  E  V  T    P   D  KK C  +      I L V   Y Y   +    Y++   I Y IE++    K     R+ F    NT T     G ++    N +   +  T  +   +       +PIE+ ++  L  S   KR++    L      PVL   +   N  N +  G G S   C   L +Q +             LP  G+  ++ + +  +  LE+   N    D   A+ T +I ++        S +  R  +    +I   N   N  Q+     EC L N F  N   + YI +    +S   +   + L++K         +   AN+ ++LL++      P   ++    + G S++  E ++G ++ +   + N  +      +  L I +P   + N      ++LLYL++I     +TG ++I C     V+ L+ I      R+ +++   +  +D            PK    +D+ K                  ++ C +G A CV   C   PL        +    R+W  T +E+F    +V I
Sbjct:    6 LVGAPKAKKLSKQQSQITGGLYNCDVTTIEATCPRVNFDNDEDVRSENKSNQWMGVTVQSQGPGGKIVTCAHRYQRRLFVNTAQESRDITGRCYVLSQDLKIDESTGDEGGDWKFCEGRARGHERFGSCQQGMSATFTKDYHYLVFGAPGAFNWKGVVRVEQKNNTLLELGFYD-DGPYEVTYKTAEGLDTVAVPANSYLGFSLDSGKMVTKAGQLVVVAGAPRVNHSGAV--------VLLKKESETSPQLITEYILEGEGLASSFGYDLALLDVNGDKWQDLVVGAPQYFEKNSDIGGAIYVYINKNGNWANA-------------VRTRIDGPKDSMFGLSVESLGDINLDGFNDVAIGAPYEDGGMGSVYIYHGSDSGLKLKPAQVLKGKDL--NIKLFGYSLAG-NMDLDNNQYPDLAIGS-LSDTIAVFRARPVVNI--EKTVTMT----PKELDLNKKNCGDS------ICLQVRTCYKY--TSNSKDYSAPLRIKYSIEVESKRKKLGLPSRVTFSPHSNTDTDYESSGIVDLSKANEQ-KCVDKTIKLQDTIKDKLR-GIPIEVNVEI-LYPSARRKRDVAFSQL-----LPVLGSSQPAANEVNFVKEGCG-SDNICNSNLKLQYIFCSREPNSDNFKPLPLVGDVPVISLSDQKEIALEVTVTNQNGDD---AYETVLIGSFPGA----LSYSASRTKTPDKVVICVANQ--NGSQA-----ECELGNPFKRNSVVTFYIILGTGGISLDMNEVAVNLQLKTTSDQPPLSITKKANVIVQLLLSLSGVAKPSQLEF-TGQVKGESAMKTESEVGSQIDYEFRVINLGKPLKSFGTAFLNIQWPKSTASN------KWLLYLMKIS----STGVERIGCGRTQEVNPLSLIQESSSARLKREVGKETSSDD------------PKFSLFTDKRKS----------------KVLSCEDG-ANCVNFKC---PLQGLDSNAVIALKARLWNSTFLEDFADMNYVDI 914          
BLAST of Alpha-int-3 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 187.193 bits (474), Expect = 1.900e-48
Identity = 270/1144 (23.60%), Postives = 451/1144 (39.42%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQN-SIKYFLIGAPFD--ILKDSNETTGALFSCPVTKETQDCKKFVF-------SEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE------GACW------EFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLL----INNNFYSR----ENSRSSNYLKFRNSN----SKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNN--GQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLN------------TVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLE-RVKNNLTNTIHF-GVGCSPGS-CQPILTMQAVLSLPTEGEQY--ILHMGNVSKFKLEIQTK-----NIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNAR-----QSDNATFECMLPNDFIENVKESIYINISIEAM----------------SPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLL-IYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
            ++N+D     +K    ++ S FGFS+ +    Q       L+GAP    +       TG ++ CP T  T DC++ +F       +E   +  +G  V S    G +  CA ++  +  +V   E      G C+        NE  +E++  S Q C     S  Q    +  L     +      +   AP +Y  KG+      N+ FY +    +    +   +++N      +   Y GFSM  GK     N  S V G+P        R       VV+ K   +SL     I+GE   S +GY V   DLNNDG  +LVVGAP  F    +  G V+VY N        EH  I L+  K           +  +G+++ NIGDIN+D  +D+AVGAP+  DG+G V+IY G    I   +     Q+I   +  +G+SI G   D+D NTYPD ++GS LS  +  +R RP+I     N++  +D  +     ++K C ++  +  CIK+     Y         +Y     + Y  E +M   K     R+ F N+ +             + G G   C     +    I       P+ L + I+  ++   + SL++                   PVL+ +V + +   I+F   GC P + CQ  L ++       E E+Y  +  M     F L  Q       +I+ T D            DA + +L  N PD   + S G       P   +      ++ +  +C L N        S Y+ +S   +                S Q  L  +  K+KV +   + +     P   ++  + + G S +  EE +G  +++   + N  ++   L S  + I +P EI       +G++LLYL+ +       G ++  CN        N I     Q + P     + + + + + T   +LP  +D                   +   DC +G+ARC  + C   PL+       ++   R+W  T +E     ++ ++D           +++ +   G   + P+IV    R        P      + I ++I+  SA +   AT+  +  KC FF+R
Sbjct:   24 TFNVDTRLAVVKEG--DSGSLFGFSVALHRQLQPIDRSVLLVGAPRAKALPNQHANRTGGVYQCPFTANTDDCQRVIFDNDADPTTESKQDQWMGVTVKSQGPGGKVLACAHRY-ETRRFVGLPEETRGMIGRCYVLSQDLRMNEQ-DEMDGGSWQFCAGRPDSHEQFGVCQQGLDAGFTRDFH--YIYFGAPGAYNWKGIAHVAQRNSTFYEQGIFDDGPYETGDERWKNEKLVPVAYNSYLGFSMDSGKSVMARNRLSFVAGAP--------RANHTGAVVVLKKDSLSSLTPEQTIYGEELASSFGYDVTLADLNNDGWLDLVVGAPQYFDRREDIGGAVYVYMN--QRGGFDEHNFIRLNGTK-----------DSMFGLAVANIGDINQDGFEDIAVGAPY--DGSGKVFIYHGGRMGINPKAS----QVIVRTVEKFGYSITG-GMDVDGNTYPDLLIGS-LSDKIALLRARPVI---TPNILVTSDKDIDI---NVKNCEND--KRICIKVKACFSYK----AKPANYNPIINLTYTFEAEMDRRKQGLGSRVSFLNRGSNSPEEYVLSGSLVLMGQGREKCTEKTMQLQENIKDKLRPIPLQLTYEINQVVKTKRQASLSLQ------------------PVLDAQVPSRMKTEINFVKEGCGPDNICQSNLILKYNYCSREENEKYKALKSMSGQQVFSLSDQKDLALEVSISNTGD------------DAHEAHLIVNLPD---AVSYGGFRKKTVPEEVQLVCVANANGSLADCELGNPLKRGQAVSFYLILSTSGITLDTSEISTALLLTTTSEQPDLNALSAKLKVVIELALTVTGFTKPSQAKFGGE-IRGESVMKTEEDVGSLIEYDFKVLNLGKSLGSLGSAFISISWPAEIP------NGKWLLYLVSVE----MVGTRETHCNPS-----GNRINELGLQKVAPEISPSNDKRRSLKLVTACARLPICAD-----------------RRVDAYDCRDGTARCYTLQC---PLTAMDSVAEIKLRARLWNSTFLE-----EYSHLD---------QLEIITRATVGISSQSPNIVMKDAR--------PDGYPVSEHICSLIM--SAHITNTATVFSLRMKCGFFKR 1027          
BLAST of Alpha-int-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001557.1 (pep scaffold:Pmarinus_7.0:GL480593:314407:372761:-1 gene:ENSPMAG00000001371.1 transcript:ENSPMAT00000001557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 2.147e-36
Identity = 142/477 (29.77%), Postives = 215/477 (45.07%), Query Frame = 3
Query:  222 FLIGAP---FDILKDSNETTGALFSC-----------------PVTKETQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYV---KYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNY--EYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF--TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFD-SLKKCNSNGQEMPCIKLSVSIYY 1565
             L+GAP    D+L ++    GA+F C                 P ++    C +    E  N+ L   +   N  +G I  CA ++ ++  YV   K   G C+         E      C    K   + Y  E+ +C  G A   LE   +VL AP S+   G +I +N  +R NS  S     R +     Y G+S+  G  F +P    +V G+P          +   G+V + ++    L  +    G+  GS +G ++ A+DLN+DG+ +L+VGAP    + + G+V VY N         H    L VE+  L+       N  +G  +  +GDI+ D   D+AVGAP E +  GAVYIY G  + I  K SQ+I G+ I   +  +G SI G+  DLD N YPD ++G+  S   V  RTRP+I V       E  + LP S + +   C   GQ   C+ +SV + +
Sbjct:    1 ILVGAPKADSDLLTETVHP-GAIFKCRVQPNGEQSCTEMLLGPPGSRHNHQCGRTCLEERDNQWLGVSMARQNKPDGKILACAHRW-KNAFYVREWKLPHGLCYIIPASLAPSESTHIIPCF---KEHQKKYGEEHGSCQAGIAGLFLE-DAVVLGAPGSFYWTGTVILHNLTTRANSFYSE--SERRAVGYSSYLGYSITAGH-FTHPQSTEVVGGAP---------QRANVGEVYLFRIQRGGLHIIRHFSGKKMGSYFGSALCAVDLNSDGLSDLLVGAPTHSASRDEGRVHVYVN---------HGNGDL-VEQEPLVG--LNAYNAHFGAVIAALGDIDDDGFPDVAVGAPQEEE-FGAVYIYHGSQNGITHKHSQRIFGKSIESGISMFGQSISGQ-VDLDGNGYPDVVIGAFTSDVAVLFRTRPVITV-------EASVVLPRSVNITAPLCVDGGQPTLCLNVSVCLRF 438          
BLAST of Alpha-int-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005763.1 (pep scaffold:Pmarinus_7.0:GL478250:6840:43285:-1 gene:ENSPMAG00000005190.1 transcript:ENSPMAT00000005763.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 2.274e-34
