Diacylglycerol kinase

Overview
NameDiacylglycerol kinase
Smed IDSMED30032957
Length (bp)3674
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Diacylglycerol kinase (SMED30032957) t-SNE clustered cells

Violin plots show distribution of expression levels for Diacylglycerol kinase (SMED30032957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Diacylglycerol kinase (SMED30032957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Diacylglycerol kinase (SMED30032957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032957SMESG000023623.1 SmedASXL_012958SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032957SMESG000023623.1 Contig43533newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032957SMESG000023623.1 Contig43533uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30032957SMESG000023623.1 SMESG000017153.1 dd_Smed_v6_7792_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKQ (diacylglycerol kinase theta [Source:HGNC Symbol;Acc:HGNC:2856])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 351/906 (38.74%), Postives = 521/906 (57.51%), Query Frame = 2
Query:  407 PAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKD--------GRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPW-DIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADS 3097
            PA    H+F K +  +P +CH CS+ +WGL   GF+C+VCNF+ HEKCL  V   CT++A + V  P++HC+   G  KRKFC VCRK L+  PA+ CE+CE H H +C  +  ++C++      +    +    HHW EGNLP  ++C +C K C SS+ +AG RCEWCG  +H++C   +  EC FG L++++LPP+ V +      +      ++   +   +E     D  + S       + Q   E  +   K+FDG+ +++R  +R    ++   ++ V+E  L+A HI        +C +            G+          +S  + ++     ++R     +E    LKIYPG L    +V   Y  V +  K+T++ V++  +     ++ +  +FQLVEV +     +R +  DE P  D +Q +R+ S+R +  TRFY+    D   P V++FVG L   L+   Y  +L E         S+  IY   G +VL   C  +AE  Y +LKD  ++ R L  ++LP ++   +P D  PLLVFVN KSGG +G  L+ +FRKLLNPHQVF+L  GGPLPGL+ F QV  +++LVCGGDGTVGW L  L+ T    AC  P +A+LPLGTGNDL RVLRWG GY SGE P  +L  V  A+ + +DRWT+++     D  EA  A   E +T   + +   ++ M+NY G+G+DA+L+LDFH AR E P KF SR+HNK VY+++GL+K+ +    + LHKQI L+ +   ++LP IEGLI +NI SWG GA+ WG + D +F KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL    PVQVDGEP++Q+PG + +  +  +  ML+K K   RR   +
Sbjct:   55 PAAAPGHSFRKVTLTKPTFCHLCSDFIWGL--AGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLE-APALHCEVCELHLHPDCVPFACSDCRQ---CHQDGHQDHDTHHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRL------LPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAWAGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEV---LKIYPGWL----KVGVAYVSVRVTPKSTARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVRQVSQTRFYVAESRD-VAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGY-SGEDPFSVLLSVDEADAVLMDRWTILL-----DAHEAGSA---ENDT--ADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHS---RSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKVHMLRKAKQKPRRAGTT 926          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKQ (diacylglycerol kinase theta [Source:HGNC Symbol;Acc:HGNC:2856])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 348/906 (38.41%), Postives = 516/906 (56.95%), Query Frame = 2
Query:  407 PAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKD--------GRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPW-DIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADS 3097
            PA    H+F K +  +P +CH CS+ +WGL   GF+C+VCNF+ HEKCL  V   CT++A + V  P++HC+   G  KRKFC VCRK L+  PA+ CE+CE H H +C  +  ++C++           +    HHW EGNLP  ++C +C K C SS+ +AG RCEWCG  +H++C   +  EC FG L++++LPP+ V +      +      ++   +   +E     D  + S       + Q   E  +   K+FDG+ +++R  +R    ++   ++ V+E  L+A HI        +C +            G+          +S  + ++     ++R     +E    LKIYPG L    +V   Y  V +  K+T++ V++  +     ++ +  +FQLVEV +     +R +  DE P  D +Q +R+ S+R +  TRFY+    D   P V++FVG L   L+   Y  +L E                  G +VL   C  +AE  Y +LKD  ++ R L  ++LP ++   +P D  PLLVFVN KSGG +G  L+ +FRKLLNPHQVF+L  GGPLPGL+ F QV  +++LVCGGDGTVGW L  L+ T    AC  P +A+LPLGTGNDL RVLRWG GY SGE P  +L  V  A+ + +DRWT+++     D  EA  A   E +T   + +   ++ M+NY G+G+DA+L+LDFH AR E P KF SR+HNK VY+++GL+K+ +    + LHKQI L+ +   ++LP IEGLI +NI SWG GA+ WG + D +F KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL    PVQVDGEP++Q+PG + +  +  +  ML+K K   RR   +
Sbjct:    2 PAAAPGHSFRKVTLTKPTFCHLCSDFIWGL--AGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLE-APALHCEVCELHLHPDCVPFACSDCRQCHQDG---HQDHDTHHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRL------LPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAWAGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEV---LKIYPGWL----KVGVAYVSVRVTPKSTARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVRQVSQTRFYVAESRD-VAPHVSLFVGGLPPGLSPEEYSSLLHEAGATK-------------GAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGY-SGEDPFSVLLSVDEADAVLMDRWTILL-----DAHEAGSA---ENDT--ADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHS---RSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKVHMLRKAKQKPRRAGTT 860          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKG (diacylglycerol kinase gamma [Source:HGNC Symbol;Acc:HGNC:2853])