Identity = 137/509 (26.92%), Postives = 225/509 (44.20%), Query Frame = 3
Query:  105 FSYNIDL-NSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETTGALFSC-------------PVTKETQDCKKFVFSEHSNESLLGYVV--DSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDC-LESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNS---KYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQ--DLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFD-SLKKCNSNGQEMPCIKLSV 1553
             +YN+D+  +  I+       +FFGFS  +      +  + LIGAP    +   E +GA+F C             P+ K T +    +  E   +  LG  +  ++   E  +  CA +    +    +  G C+                C + ++ +  +  ++ +C  G A  S  +  +VL  P S+   G ++ +N        SS +  F   ++   K  Y G+S++ G IF N     +V G+P          Q   G+V +  L+E  L+      G+  GS +G +  A+DL+ DG+ +L+VGAP      + G+V V+ N    Q N+        VE++ LL+      N  +G  +  +GDIN D  +  D+A+GAP E+D  GAVYIY G    I    SQ+I G+ ++ +L  +G SI G   D+D N YPD  VG+  S   V  R + ++ V A        + LP + + S   C    Q + CI + V
Sbjct:   28 LAYNLDVAGAAPIRGA---KGTFFGFS--VLQHAYENDTWVLIGAPQ--AQSGAERSGAVFKCHEDGAGGYSCSELPIDKRTGNVCGTLCRETRADQWLGVSLAREAGGGESKVMACAHRRANVNPDDIFPHGICFLIPPDLKPDAVTHTSPCSIGAVDAHDEMRQHASCQAGMAASSATQNFMVLGGPGSFNWAGTVMLHNV-------SSGFTHFSTPDTVVTKDSYLGYSVSAG-IFYNRTSLGVVAGAP---------RQDNVGKVYLLTLVEGELQITWQSSGKQLGSYFGSATCAVDLDADGLADLLVGAPQHSETRDEGRVHVFMN--AGQGNL--------VEQKSLLSGANAY-NAHFGQVIVALGDINDDRFEEPDVAIGAPHEDDLRGAVYIYNGGPSGISHSFSQRILGRSVNGELSMFGHSISGV-IDMDRNGYPDVTVGAFNSDAAVVFRAKAVVTVRAH-------VSLPSTVNASSSVCPGTHQPVTCIIIRV 493          
BLAST of Alpha-int-3 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 119.013 bits (297), Expect = 2.025e-27
Identity = 126/514 (24.51%), Postives = 223/514 (43.39%), Query Frame = 3
Query:  276 ALFSCPVTKETQDCKKFVFSEHSN-------ESLLGYVVDSNSHEGLIYTCAP-----KFLRSHTYVKYVEGACWEFNEMFN-EVEQISNQDCLESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL---------LINNNFYSRENSR------SSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKL--IENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF-----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTG 1706
             +++CP+T++  DC +  F +H +          +G  V S    G +  CA      KF+ +   ++   G C+   +    + +  S      +     ++Y  Y  C  G AA  + +   L   +P ++  +G          L+ +      +++       ++ +     NS ++   FS+ V          S+V G+P  +           G V++  +    NSL    ++ GE   S YGY+V   DLN DG  +L+VGAP+       +  G V+VY N   +    E K       KR+ L   +  +   +G+++  IGD++ D  QD+AVGAPFE   +G VYIY G    +I        Q+      G+G+S+ G   D+D N YPD +VGS LS  VV  R+R +I     +++ + D+ +     S+K C +  ++  C+++     Y+       P+Y+ + T+ Y +  +    +   S R++      T TG
Sbjct:   21 GIYACPITQQPGDCSRLTFDDHVDPKEESKENQWMGVTVRSQGPGGKVLACAHRYERRKFVGNSEEIRSPVGRCYVLGQALGLDQDDHSEGGGWHACSDRGESYALYGFCQQGTAAGFTRDYHYLYFGSPGAHYWRGATHLECHSSALVPHKLQEVGSAQRLGEQVGADAVVHVQHNSTFR---FSVDVANNVARRGEPSVVAGAPRAAH---------MGAVLLLAVNYSHNSLVPEVMLRGEGLASAYGYAVCLADLNGDGWMDLLVGAPYFFDQSKKSVGGAVYVYLND--NDGGGERK-------KRVRL---EGTAGSGFGLTIAAIGDVDLDGFQDVAVGAPFEE--SGRVYIYSGGPSGVITKP----AQVWHASQPGFGYSLSG-GLDVDGNLYPDLLVGS-LSDQVVLFRSRTVITADV-HLLTDGDIDM-----SVKNCEN--RQSTCVRVLACFSYW----ARPPTYSPAITLHYSLNAEEDRRQQGLSSRVHLTAIAGTETG 490          
BLAST of Alpha-int-3 vs. Ensembl Sea Lamprey
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 115.546 bits (288), Expect = 2.874e-26
Identity = 85/254 (33.46%), Postives = 132/254 (51.97%), Query Frame = 3
Query:  711 SNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFEN-DGTGAVYIYLGDSHQIIKL-SQKIEGQMISPDLRG-YGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVA 1463
            +N+   Y G+S+AVG+ F   +V+  V G P  S          FG V+I  L    +  +  + GE   S +GY+V   D+NNDG+D+L+VGAP       Q  +    E+ +  +  +  PL +     L+       G+YG ++  +GD+++D   D+AVG PF   DGTG V++Y G    ++ + SQ + G+  S  L   +GF++ G   DLDSN YPD IVG+      +  R RP++ V AE  V+
Sbjct:   27 ANNDDAYMGYSVAVGE-FTGDSVQEFVTGVPKGSS--------TFGYVLI--LNTTDMSTLMNVTGEQLASYFGYTVAVTDVNNDGLDDLLVGAPLYMERGSQGRLE---ELGRVYLYLQQAPLSLGAAQTLSGRDVY--GRYGSAITPVGDLDQDGYNDVAVGMPFGGEDGTGVVFVYNGRDTGLMAIPSQTLRGRWASQGLPASFGFALRG-GTDLDSNGYPDLIVGAFGVDKAIVYRARPVVTVSAELTVS 263          
BLAST of Alpha-int-3 vs. Ensembl Nematostella
Match: EDO48984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH6])

HSP 1 Score: 123.25 bits (308), Expect = 2.750e-28
Identity = 100/274 (36.50%), Postives = 147/274 (53.65%), Query Frame = 3
Query:  918 GSGYGYSVLAMDLNNDGMDELVVGAPF--TNN--NNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISP-----DLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQL-PYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSK-------TIDYEIELDMPFI---KTSSSKRLYF 1679
            GSG+G+SV  +D+N DG  ++V+GAPF  T N  N G+VFVY N   +      KT       R L  S+ +     +G ++ N+GD+++D  +D AVGAP+E +GTG VYI+ G    +   SQK  GQ+I P     DL+ +G SI GK  D+D N YPD ++G+  S  VV +R+RPII +        TD+ + P  F+S  K  S   +   I+ +V I     D+  C SY+  +       +ID  IE D+ +    +TS   R+ F
Sbjct:  323 GSGFGFSVAGVDVNGDGWTDVVIGAPFYSTKNSPNEGRVFVYTN---NGDGTFSKT-------RELAPSIAR-KGAYFGHAVANLGDLDQDGYEDFAVGAPYE-EGTGVVYIFNGSETGV---SQKA-GQLIKPTDINQDLKTFGSSIAGK-LDMDGNGYPDLLIGAYTSDSVVLLRSRPIIDI-------NTDVNITPNPFNSRNKTCSKTFKGKLIQ-TVCI-----DIEICLSYSERRNRTHDKLSIDLNIEADVEYTRNSRTSKQSRVVF 566          

HSP 2 Score: 58.9214 bits (141), Expect = 1.308e-8
Identity = 72/323 (22.29%), Postives = 139/323 (43.03%), Query Frame = 3
Query: 2349 HLRPIVLKIKVKMVANIDLKLLVTPDNYQYR-EDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLK-KVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFL---KYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVI--YAIIIAVSAGVILLATIVIILYKCNFFRRQ 3296
             L+  ++++ V +V+  DL+L  +    Q      + G S++  E++IG +++ T   +N   +  +  ++++I +P+E       T+G++LLYL+ +      +GN +     D  N +  ++K +      P   +   Q   + T  T V +       IK     +   +  E  + V +DC  G+ARC P+ C +   ++   E++     RIW  TLIE++    K   V +         V +   L     N +            V        PP   D +  + I +AV   ++ L  +++IL+K  FF+R+
Sbjct:  966 QLKDNLIELNVTIVSQADLELSGSFKQEQVSYGGEVKGESAMRVEDEIGNEVRHTYIAQNKGPD-FVPEAEVVIQWPFEA------TNGKHLLYLMDVE----ISGNAECTFAPDQPNLLGLIVKPKSS----PARNVTSRQSSSESTRTTRVRRAVEEETSIK-----TKRATADERGSSVKLDCETGTARCTPIRCLIKRFAK-GNEVSFVVRSRIWAATLIEDYYNTDKSSEVTVVSRASLRAAVTFVRELNKENNNAE------------VKTQFNPDFPPRKSDKLASWVIPVAVVGAILALVIVILILWKLGFFKRK 1255          
BLAST of Alpha-int-3 vs. Ensembl Nematostella
Match: EDO49372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG71])

HSP 1 Score: 107.071 bits (266), Expect = 2.176e-23
Identity = 139/590 (23.56%), Postives = 241/590 (40.85%), Query Frame = 3
Query:   51 MEFINFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAP-------FDILKDSNETTGALFSCPVTKETQ------DCKKFVFSEHSNESL---------LGYVVDSNSHEGLIYTCAPKFL-------RSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRN---CLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTG----FSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFT--NNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFEN-DGTGAVYIYLGDSHQI-IKLSQKIEG-QMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNT 1697
            M  +  I   L  V  +   +N+D++ P +  +   N  +FGF++ + +   +  K+ L+GAP       F      +E  G +F C   K +       D    ++ + + E +         LG  + S    G    CAP++        R     + V G C+   +    + +  +  C          Y Y     C  G +        L   A     GKG++    ++ R +S     +  R+S+ K  Y G    ++M  G+ F+    + ++  SP   + D  R ++    VV  + I+ S   + +      GS +G+S+ A+DLNNDG+ +L+VGAP    + + G+V+VY N                              NG   I++             + VGAP+   D  GAVYIY G    I  K  Q++    M  P L+ +G+S+ G   D+D N+YPD  VG+  S   V +R+RPI+ V  +  ++   + L  +  +L  C   G +  C+   V + Y +      P  +    +D+ + LD    +T   +R++F+ K  T
Sbjct:    1 MGAVKCILAVLLAVLHVVICFNVDISEPIVFRSQAKN-DYFGFTVALHSYGDD--KWLLVGAPLANQTAPFGSRFKIHERYGGVFKCRPRKNSACETIPIDTTDPLYQDFNGEQIDIEEKAGQWLGASLFSTGQNGKAVACAPRYTFRGNFINRPEKRPRNVIGRCFLIRDDLRGLHKRVSP-CYHGSNGRELMYGYGQDGMCQAGFSTVITNDDTLGFGAVGVGYGKGMI--GAYFDRSDS----TVFARSSDLKVGYFGDVFGYTMTAGR-FKRSGKEQLIGSSP---RADDIRGRVMAFDVVGDEQIKVSFT-LPLPPDNQPGSAFGFSMCAVDLNNDGLSDLLVGAPRYSYDKDEGRVYVYVN------------------------------NGLVSITIPKY----------VVVGAPYGGPDRRGAVYIYHGTKDGIDTKYRQRVTASDMNDPALKTFGYSLTG-GLDMDDNSYPDVAVGAYSSDRAVLLRSRPIVDVVGKIELSTNRIILESNQTNL--CTLQGNQHKCLTARVCLKYKH----KVP-VSQGVELDFSLALDQDR-RTIELRRMFFDPKNTT 526          
BLAST of Alpha-int-3 vs. Ensembl Nematostella
Match: EDO37905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED1])

HSP 1 Score: 50.447 bits (119), Expect = 4.517e-6
Identity = 41/110 (37.27%), Postives = 53/110 (48.18%), Query Frame = 3
Query: 1122 LSNGQYGISLENIGDINKDFIQDLAVGAPFENDG---------TGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNE-----------DLDSNTYPDFIVGS 1391
            + NG++G  L  + D+NKD I DLAV AP E  G         TGAVY+Y G       L + I    I PDL     +I GK +           D+DS+ Y D I+GS
Sbjct:  460 VPNGRFGYDLA-VSDLNKDGIDDLAVSAPSEGKGRLRADNLQYTGAVYVYYG------VLGKGIP---IKPDL-----TIIGKGQYYNLGTKLLGADIDSDGYRDLIIGS 554          
BLAST of Alpha-int-3 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 200.29 bits (508), Expect = 6.886e-52
Identity = 269/1109 (24.26%), Postives = 486/1109 (43.82%), Query Frame = 3
Query:  111 YNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFL-IGAPFDI---LKDSNETTGALFSCPVTKETQDCKK--FVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTA-------------PYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISP-DLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEI-TMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGC-SPGSCQPILTMQAVLSLPTEGE----------QYILHMGNVSKFKLEI---QTKNIATTDDNKAFRTYII---LTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLR--PIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTE-TDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYID-IPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
            +N+D   P IK       S FGFS+ +      S ++ L +GAP +    LKD NET GA+++CP++    DC +   V    S+E + G  +         ++     +  H Y K V G   E   M  +    SN   L++     Q   Y  C  G  ++S  +  L ++               Y+++G   +I  N    +NS  +N   F   +++  Y G+S+   +     +  ++V G+P   ++DS       G V++G++ +  +  + +I GE  GS +G S+ A DLNND  ++L+VGAPF     N   G V+++ N   S  N+  K              +K  +   +G ++  IGD+N+D  QD AVGAPF+   TG VYI++G    I  K SQ IEG+ +   + + +G+SI G   D+D N+YPD +VGS L   +  +R RP+I +  +N   E     P+  D     N      PCI  +V + +   +      +  S  +DY +E  +  ++    +R+YF++             ++  S S S+ ++ +I   +N+F    +  ++  + +S+N+S   + +     L +L ++PVL + +  +    IHF   C +   C   L ++A      E            QY  +M  +   K+++   ++      D ++   +  I   L Y   +   +  N +     + G++  + +PL A +    +   +     I+     I   + +  +S Q  L+   + + I+  ++ +   K L     +     +++G S++     +G  ++FT  ++ N Q    L + L + F W     P E  +G++LLYL ++    +  G  +  C+   L N  N+  +            ED   +K    T  P+    + ++  LPK          +   L+DC +G+A+CV   C L  +S+ + EI ++   R+W  T++E++     V +      W+      + ++     +K           VV    +  + P  L  ++ II AV AGV+LLA I+ IL+KC FF+R
Sbjct:   22 FNLDQRFPVIKEGETKG-SLFGFSVALHEQTVGSRQHLLLVGAPKEKANGLKDVNET-GAVYACPISTTFDDCSRMDLVTQPSSSEMVEGMWLGVTVASQKGHSAGRVLMCGHRYAKIVTGGTEEQRRMIGKCYVRSNDLTLDATDF-WQTDSYEVCNPGYDMESEGQCNLGISGGIGYTDVYLGAVGSYTWQGNVHVIWRN-PEPDNSWEANGKAFGELDNRNIYMGYSVLEEQKLLKQDQYTVVTGAP---RFDSR------GSVILGEMSQAKISLMQLIPGEQVGSYFGSSLAAADLNNDDWNDLIVGAPFYFERQNQIGGAVYIFMNENGSFQNVSTKV-------------LKGPAYSGFGFAVAAIGDVNQDGFQDFAVGAPFQE--TGRVYIWMGSKKGISDKYSQMIEGKSVGDGNFQSFGYSIDG-GMDMDGNSYPDMVVGS-LDDRIALIRARPVIHL-TKNFTVE-----PFIVDP----NQCTDAKPCISATVCMSFTLSNGN--KDFKKSIVVDYTMEAGVGELR----RRVYFQDD------------RSTFSGSLSLSSSKSICETLNVFVKTPVRDKLDAVHFSINMSLPEQTSKARRSLQNLDSFPVLSQDQKLIHKAEIHFQKECGTDNKCSSNLQLKAQFVDEKETPYPRRDGMQIFQYNRNMRIIIGLKVDVTNLKSPGKVAEDAHQTMLSVTIPNTLKYAGVRPPTYQCNAN---DANDGVLCEIGNPLKAEEM--TSLRLLFETSDIDLNTNLIECQLLLSTVSEQSDLKREAVGILIESTILPSFSAKALSVGTKFG---GTVMGESAMVNTSDVGSLVEFTFNVDMNEQLLGDLGT-LAVEFKW-----PFEVANGKWLLYLTKV----VVKGRSETECDAGGLVNSLNLSLSHSRPQRTKRQADEDDANEKFQSQTTEPQ---AASKLLTLPK----------KESYLLDCTQGTAKCVTFSCPLLNMSK-TAEIYVR--SRLWNSTMLEDYSNALTVTVKGQATLWLMAKKPTIKMETQTIEFK-----------VVIEPEEGVETPYELP-LWIIISAVVAGVLLLAIIIAILWKCGFFQR 1026          
BLAST of Alpha-int-3 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 196.052 bits (497), Expect = 1.664e-50
Identity = 268/1110 (24.14%), Postives = 484/1110 (43.60%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFL-IGAPFDI---LKDSNETTGALFSCPVTKETQDCKK--FVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTA-------------PYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPF----TNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII-KLSQKIEGQMISP-DLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEI-TMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNT-IHFGVGC-SPGSCQPILTMQAVLSLPTEGE----------QYILHMGNVSKFKLEI---QTKNIATTDDNKAFRTYII---LTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLR--PIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTE-TDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYID-IPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRR 3293