HSP 1 Score: 274.633 bits (701), Expect = 8.411e-78
Identity = 163/377 (43.24%), Postives = 209/377 (55.44%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDD-----------------KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML----KKTKLGKRRKADSSN 3103
            LV VN KSGG QG +++  F  LLNP QVFNL+ GGP PGL  FR   ++++L CGGDGTVGW L C+D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILKD+  +  + LDRW L V   +          ++E      N D     IMNNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH  I LE DG  +DL  I  EG+ ILNI S  GG N WG  K +                 KF      D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+QVDGEP++Q   TI +       +M+    K +    RRK+ S +
Sbjct:  397 LVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFRDTPDFRVLACGGDGTVGWILDCIDKAN---FAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL-TKILKDIEQSPLVMLDRWHLEVIPRE----------EVE------NGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSE-TFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD 752          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKG (diacylglycerol kinase gamma [Source:HGNC Symbol;Acc:HGNC:2853])

HSP 1 Score: 273.863 bits (699), Expect = 3.231e-77
Identity = 163/377 (43.24%), Postives = 209/377 (55.44%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDD-----------------KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML----KKTKLGKRRKADSSN 3103
            LV VN KSGG QG +++  F  LLNP QVFNL+ GGP PGL  FR   ++++L CGGDGTVGW L C+D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILKD+  +  + LDRW L V   +          ++E      N D     IMNNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH  I LE DG  +DL  I  EG+ ILNI S  GG N WG  K +                 KF      D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+QVDGEP++Q   TI +       +M+    K +    RRK+ S +
Sbjct:  436 LVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFRDTPDFRVLACGGDGTVGWILDCIDKAN---FAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL-TKILKDIEQSPLVMLDRWHLEVIPRE----------EVE------NGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSE-TFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD 791          

HSP 2 Score: 53.9138 bits (128), Expect = 2.017e-6
Identity = 30/109 (27.52%), Postives = 47/109 (43.12%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTA--VARPLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQ 736
            H +  K F +P YC+ C  ++ G+   G  C  C + VHE+C+S+    C    S A      + H W E  +  +  C+ C K +       A  C  C    H +C+
Sbjct:  272 HAWTMKHFKKPTYCNFCHIMLMGVRKQGLCCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVK--CDRCHKSIKCYQSVTARHCVWCRMTFHRKCE 378          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKB (diacylglycerol kinase beta [Source:HGNC Symbol;Acc:HGNC:2850])

HSP 1 Score: 273.863 bits (699), Expect = 3.539e-77
Identity = 153/354 (43.22%), Postives = 204/354 (57.63%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPE-----------------------KDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            LVFVN KSGG QG ++   F+ LLNP QV++L   GP+PGL  FR V ++++L CGGDGTVGW L C++          PP+A+LPLGTGNDLAR LRWGGGY  GE  ++ILKD+  + E+ LDRW   V  +D D+                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH+ + +E DG  IDL  I  EG+ ILNI S  GG+N WG                         K+ KF      D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+Q+DGEP++Q+P TI +
Sbjct:  432 LVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVLDCIEKAN---VGKHPPVAILPLGTGNDLARCLRWGGGY-EGENLMKILKDIENSTEIMLDRWKFEVIPNDKDE----------------KGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSE-TFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKI 764          