             +N+D   P IK       S FGFS+ +      S ++ L +GAP +    LKD NET GA+++CP++    DC +   V    S+E + G  +         ++     +  H Y K V G   E   M  +    SN   L++     Q   Y  C  G  ++S  +  L ++               Y+++G   +I  N    +NS  +N   F   +++  Y G+S+   +     +  ++V G+P   ++DS       G V++G++ +  +  + +I GE  GS +G S+ A DLNND  ++L+VGAPF     N   G V+++ N   S  N+  K              +K  +   +G ++  IGD+N+D  QD AVGAPF+   TG VYI++G    I  K SQ IEG+ +   + + +G+SI G   D+D N+YPD +VGS L   +  +R RP+I +  +N   E     P+  D     N      PCI  +V + +   +      +  S  +DY +E  +  ++    +R+YF++             ++  S S S+ ++ +I   +N+F    +  ++  + +S+N+S   + +     L +L ++PVL + +  +    IHF   C +   C   L ++A      E            QY  +M  +   K+++   ++      D ++   +  I   L Y   +   +  N +     + G++  + +PL A +    +   +     I+     I   + +  +S Q  L+   + + I+  ++ +   K L     +     +++G S++     +G  ++FT  ++ N Q    L + L + F W     P E  +G++LLYL ++    +  G  +  C+   L N  N+  +            ED   +K    T  P+    + ++  LPK              L+DC +G+A+CV   C L  +S+ + EI ++   R+W  T++E++     V +      W+      + ++     +K           VV    +  + P  L  ++ II AV AGV+LLA I+ IL+K  FF+R
Sbjct:   21 GFNLDQRFPVIKEGETKG-SLFGFSVALHEQTVGSRQHLLLVGAPKEKANGLKDVNET-GAVYACPISTTFDDCSRMDLVTQPSSSEMVEGMWLGVTVASQKGHSAGRVLMCGHRYAKIVTGGTEEQRRMIGKCYVRSNDLTLDATDF-WQTDSYEVCNPGYDMESEGQCNLGISGGIGYTDVYLGAVGSYTWQGNVHVIWRN-PEPDNSWEANGKAFGELDNRNIYMGYSVLEEQKLLKQDQYTVVTGAP---RFDSR------GSVILGEMSQAKISLMQLIPGEQVGSYFGSSLAAADLNNDDWNDLIVGAPFYFERQNQIGGAVYIFMNENGSFQNVSTKV-------------LKGPAYSGFGFAVAAIGDVNQDGFQDFAVGAPFQE--TGRVYIWMGSKKGISDKYSQMIEGKSVGDGNFQSFGYSIDG-GMDMDGNSYPDMVVGS-LDDRIALIRARPVIHL-TKNFTVE-----PFIVDP----NQCTDAKPCISATVCMSFTLSNGNK--DFKKSIVVDYTMEAGVGELR----RRVYFQDD------------RSTFSGSLSLSSSKSICETLNVFVKTPVRDKLDAVHFSINMSLPEQTSKARRSLQNLDSFPVLSQDQKLIHKAEIHFQKECGTDNKCSSNLQLKAQFVDEKETPYPRRDGMQIFQYNRNMRIIIGLKVDVTNLKSPGKVAEDAHQTMLSVTIPNTLKYAGVRPPTYQCNAN---DANDGVLCEIGNPLKAEEM--TSLRLLFETSDIDLNTNLIECQLLLSTVSEQSDLKREAVGILIESTILPSFSAKALSVGTKFG---GTVMGESAMVNTSDVGSLVEFTFNVDMNEQLLGDLGT-LAVEFKW-----PFEVANGKWLLYLTKV----VVKGRSETECDAGGLVNSLNLSLSHSRPQRTKRQADEDDANEKFQSQTTEPQ---AASKLLTLPKKES----------YLLDCTQGTAKCVTFSCPLLNMSK-TAEIYVR--SRLWNSTMLEDYSNALTVTVKGQATLWLMAKKPTIKMETQTIEFK-----------VVIEPEEGVETPYELP-LWIIISAVVAGVLLLAIIIAILWKLGFFKR 1026          
BLAST of Alpha-int-3 vs. Ensembl Medaka
Match: itga6b (integrin alpha-6 [Source:NCBI gene;Acc:101167322])

HSP 1 Score: 186.422 bits (472), Expect = 1.739e-47
Identity = 248/1053 (23.55%), Postives = 416/1053 (39.51%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIK-YFLIGAP--FDILKDSNETTGALFSCPVTKETQDCKKFVFS-------EHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE-----GACWEFNEMFNEVEQISNQD--CLESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL--LINNNF------------YSRENSRSSN-YLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNN--NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII--KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCP-SYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNI-SLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSP-GSCQPILTMQAVLSLPTEGEQY-----------ILHMGNVSKFKLEIQTKNIATTDDNKAFRTYII---LTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMS---------------PQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETD-GQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            ++N+D ++   K    +  S FGFSL +        K   L+GAP    +    ++ TG L+SC +   ++ C + +F        E      +G  V S    G I TCA ++ R +     +E     G C+  ++  + +   SN+D        S  + +E + +C  G +A    +    +  AP +Y  KG+  L   NF            Y   + +  N  L    +NS   Y GFS+  G+   N    ++V G+P  + +      +K G      L+E   EY   + GE   S +GY +  +DLN DG +++VVGAP  F  +    G +++Y N      N +  T           T +    +  +G+++EN+GDIN+D   D AVGAP++++G G VYIY G +  II  K  Q + GQ +   L  +G+S+ G N DLD NTYPD  VGS LS  V   R RP++ +  E   +   + L     + K C     +  C+ ++    Y     T  P SYA + T+ Y +E D    K     R  F           S    T + +      T  +    N+   +  +P+++    S+++ +  +R   S         PVL+ +K           GC     C+  L M     L T  E             ++ + N     LE+   N    D ++A  T I    LTY   ++           S+    +  V++   +R       +C L N F+ + +   YI  S   +S                ++    +  + KV ++  + L   V P    Y  + + G +++  E  IG  +     + N  +      +  L    W     P ET+ G++LLYL+ I    +       +  ++ LN   +  ++R              +  KV V   + +L +   EI                    + C  G A+CV + C LG L    G   + F  R+W  T +E++  +  V +
Sbjct:   20 AFNLDTDNVLRKDG--DPGSLFGFSLAMHRQLSPVDKTMLLVGAPRAAALSNQKSKVTGGLYSCDMASSSKSCTRIIFDNDEDVKKESKENQWMGVSVSSQGPGGKIVTCAHRYQRRNNVRTNLESRDIIGRCYVLSQDLS-IRADSNEDGGSWHFCDSRLRGHEMFGSCQQGLSATFDDDYHYFIFGAPGAYNWKGIVRLEQKNFSLVEMGIFDDGPYELGDEKQKNPNLVPAPANS---YLGFSLDSGRSLTNKGQLTVVAGAP-RANHSGAVVLLKKGLTTSNILLE---EYT--LEGEGLASSFGYDLAVLDLNKDGWEDIVVGAPQFFVKDGEIGGAIYIYIN---KNGNWDQVTP----------TRINGPKDSMFGLAVENLGDINQDGYHDFAVGAPYKDNGVGQVYIYCGSATGIISEKDPQVLSGQPLGVKL--FGYSLAG-NMDLDKNTYPDLAVGS-LSDSVFVYRARPVVNIKKEVTFSPNQINL-----ADKSCG----KAFCMDVTACFTY-----TANPKSYAPTLTVAYTLEADADLRKKGLKPRAIFTESSELDGNAQSTGTITMDKQGKEQCVTRKLAIQENIRDKLQGIPVDV----SVSIQDAKRRRRQSSTAKLT---PVLDEIKPTRATVEFLKEGCGQDNECESNLKMNYRFGLRTTTEDDFTELNQEDGLPVISLSNQKDIALEVTVTNQKGDDAHEASLTAIFPSSLTYSTYRV-----------SSQESPVTCVSNKEGSRA------DCELGNPFMRDAETKFYIFFSTAGISFNISEVEITLMLNTTSKQSKSTVKARAKVAIMLQLSLLGQVNPSQVHYTGE-IKGETAMITESDIGSGITHQFRVINLGKRLTDFGTATL-EIDW-----PKETEQGKWLLYLMNINSMGVDQIKCTPSAEINPLNKKPDTARSR-----------RAAESTKVDVKGTISRLIDTKKEI-------------------TLSCNNG-AKCVKIKCPLGGL---DGNAVITFSSRLWNTTFLEDYSDFHHVEV 964          
BLAST of Alpha-int-3 vs. Ensembl Medaka
Match: itga6b (integrin alpha-6 [Source:NCBI gene;Acc:101167322])

HSP 1 Score: 186.422 bits (472), Expect = 1.896e-47
Identity = 248/1053 (23.55%), Postives = 416/1053 (39.51%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIK-YFLIGAP--FDILKDSNETTGALFSCPVTKETQDCKKFVFS-------EHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE-----GACWEFNEMFNEVEQISNQD--CLESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL--LINNNF------------YSRENSRSSN-YLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNN--NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII--KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCP-SYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNI-SLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSP-GSCQPILTMQAVLSLPTEGEQY-----------ILHMGNVSKFKLEIQTKNIATTDDNKAFRTYII---LTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMS---------------PQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETD-GQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            ++N+D ++   K    +  S FGFSL +        K   L+GAP    +    ++ TG L+SC +   ++ C + +F        E      +G  V S    G I TCA ++ R +     +E     G C+  ++  + +   SN+D        S  + +E + +C  G +A    +    +  AP +Y  KG+  L   NF            Y   + +  N  L    +NS   Y GFS+  G+   N    ++V G+P  + +      +K G      L+E   EY   + GE   S +GY +  +DLN DG +++VVGAP  F  +    G +++Y N      N +  T           T +    +  +G+++EN+GDIN+D   D AVGAP++++G G VYIY G +  II  K  Q + GQ +   L  +G+S+ G N DLD NTYPD  VGS LS  V   R RP++ +  E   +   + L     + K C     +  C+ ++    Y     T  P SYA + T+ Y +E D    K     R  F           S    T + +      T  +    N+   +  +P+++    S+++ +  +R   S         PVL+ +K           GC     C+  L M     L T  E             ++ + N     LE+   N    D ++A  T I    LTY   ++           S+    +  V++   +R       +C L N F+ + +   YI  S   +S                ++    +  + KV ++  + L   V P    Y  + + G +++  E  IG  +     + N  +      +  L    W     P ET+ G++LLYL+ I    +       +  ++ LN   +  ++R              +  KV V   + +L +   EI                    + C  G A+CV + C LG L    G   + F  R+W  T +E++  +  V +
Sbjct:   20 AFNLDTDNVLRKDG--DPGSLFGFSLAMHRQLSPVDKTMLLVGAPRAAALSNQKSKVTGGLYSCDMASSSKSCTRIIFDNDEDVKKESKENQWMGVSVSSQGPGGKIVTCAHRYQRRNNVRTNLESRDIIGRCYVLSQDLS-IRADSNEDGGSWHFCDSRLRGHEMFGSCQQGLSATFDDDYHYFIFGAPGAYNWKGIVRLEQKNFSLVEMGIFDDGPYELGDEKQKNPNLVPAPANS---YLGFSLDSGRSLTNKGQLTVVAGAP-RANHSGAVVLLKKGLTTSNILLE---EYT--LEGEGLASSFGYDLAVLDLNKDGWEDIVVGAPQFFVKDGEIGGAIYIYIN---KNGNWDQVTP----------TRINGPKDSMFGLAVENLGDINQDGYHDFAVGAPYKDNGVGQVYIYCGSATGIISEKDPQVLSGQPLGVKL--FGYSLAG-NMDLDKNTYPDLAVGS-LSDSVFVYRARPVVNIKKEVTFSPNQINL-----ADKSCG----KAFCMDVTACFTY-----TANPKSYAPTLTVAYTLEADADLRKKGLKPRAIFTESSELDGNAQSTGTITMDKQGKEQCVTRKLAIQENIRDKLQGIPVDV----SVSIQDAKRRRRQSSTAKLT---PVLDEIKPTRATVEFLKEGCGQDNECESNLKMNYRFGLRTTTEDDFTELNQEDGLPVISLSNQKDIALEVTVTNQKGDDAHEASLTAIFPSSLTYSTYRV-----------SSQESPVTCVSNKEGSRA------DCELGNPFMRDAETKFYIFFSTAGISFNISEVEITLMLNTTSKQSKSTVKARAKVAIMLQLSLLGQVNPSQVHYTGE-IKGETAMITESDIGSGITHQFRVINLGKRLTDFGTATL-EIDW-----PKETEQGKWLLYLMNINSMGVDQIKCTPSAEINPLNKKPDTARSR-----------RAAESTKVDVKGTISRLIDTKKEI-------------------TLSCNNG-AKCVKIKCPLGGL---DGNAVITFSSRLWNTTFLEDYSDFHHVEV 964          
BLAST of Alpha-int-3 vs. Ensembl Medaka
Match: itga6b (integrin alpha-6 [Source:NCBI gene;Acc:101167322])

HSP 1 Score: 186.422 bits (472), Expect = 2.101e-47
Identity = 248/1053 (23.55%), Postives = 416/1053 (39.51%), Query Frame = 3
Query:  108 SYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIK-YFLIGAP--FDILKDSNETTGALFSCPVTKETQDCKKFVFS-------EHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVE-----GACWEFNEMFNEVEQISNQD--CLESIKSESQNYE-YRNCLTG-AALKSLERKQLVLTAPYSYEGKGL--LINNNF------------YSRENSRSSN-YLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAP--FTNNN--NGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQII--KLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCP-SYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNI-SLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSP-GSCQPILTMQAVLSLPTEGEQY-----------ILHMGNVSKFKLEIQTKNIATTDDNKAFRTYII---LTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMS---------------PQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETD-GQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYI 3047
            ++N+D ++   K    +  S FGFSL +        K   L+GAP    +    ++ TG L+SC +   ++ C + +F        E      +G  V S    G I TCA ++ R +     +E     G C+  ++  + +   SN+D        S  + +E + +C  G +A    +    +  AP +Y  KG+  L   NF            Y   + +  N  L    +NS   Y GFS+  G+   N    ++V G+P  + +      +K G      L+E   EY   + GE   S +GY +  +DLN DG +++VVGAP  F  +    G +++Y N      N +  T           T +    +  +G+++EN+GDIN+D   D AVGAP++++G G VYIY G +  II  K  Q + GQ +   L  +G+S+ G N DLD NTYPD  VGS LS  V   R RP++ +  E   +   + L     + K C     +  C+ ++    Y     T  P SYA + T+ Y +E D    K     R  F           S    T + +      T  +    N+   +  +P+++    S+++ +  +R   S         PVL+ +K           GC     C+  L M     L T  E             ++ + N     LE+   N    D ++A  T I    LTY   ++           S+    +  V++   +R       +C L N F+ + +   YI  S   +S                ++    +  + KV ++  + L   V P    Y  + + G +++  E  IG  +     + N  +      +  L    W     P ET+ G++LLYL+ I    +       +  ++ LN   +  ++R              +  KV V   + +L +   EI                    + C  G A+CV + C LG L    G   + F  R+W  T +E++  +  V +
Sbjct:   20 AFNLDTDNVLRKDG--DPGSLFGFSLAMHRQLSPVDKTMLLVGAPRAAALSNQKSKVTGGLYSCDMASSSKSCTRIIFDNDEDVKKESKENQWMGVSVSSQGPGGKIVTCAHRYQRRNNVRTNLESRDIIGRCYVLSQDLS-IRADSNEDGGSWHFCDSRLRGHEMFGSCQQGLSATFDDDYHYFIFGAPGAYNWKGIVRLEQKNFSLVEMGIFDDGPYELGDEKQKNPNLVPAPANS---YLGFSLDSGRSLTNKGQLTVVAGAP-RANHSGAVVLLKKGLTTSNILLE---EYT--LEGEGLASSFGYDLAVLDLNKDGWEDIVVGAPQFFVKDGEIGGAIYIYIN---KNGNWDQVTP----------TRINGPKDSMFGLAVENLGDINQDGYHDFAVGAPYKDNGVGQVYIYCGSATGIISEKDPQVLSGQPLGVKL--FGYSLAG-NMDLDKNTYPDLAVGS-LSDSVFVYRARPVVNIKKEVTFSPNQINL-----ADKSCG----KAFCMDVTACFTY-----TANPKSYAPTLTVAYTLEADADLRKKGLKPRAIFTESSELDGNAQSTGTITMDKQGKEQCVTRKLAIQENIRDKLQGIPVDV----SVSIQDAKRRRRQSSTAKLT---PVLDEIKPTRATVEFLKEGCGQDNECESNLKMNYRFGLRTTTEDDFTELNQEDGLPVISLSNQKDIALEVTVTNQKGDDAHEASLTAIFPSSLTYSTYRV-----------SSQESPVTCVSNKEGSRA------DCELGNPFMRDAETKFYIFFSTAGISFNISEVEITLMLNTTSKQSKSTVKARAKVAIMLQLSLLGQVNPSQVHYTGE-IKGETAMITESDIGSGITHQFRVINLGKRLTDFGTATL-EIDW-----PKETEQGKWLLYLMNINSMGVDQIKCTPSAEINPLNKKPDTARSR-----------RAAESTKVDVKGTISRLIDTKKEI-------------------TLSCNNG-AKCVKIKCPLGGL---DGNAVITFSSRLWNTTFLEDYSDFHHVEV 964          
BLAST of Alpha-int-3 vs. Planmine SMEST
Match: SMESG000034289.1 (SMESG000034289.1)

HSP 1 Score: 2170.97 bits (5624), Expect = 0.000e+0
Identity = 1074/1090 (98.53%), Postives = 1078/1090 (98.90%), Query Frame = 3
Query:   51 MEFINFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKRRWK 3320
            MEFINFIFLFLFHVP LYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVF+EHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFN+MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVA TDMQLPYSFDSLKKCNSNGQEMPCIKLSVSI+YYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRN LSDDLADLSNYPVLERVKNNLTN IHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKF+IALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYK        KVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKRRWK
Sbjct:    1 MEFINFIFLFLFHVPALYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVFTEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNDMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAATDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIHYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNFLSDDLADLSNYPVLERVKNNLTNKIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFSIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYK--------KVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKRRWK 1082          
BLAST of Alpha-int-3 vs. Planmine SMEST
Match: SMESG000034289.1 (SMESG000034289.1)

HSP 1 Score: 2134.38 bits (5529), Expect = 0.000e+0
Identity = 1060/1078 (98.33%), Postives = 1065/1078 (98.79%), Query Frame = 3
Query:   51 MEFINFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVFSEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNXXXXXXXXXXNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKCNF 3284