HSP 2 Score: 70.8626 bits (172), Expect = 1.210e-11
Identity = 51/183 (27.87%), Postives = 76/183 (41.53%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKL--DDNPAIRCEICEYHSHIECQDYVVNNC-KEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQN 1153
            H W      K  +CN+C   L       + C  C+Y  H  C      +C K       N  +++    H+W+EGN P  +KC  C+K     + + G  C WC    H  C   +  EC  GPLK+ ILPP+++C     +      GVS     +ST +       +    IDK  ++  N
Sbjct:  238 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKRNTDVMH----HYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCGPLKDHILPPTTICPVVLTLPTS---GVSVPEERQSTVKKEKSGSQQPNKVIDKNKMQRAN 411          

HSP 3 Score: 52.7582 bits (125), Expect = 4.309e-6
Identity = 33/119 (27.73%), Postives = 54/119 (45.38%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F++PAYC+ C  ++ G+   G  C  C + VHE+C+++    C  T + S      + H W E G    K C+ C K +        + C  C+   H +C  ++   C  G
Sbjct:  238 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKRNTDVMHHYWVE-GNCPTK-CDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCG 354          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 413/901 (45.84%), Postives = 585/901 (64.93%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHE-DYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNK-WTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETN--TLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDD-KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNT 3106
            H H F+KK+F +PAYCHHC + +WG++T G+ CE+CNF+ HEKCL  V + C+++A   +  P++H W+ P   KRK+C VCRK+ DD  ++ CE+CEY+ H++C D  V++CKE A Y  N+   N  Q+HH  EGNLP  SKCI+C K C+S+EC+AG RCEWCG  +H +C++Q+  EC FG L+ I+LPP  + IPRT++ ME ++ +S     +S S       S  +   D  S   ++ KE+ + +  +VFDGN S + ++ R     K +S Q V +  L+ FHI    + Y + ++   +  E  L+D    ++    + KR  I +R+ +     + ++K+Y G   +  +V   +  + ++K T  ++++  A+  F  +    N + L+EV LDR V ER     E    +++ LRKDS+R   + RFY++  EDPH   V  FVGNL  +L Q  YE++LL+ LG   K +T+I  IY+E G L++++   + A    + L+    +++ L+V+ LP + P+MIP D+ PLLV VN+KSGGCQGT+LI +FRKLLNP QVF++  GGPL GLY FR +  YKIL CGGDGT+GW L CLD   QDAAC SPP  ++PLGTGNDLARVLRWGGGYT  E P+ ILKDV+ A+ +KLDRW +V   ++ ++  +    Q E N  T+N  ED + +IIMNNYFG+G+DAD+ L FHN R  NP KF SR+ NKT Y K+GL+KM +  TCKDL K+I LE DG  I+LP IEG+++LN++SWG GANPWG  K++  F KPTHYDGLLEV+G+S +  +G I S +  GIRI Q G ++IT   + PVQVDGEP IQ PGTIT+LKSAL+A MLKK K  +R  A ++ +
Sbjct:   19 HGHYFVKKTFGKPAYCHHCCDKIWGMLTTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSLS-------SPSKIQADDVSTSGEDVKEREDFEIIRVFDGNNSYRSQISRNIVVAKHVSVQQVRDAALRRFHINDTPERYYITQV-VGEVEEEILEDPVPLRNVKRPEGKRAQIFIRYYDD--PDKDEVKVYGG---WLRKVPVTFCAISVSKDTVVQDLVTDALYHFGLDGSCWNRYNLIEVSLDRGVAERTCNPQENVLQLVRNLRKDSLRRYHVVRFYVQEKEDPHDHAV--FVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSS-GNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGNFSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQMLKKAKKSRRGGATNATS 903          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 414/900 (46.00%), Postives = 584/900 (64.89%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNK-WTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETN--TLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDD-KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNT 3106
            H H F+KK+F +PAYCHHC + +WG++T G+ CE+CNF+ HEKCL  V + C+++A   +  P++H W+ P   KRK+C VCRK+ DD  ++ CE+CEY+ H++C D  V++CKE A Y  N+   N  Q+HH  EGNLP  SKCI+C K C+S+EC+AG RCEWCG  +H +C++Q+  EC FG L+ I+LPP  + IPRT++ ME ++ +S     +S         SK ++     S +D  E+E  E   +VFDGN S + ++ R     K +S Q V +  L+ FHI    + Y + ++   +  E  L+D    ++    + KR  I +R+ +     + ++K+Y G   +  +V   +  + ++K T  ++++  A+  F  +    N + L+EV LDR V ER     E    +++ LRKDS+R   + RFY++  EDPH   V  FVGNL  +L Q  YE++LL+ LG   K +T+I  IY+E G L++++   + A    + L+    +++ L+V+ LP + P+MIP D+ PLLV VN+KSGGCQGT+LI +FRKLLNP QVF++  GGPL GLY FR +  YKIL CGGDGT+GW L CLD   QDAAC SPP  ++PLGTGNDLARVLRWGGGYT  E P+ ILKDV+ A+ +KLDRW +V   ++ ++  +    Q E N  T+N  ED + +IIMNNYFG+G+DAD+ L FHN R  NP KF SR+ NKT Y K+GL+KM +  TCKDL K+I LE DG  I+LP IEG+++LN++SWG GANPWG  K++  F KPTHYDGLLEV+G+S +  +G I S +  GIRI Q G ++IT   + PVQVDGEP IQ PGTIT+LKSAL+A MLKK K  +R  A ++ +