            MEFINFIFLFLFHVP LYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVF+EHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFN+MFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVA TDMQLPYSFDSLKKCNSNGQEMPCIKLSVSI+YYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRN LSDDLADLSNYPVLERVKNNLTN IHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKF+IALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYK        KVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYK +F
Sbjct:    1 MEFINFIFLFLFHVPALYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVFTEHSNESLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNDMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLINNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGSPGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLGDSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAATDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIHYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTVTGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSEVPKRNFLSDDLADLSNYPVLERVKNNLTNKIHFGVGCSPGSCQPILTMQAVLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAKKINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVKESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDSLLGFSSITGEEKIGPKMKFSIALENNVQNSVILSSKLLIYFPWEISGNPTETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPISKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDCFEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYIDIPVFWVPLVDYDVVLQVPGGNYK--------KVRVVAANLQKPKPPASLDVIYAIIIAVSAGVILLATIVIILYKVSF 1070          
BLAST of Alpha-int-3 vs. Planmine SMEST
Match: SMESG000022733.1 (SMESG000022733.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.221e-17
Identity = 151/580 (26.03%), Postives = 252/580 (43.45%), Query Frame = 3
Query:  117 IDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKD----SNETTGALFSCPVTKETQDCKKF-VFSEHSNESLLGYV--------VDSNSHEGLIYTCAPKFLRSHTY-VKYVE------GACWEFNEMFNEVEQISNQDCLESIKSESQNYEYRNCLTG----AALKSLERKQLVLTAPYSYEGKGLLINNNFYSREN------SRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKS-----IVLGSPGISQYDSTRTQIKFGQVVI--GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNN---------GQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAP-FENDGTGAVYIYLGDSH---QIIKLSQKIEGQMISPD------------LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIYYYYPDLTTCPSYASSKT------IDYEIELDMPFIK 1652
            + L+  Y+ SN     S+FG+S++ F  ++ +  Y L+GAP D + D     N  TG ++   ++    DC K  + SE S     GY            N   G+   C P+FL   +Y V   E      G C  +    + +  IS   C  S+  E        CL+G     +    E+ ++ L  P S+  +G +   NF             S + LK R  N  Y      +  G   R+P + S     +V  SP    + S   +   G V++   KL  + + Y+  + G + GS +G S+   D N D + +++VGAPF  ++          G +++++     Q + + K    +    L   +++    G++G+S+ N+GDI+ D I D AVG P   ND TG+VYIYLG S    Q+I+  + +   +++P              + +G+S+ GK  D+D N+ PD I+G   S  +V +R++ +I  + EN V      LP S  S++    N  + PC   S   Y            ++S+       ID + +L+ PF K
Sbjct:   34 VGLSKLYLHSNV---NSYFGYSISSFIGQKEA--YCLVGAPRDEIDDESTNGNVNTGGVYR--ISFVNNDCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTG--STIRDISFLAC--SVTDEGA------CLSGFSSSVSADDSEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSP---HWKSNEYR---GVVLVLDTKLDLSQILYIPDMSGHL-GSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFY----GQVSDKFKYTVSNQNDVLKGVNVR----GKFGMSIANLGDIDGDDIDDFAVGCPNCGNDATGSVYIYLGGSKVPVQVIR-PRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGK-FDIDGNSVPDLIIGDYSSSQIVVLRSKNLI--WLENPV----WLLPTS-KSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYK 572          
BLAST of Alpha-int-3 vs. Planmine SMEST
Match: SMESG000018926.1 (SMESG000018926.1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.024e-6
Identity = 59/201 (29.35%), Postives = 95/201 (47.26%), Query Frame = 3
Query:  921 SGYGYSVLAMDLNNDGMDELVVGAPFTN----NNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPF-ENDGT-GAVYIYLGDS--------HQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQL 1481
            S +G ++  + +       +V+GAPF +     N G+V+++       S+ ++++ P D      L   +K  +  +G  L NIGDIN D  QDLA+ +PF  ND   G V +Y  +         +QI+K SQK +   I      +G +I G   D+D N +PD IV S  S  +    +R   ++Y    +  TD  L
Sbjct:  296 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFC------SSNKNRSAPSD-----FLHGKEK--DEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK-SQKPKNAGI------FGIAITG-GSDMDFNGWPDIIVSSTRSNSIEMYASR---QLYTAKCIYSTDSNL 472          
BLAST of Alpha-int-3 vs. Planmine SMEST
Match: SMESG000018926.1 (SMESG000018926.1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.328e-6
Identity = 59/201 (29.35%), Postives = 95/201 (47.26%), Query Frame = 3
Query:  921 SGYGYSVLAMDLNNDGMDELVVGAPFTN----NNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPF-ENDGT-GAVYIYLGDS--------HQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAETDMQL 1481
            S +G ++  + +       +V+GAPF +     N G+V+++       S+ ++++ P D      L   +K  +  +G  L NIGDIN D  QDLA+ +PF  ND   G V +Y  +         +QI+K SQK +   I      +G +I G   D+D N +PD IV S  S  +    +R   ++Y    +  TD  L
Sbjct:  296 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFC------SSNKNRSAPSD-----FLHGKEK--DEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK-SQKPKNAGI------FGIAITG-GSDMDFNGWPDIIVSSTRSNSIEMYASR---QLYTAKCIYSTDSNL 472          
The following BLAST results are available for this feature:
BLAST of Alpha-int-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA32.671e-4324.37integrin subunit alpha 3 [Source:HGNC Symbol;Acc:H... [more]
ITGA33.007e-4324.37integrin subunit alpha 3 [Source:HGNC Symbol;Acc:H... [more]
ITGA76.928e-4229.06integrin subunit alpha 7 [Source:HGNC Symbol;Acc:H... [more]
ITGA73.090e-4029.42integrin subunit alpha 7 [Source:HGNC Symbol;Acc:H... [more]
ITGA77.198e-3929.36integrin subunit alpha 7 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ina-15.534e-3422.66Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot... [more]
pat-23.587e-2425.36Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mew2.821e-5223.38gene:FBgn0004456 transcript:FBtr0340190[more]
mew3.516e-5223.38gene:FBgn0004456 transcript:FBtr0073732[more]
mew7.135e-5123.33gene:FBgn0004456 transcript:FBtr0310647[more]
mew8.511e-4323.38gene:FBgn0004456 transcript:FBtr0073731[more]
mew1.108e-4223.54gene:FBgn0004456 transcript:FBtr0310648[more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga3a3.953e-4824.72integrin, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-09080... [more]
itga42.666e-4727.71integrin alpha 4 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
itga41.456e-4627.71integrin alpha 4 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
itga41.456e-4627.71integrin alpha 4 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
itga6a3.533e-4224.00integrin, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-05030... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA36.018e-4424.32integrin subunit alpha 3 [Source:NCBI gene;Acc:100... [more]
ITGA31.849e-4224.00integrin subunit alpha 3 [Source:NCBI gene;Acc:100... [more]
ITGA43.934e-4226.76integrin subunit alpha 4 [Source:NCBI gene;Acc:100... [more]
ITGA44.115e-4227.18integrin subunit alpha 4 [Source:NCBI gene;Acc:100... [more]
ITGA44.202e-4227.18integrin subunit alpha 4 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Itga32.631e-5424.21integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602][more]
Itga33.713e-5424.21integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602][more]
Itga37.821e-5024.18integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602][more]
Itga42.873e-4227.45integrin alpha 4 [Source:MGI Symbol;Acc:MGI:96603][more]
Itga63.431e-4225.26integrin alpha 6 [Source:MGI Symbol;Acc:MGI:96605][more]
back to top
BLAST of Alpha-int-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17852|ITA3_CRIGR1.225e-5424.45Integrin alpha-3 OS=Cricetulus griseus OX=10029 GN... [more]
sp|Q62470|ITA3_MOUSE2.597e-5324.21Integrin alpha-3 OS=Mus musculus OX=10090 GN=Itga3... [more]
sp|Q24247|ITA1_DROME3.524e-5123.38Integrin alpha-PS1 OS=Drosophila melanogaster OX=7... [more]
sp|F1MMS9|ITA3_BOVIN8.357e-4824.16Integrin alpha-3 OS=Bos taurus OX=9913 GN=ITGA3 PE... [more]
sp|P26006|ITA3_HUMAN1.444e-4224.37Integrin alpha-3 OS=Homo sapiens OX=9606 GN=ITGA3 ... [more]
back to top
BLAST of Alpha-int-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1P8CUU30.000e+097.79Alpha-int-3 OS=Schmidtea mediterranea OX=79327 PE=... [more]
A0A068YDF91.166e-6324.46Integrin alpha ps OS=Echinococcus multilocularis O... [more]
A0A068WCN41.009e-6024.52Integrin alpha ps OS=Echinococcus granulosus OX=62... [more]
A0A1S3R6S02.095e-5925.40integrin alpha-3-like isoform X3 OS=Salmo salar OX... [more]
A0A1S3R7F93.342e-5925.35integrin alpha-3-like isoform X1 OS=Salmo salar OX... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga6a1.410e-4824.74integrin subunit alpha 6 [Source:NCBI gene;Acc:103... [more]
itga6a1.410e-4824.74integrin subunit alpha 6 [Source:NCBI gene;Acc:103... [more]
itga3b4.183e-4625.42integrin alpha-3-like [Source:NCBI gene;Acc:103040... [more]
itga6a3.044e-4027.81integrin subunit alpha 6 [Source:NCBI gene;Acc:103... [more]
itga6b1.972e-3923.65integrin alpha-6-like [Source:NCBI gene;Acc:103030... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA61.900e-4823.60integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000001557.12.147e-3629.77pep scaffold:Pmarinus_7.0:GL480593:314407:372761:-... [more]
ENSPMAT00000005763.12.274e-3426.92pep scaffold:Pmarinus_7.0:GL478250:6840:43285:-1 g... [more]
ITGA62.025e-2724.51integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
itga82.874e-2633.46integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-int-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO489842.750e-2836.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493722.176e-2323.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379054.517e-637.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-int-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga3b6.886e-5224.26integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga3b1.664e-5024.14integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga6b1.739e-4723.55integrin alpha-6 [Source:NCBI gene;Acc:101167322][more]
itga6b1.896e-4723.55integrin alpha-6 [Source:NCBI gene;Acc:101167322][more]
itga6b2.101e-4723.55integrin alpha-6 [Source:NCBI gene;Acc:101167322][more]
back to top
BLAST of Alpha-int-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034289.10.000e+098.53SMESG000034289.1[more]
SMESG000034289.10.000e+098.33SMESG000034289.1[more]
SMESG000022733.11.221e-1726.03SMESG000022733.1[more]
SMESG000018926.12.024e-629.35SMESG000018926.1[more]
SMESG000018926.12.328e-629.35SMESG000018926.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032970 ID=SMED30032970|Name=Alpha-int-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3827bp
GTTTTTTTTTCAAAAAATTTTTCTTATGATTTCCTAACGATTTAAAATTT
ATGGAGTTTATTAATTTTATTTTTTTATTTCTTTTCCATGTGCCTGTATT
ATATTTTTCCTACAACATCGACCTTAATTCGCCTTACATTAAATCAAATT
TTATAAATAACAAAAGCTTCTTCGGATTTTCGTTAAATATTTTTACTTCA
AAACAAAACAGTATCAAGTACTTTTTGATCGGAGCTCCGTTTGACATTTT
AAAAGACTCTAATGAAACAACTGGAGCCTTATTTTCATGTCCTGTAACAA
AAGAAACTCAAGATTGCAAAAAGTTTGTATTCAGCGAGCACTCGAATGAA
TCGCTATTGGGTTACGTAGTCGACTCAAATAGCCATGAGGGACTGATTTA
TACTTGTGCTCCAAAATTTTTGCGGTCTCACACCTATGTAAAGTATGTTG
AAGGCGCATGTTGGGAATTCAATGAGATGTTCAATGAAGTCGAACAAATT
TCAAATCAAGACTGCCTTGAATCAATTAAGTCTGAATCACAAAATTACGA
ATACCGTAATTGTTTGACAGGTGCAGCGTTGAAAAGCCTCGAACGAAAAC
AACTTGTTCTGACGGCTCCTTATTCGTATGAAGGAAAAGGCCTTCTCATC
AATAACAATTTTTACTCACGTGAAAATTCAAGATCTTCAAATTATTTAAA
ATTTCGAAATTCCAATTCAAAATATCAATATACAGGATTTTCAATGGCTG
TTGGGAAAATTTTCCGCAATCCAAATGTCAAATCAATTGTGTTAGGATCG
CCAGGAATATCACAATATGATTCAACAAGAACTCAAATCAAATTTGGCCA
AGTTGTAATTGGAAAATTAATTGAGAACTCATTGGAATATGTGGGAGTTA
TATTCGGTGAAGTATTTGGCAGCGGATACGGATATTCAGTGCTAGCGATG
GATTTAAACAATGACGGAATGGACGAATTGGTTGTTGGAGCTCCGTTTAC
TAATAACAATAATGGCCAAGTGTTCGTTTATTGGAACATTGAAATGAGCC
AGTCTAACATTGAACATAAAACTATTCCATTGGACGTAGAAAAACGGCTG
TTACTCACTAGTATGAAAAAATTAAGTAATGGACAATATGGCATCAGTTT
GGAAAATATTGGGGACATTAATAAAGATTTCATTCAAGATTTAGCTGTTG
GTGCGCCCTTTGAAAATGATGGAACCGGAGCAGTTTATATATATCTTGGA
GATAGCCATCAAATTATAAAATTATCTCAGAAAATAGAAGGCCAGATGAT
CTCTCCTGATCTTCGAGGATATGGGTTTTCTATATTTGGTAAAAATGAAG
ATCTCGACTCGAATACATATCCAGATTTCATAGTAGGATCTGTGTTAAGT
GGGCATGTGGTTGGAATGCGAACGCGACCTATAATTAGAGTATATGCAGA
AAATATGGTGGCTGAAACTGACATGCAACTGCCGTATAGTTTTGATAGTT
TGAAAAAATGTAACTCGAATGGACAAGAAATGCCTTGTATTAAATTAAGT
GTATCAATATATTACTATTATCCCGACCTGACAACCTGTCCTTCTTATGC
GAGCTCAAAAACAATAGATTATGAAATTGAACTTGATATGCCTTTTATCA
AGACATCTTCCAGCAAAAGGCTTTATTTTGAAAACAAATTAAACACAGTG
ACAGGCGGGGGATCTATAAATTGCAAAACACCGAATTCGAAGTCAAATTC
AATTATAAACACTTTCAATATTCTTTTTCCGGTCAATTTATTTTTCAACA
TTTCTCTTCCCATTGAAATTACTATGAAATGGTCGCTAAATGTGTCTGAA
GTTCCTAAACGTAATTTGCTAAGCGATGATCTGGCAGATCTATCGAATTA
TCCGGTTTTGGAAAGAGTTAAAAATAATTTGACCAACACAATCCATTTCG
GGGTTGGATGTTCTCCTGGAAGCTGCCAACCAATTCTAACGATGCAAGCA
GTTTTGTCACTACCAACAGAAGGGGAACAATACATTCTTCATATGGGGAA
TGTGTCAAAATTTAAGCTCGAAATTCAAACGAAAAATATAGCCACAACAG
ATGATAATAAAGCATTCAGAACTTATATAATATTGACTTATGATGCCAAA
AAGATTAATTTATTTTCAAATAATCCGGACAGAAAAACCTCGACATCATC
AGGTCTGATTTATGCAGTAAATAGCCCATTAAATGCCCGACAGTCTGACA
ACGCCACTTTTGAATGTATGTTACCGAATGACTTCATCGAGAACGTTAAG
GAGTCCATTTATATTAACATTTCTATAGAAGCTATGTCTCCACAACGTCA
TTTGAGACCCATTGTATTGAAAATAAAAGTAAAAATGGTCGCCAATATTG
ATTTAAAATTACTAGTGACACCTGACAATTATCAATATCGTGAAGATTCA
TTACTGGGGTTTTCTTCAATAACAGGTGAAGAAAAGATAGGTCCGAAAAT
GAAATTTACCATAGCTTTGGAAAACAATGTTCAAAATAGCGTTATATTAT
CGTCAAAGCTTTTGATATATTTCCCTTGGGAGATATCAGGGAATCCAACT
GAGACTGATGGGCAATACTTATTATATTTATTACGAATTCCGAAATTCAG
TATTACCACTGGCAATAAAAAGATTGCCTGTAATGTCGATATTTTAAATA
ATATTACAAATGTAATTAAGACTAGAATTTATCAAGATATTATTCCCATT
TCAAAACTTGAAGATGTCCAGTTGAAAAAAGTAACAGTACCGACAAACGT
TCCAAAACTACCAAATATTAGTGACGAAATAAAGTTCCTTCCTAAAGATT
CCGATTCTGGCAGTATATCAGAATGGGAAAACATTGTTCTAATTGATTGT
TTTGAAGGAAGTGCTAGATGTGTTCCAGTAGTGTGCGATCTTGGCCCACT
TTCCAGGCAAAGCGGTGAAATCACTTTGCAGTTCGACATTAGAATTTGGA
TTCATACCCTGATTGAGAATTTTCTCAAATACAAATTTGTTTACATCGAT
ATTCCGGTTTTCTGGGTGCCTTTGGTAGATTATGACGTTGTGCTGCAAGT
TCCTGGAGGAAACTATAAAAAACTTCCAGATATTGTAAGCCATAAGGTTC
GCGTAGTTGCTGCCAATCTTCAAAAACCGAAACCTCCAGCTTCATTAGAC
GTGATCTATGCTATTATCATAGCCGTTTCAGCTGGGGTTATATTGTTAGC
AACCATTGTAATTATTTTGTATAAGTGTAATTTTTTTCGGCGACAAAATG
TTGGGAAACGACGGTGGAAATGAGTTACTCAGTGAGGAAATTTGAAATCG
AATTTCAGGAAAATTTCCCACCAGATATATTTAATTTATTTCATGCTCAA
TAATGTTAGTTAGCTCAAATATATATTATATATGCCGTATGTTCTATAAT
GATGAATCCTAACGGAGTCCTAGTCCAACTGTTGCTATGATTACTAGCTT
GTTTTGAATGACTTTTACTGTGTTTTATGGAATAAAATCTGAATTTTTTG
GTATGTCATAAATGGAGTATCACTTTCAGTTGAGTGTTTTCTAAATATTT
TTTTGGTTGAACCAAACTGAAACATGCTCAGTATTCATTTCAAAATATTA
CATTGTATTGTAGCCAAGGAGCTCTAAATATTTGCATTTAGAAATAATAT
ATAACAAATTCACTAAACATTTTAAGCGTTATTTTATTTCAGTTCGTTTA
TGCGCCAAAAGTGACCGTTTTATGTACAGCCCACGCTGTCGTATTATATA
ATTATTTCCTAGTTGTGTTATATTCCT
back to top

protein sequence of SMED30032970-orf-1

>SMED30032970-orf-1 ID=SMED30032970-orf-1|Name=SMED30032970-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1091bp
MEFINFIFLFLFHVPVLYFSYNIDLNSPYIKSNFINNKSFFGFSLNIFTS
KQNSIKYFLIGAPFDILKDSNETTGALFSCPVTKETQDCKKFVFSEHSNE
SLLGYVVDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNEMFNEVEQI
SNQDCLESIKSESQNYEYRNCLTGAALKSLERKQLVLTAPYSYEGKGLLI
NNNFYSRENSRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKSIVLGS
PGISQYDSTRTQIKFGQVVIGKLIENSLEYVGVIFGEVFGSGYGYSVLAM
DLNNDGMDELVVGAPFTNNNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRL
LLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPFENDGTGAVYIYLG
DSHQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLS
GHVVGMRTRPIIRVYAENMVAETDMQLPYSFDSLKKCNSNGQEMPCIKLS
VSIYYYYPDLTTCPSYASSKTIDYEIELDMPFIKTSSSKRLYFENKLNTV
TGGGSINCKTPNSKSNSIINTFNILFPVNLFFNISLPIEITMKWSLNVSE
VPKRNLLSDDLADLSNYPVLERVKNNLTNTIHFGVGCSPGSCQPILTMQA
VLSLPTEGEQYILHMGNVSKFKLEIQTKNIATTDDNKAFRTYIILTYDAK
KINLFSNNPDRKTSTSSGLIYAVNSPLNARQSDNATFECMLPNDFIENVK
ESIYINISIEAMSPQRHLRPIVLKIKVKMVANIDLKLLVTPDNYQYREDS
LLGFSSITGEEKIGPKMKFTIALENNVQNSVILSSKLLIYFPWEISGNPT
ETDGQYLLYLLRIPKFSITTGNKKIACNVDILNNITNVIKTRIYQDIIPI
SKLEDVQLKKVTVPTNVPKLPNISDEIKFLPKDSDSGSISEWENIVLIDC
FEGSARCVPVVCDLGPLSRQSGEITLQFDIRIWIHTLIENFLKYKFVYID
IPVFWVPLVDYDVVLQVPGGNYKKLPDIVSHKVRVVAANLQKPKPPASLD
VIYAIIIAVSAGVILLATIVIILYKCNFFRRQNVGKRRWK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR028994Integrin_alpha_N
IPR000413Integrin_alpha
IPR013519Int_alpha_beta-p
IPR013649Integrin_alpha-2
IPR013517FG-GAP
IPR032695Integrin_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0008305integrin complex
GO:0071944cell periphery
GO:0097060synaptic membrane
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0030054cell junction
GO:0030426growth cone
GO:0031527filopodium membrane
GO:0034667integrin alpha3-beta1 complex
GO:0042995cell projection
GO:0043235receptor complex
GO:0045202synapse
GO:0048471perinuclear region of cytoplasm
GO:0060076excitatory synapse
GO:0070062extracellular exosome
GO:0071438invadopodium membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0072006nephron development
GO:0090004positive regulation of establishment of protein localization to plasma membrane
GO:0097062dendritic spine maintenance
GO:0097205renal filtration
GO:0001764neuron migration
GO:0007229integrin-mediated signaling pathway
GO:0007507heart development
GO:0007613memory
GO:0010628positive regulation of gene expression
GO:0010634positive regulation of epithelial cell migration
GO:0010811positive regulation of cell-substrate adhesion
GO:0010976positive regulation of neuron projection development
GO:0017015regulation of transforming growth factor beta receptor signaling pathway
GO:0030111regulation of Wnt signaling pathway
GO:0030324lung development
GO:0030510regulation of BMP signaling pathway
GO:0031345negative regulation of cell projection organization
GO:0034698response to gonadotropin
GO:0035024negative regulation of Rho protein signal transduction
GO:0035640exploration behavior
GO:0042493response to drug
GO:0043588skin development
GO:0044708single-organism behavior
GO:0048333mesodermal cell differentiation
GO:0060135maternal process involved in female pregnancy
Vocabulary: molecular function
TermDefinition
GO:0001948glycoprotein binding
GO:0001968fibronectin binding
GO:0002020protease binding
GO:0005178integrin binding
GO:0005515protein binding
GO:0005518collagen binding
GO:0019904protein domain specific binding
GO:0043236laminin binding
GO:0046982protein heterodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000413Integrin alpha chainPRINTSPR01185INTEGRINAcoord: 225..237
score: 35.83
coord: 425..446
score: 33.81
coord: 583..596
score: 29.09
coord: 286..306
score: 48.55
coord: 362..386
score: 46.24
coord: 1062..1081
score: 48.05
coord: 452..471
score: 28.66
IPR013519Integrin alpha beta-propellorSMARTSM00191int_alpha_rptcoord: 359..413
e-value: 9.1E-10
score: 48.5
coord: 224..285
e-value: 45.0
score: 6.4
coord: 289..343
e-value: 1.8E-5
score: 34.2
coord: 37..96
e-value: 6.0E-4
score: 29.1
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 214..274
score: 5.591
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 279..336
score: 10.464
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 349..407
score: 10.119
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 410..473
score: 8.707
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 26..89
score: 6.767
IPR028994Integrin alpha, N-terminalGENE3DG3DSA:2.130.10.130coord: 21..461
e-value: 4.2E-89
score: 301.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.1460coord: 471..642
e-value: 3.1E-5
score: 26.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.1530coord: 780..1004
e-value: 1.5E-19
score: 72.5
NoneNo IPR availableGENE3DG3DSA:1.20.5.930coord: 1050..1088
e-value: 3.0E-7
score: 31.6
NoneNo IPR availablePANTHERPTHR23220INTEGRIN ALPHAcoord: 18..1086
NoneNo IPR availablePANTHERPTHR23220:SF122INTEGRIN ALPHA-PS1coord: 18..1086
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.617
NoneNo IPR availableSUPERFAMILYSSF69318Integrin alpha N-terminal domaincoord: 21..460
NoneNo IPR availableTMHMMTMhelixcoord: 1051..1073
IPR013517FG-GAP repeatPFAMPF01839FG-GAPcoord: 294..327
e-value: 5.3E-7
score: 29.6
coord: 371..398
e-value: 3.5E-5
score: 23.8
IPR013649Integrin alpha-2PFAMPF08441Integrin_alpha2coord: 458..962
e-value: 7.0E-29
score: 101.0
IPR032695Integrin domain superfamilySUPERFAMILYSSF69179Integrin domainscoord: 781..1012