Sbjct:   19 HGHYFVKKTFGKPAYCHHCCDKIWGMLTTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSRK---VSSPSKIQADDVSTSGEDVKEREDFE-IIRVFDGNNSYRSQISRNIVVAKHVSVQQVRDAALRRFHINDTPERYYITQV-VGEVEEEILEDPVPLRNVKRPEGKRAQIFIRYYDD--PDKDEVKVYGG---WLRKVPVTFCAISVSKDTVVQDLVTDALYHFGLDGSCWNRYNLIEVSLDRGVAERTCNPQENVLQLVRNLRKDSLRRYHVVRFYVQEKEDPHDHAV--FVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSS-GNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGNFSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQMLKKAKKSRRGGATNATS 905          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 404/900 (44.89%), Postives = 569/900 (63.22%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNK-WTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETN--TLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDD-KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNT 3106
            H H F+KK+F +PAYCHHC + +WG++T G+ CE+CNF+ HEKCL  V + C+++A   +  P++H W+ P   KRK+C VCRK+ DD  ++ CE+CEY+ H++C D  V++CKE A Y  N+   N  Q+HH  EGNLP  SKCI+C K C+S+EC+AG RCEWCG  +H +C++Q+  EC FG L+ I+LPP  + IPRT++ ME ++ +S                             DQ +  K     ++F         + R     K +S Q V +  L+ FHI    + Y + ++   +  E  L+D    ++    + KR  I +R+ +     + ++K+Y G   +  +V   +  + ++K T  ++++  A+  F  +    N + L+EV LDR V ER     E    +++ LRKDS+R   + RFY++  EDPH   V  FVGNL  +L Q  YE++LL+ LG   K +T+I  IY+E G L++++   + A    + L+    +++ L+V+ LP + P+MIP D+ PLLV VN+KSGGCQGT+LI +FRKLLNP QVF++  GGPL GLY FR +  YKIL CGGDGT+GW L CLD   QDAAC SPP  ++PLGTGNDLARVLRWGGGYT  E P+ ILKDV+ A+ +KLDRW +V   ++ ++  +    Q E N  T+N  ED + +IIMNNYFG+G+DAD+ L FHN R  NP KF SR+ NKT Y K+GL+KM +  TCKDL K+I LE DG  I+LP IEG+++LN++SWG GANPWG  K++  F KPTHYDGLLEV+G+S +  +G I S +  GIRI Q G ++IT   + PVQVDGEP IQ PGTIT+LKSAL+A MLKK K  +R  A ++ +
Sbjct:   19 HGHYFVKKTFGKPAYCHHCCDKIWGMLTTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSH---------------------------DQPQSRK----GQIF------HYPISRNIVVAKHVSVQQVRDAALRRFHINDTPERYYITQV-VGEVEEEILEDPVPLRNVKRPEGKRAQIFIRYYDD--PDKDEVKVYGG---WLRKVPVTFCAISVSKDTVVQDLVTDALYHFGLDGSCWNRYNLIEVSLDRGVAERTCNPQENVLQLVRNLRKDSLRRYHVVRFYVQEKEDPHDHAV--FVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSS-GNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGNFSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQMLKKAKKSRRGGATNATS 872          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 493.426 bits (1269), Expect = 2.098e-158
Identity = 256/473 (54.12%), Postives = 335/473 (70.82%), Query Frame = 2
Query: 1700 KDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNK-WTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETN--TLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDD-KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNT 3106
            +DS+R   + RFY++  EDPH   V  FVGNL  +L Q  YE++LL+ LG   K +T+I  IY+E G L++++   + A    + L+    +++ L+V+ LP + P+MIP D+ PLLV VN+KSGGCQGT+LI +FRKLLNP QVF++  GGPL GLY FR +  YKIL CGGDGT+GW L CLD   QDAAC SPP  ++PLGTGNDLARVLRWGGGYT  E P+ ILKDV+ A+ +KLDRW +V   ++ ++  +    Q E N  T+N  ED + +IIMNNYFG+G+DAD+ L FHN R  NP KF SR+ NKT Y K+GL+KM +  TCKDL K+I LE DG  I+LP IEG+++LN++SWG GANPWG  K++  F KPTHYDGLLEV+G+S +  +G I S +  GIRI Q G ++IT   + PVQVDGEP IQ PGTIT+LKSAL+A MLKK K  +R  A ++ +
Sbjct:  280 QDSLRRYHVVRFYVQEKEDPHDHAV--FVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSS-GNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGNFSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQMLKKAKKSRRGGATNATS 749          

HSP 2 Score: 279.641 bits (714), Expect = 1.243e-79
Identity = 119/266 (44.74%), Postives = 174/266 (65.41%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRR 1216
            H H F+KK+F +PAYCHHC + +WG++T G+ CE+CNF+ HEKCL  V + C+++A   +  P++H W+ P   KRK+C VCRK+ DD  ++ CE+CEY+ H++C D  V++CKE A Y  N+   N  Q+HH  EGNLP  SKCI+C K C+S+EC+AG RCEWCG  +H +C++Q+  EC FG L+ I+LPP  + IPRT++ ME ++ +S     +S         SK ++     S +D  E+E  E   +VFDGN S + +
Sbjct:   19 HGHYFVKKTFGKPAYCHHCCDKIWGMLTTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSRK---VSSPSKIQADDVSTSGEDVKEREDFE-IIRVFDGNNSYRSQ 280          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 493.426 bits (1269), Expect = 2.293e-158
Identity = 256/473 (54.12%), Postives = 335/473 (70.82%), Query Frame = 2
Query: 1700 KDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNK-WTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETN--TLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDD-KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNT 3106
            +DS+R   + RFY++  EDPH   V  FVGNL  +L Q  YE++LL+ LG   K +T+I  IY+E G L++++   + A    + L+    +++ L+V+ LP + P+MIP D+ PLLV VN+KSGGCQGT+LI +FRKLLNP QVF++  GGPL GLY FR +  YKIL CGGDGT+GW L CLD   QDAAC SPP  ++PLGTGNDLARVLRWGGGYT  E P+ ILKDV+ A+ +KLDRW +V   ++ ++  +    Q E N  T+N  ED + +IIMNNYFG+G+DAD+ L FHN R  NP KF SR+ NKT Y K+GL+KM +  TCKDL K+I LE DG  I+LP IEG+++LN++SWG GANPWG  K++  F KPTHYDGLLEV+G+S +  +G I S +  GIRI Q G ++IT   + PVQVDGEP IQ PGTIT+LKSAL+A MLKK K  +R  A ++ +
Sbjct:  278 QDSLRRYHVVRFYVQEKEDPHDHAV--FVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSS-GNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGNFSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQMLKKAKKSRRGGATNATS 747          

HSP 2 Score: 280.796 bits (717), Expect = 4.730e-80
Identity = 120/266 (45.11%), Postives = 175/266 (65.79%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRR 1216
            H H F+KK+F +PAYCHHC + +WG++T G+ CE+CNF+ HEKCL  V + C+++A   +  P++H W+ P   KRK+C VCRK+ DD  ++ CE+CEY+ H++C D  V++CKE A Y  N+   N  Q+HH  EGNLP  SKCI+C K C+S+EC+AG RCEWCG  +H +C++Q+  EC FG L+ I+LPP  + IPRT++ ME ++ +S     +S S       SK ++     S +D  E+E  E   +VFDGN S + +
Sbjct:   19 HGHYFVKKTFGKPAYCHHCCDKIWGMLTTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSLS-----SPSKIQADDVSTSGEDVKEREDFE-IIRVFDGNNSYRSQ 278          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0300963)

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 332/635 (52.28%), Postives = 455/635 (71.65%), Query Frame = 2
Query: 1181 KVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGREN-PLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKR 3082
            KVFDGN S +R+ YR     ++ + + ++   L+AFHI      + + ++    G E+ P+ D +   + +  + KRP I LR ++ +   RG +++YPG L  C+ +   Y  VP++  T  K++I  A+ +F  +   I +++  EV LDR VTER +  +E PWDI+++L KDSIR + L RFY++  +DPHGP + +FVGNL   L+Q  YE++L + +   NK+ SI  IYYE G +VL++    KA   +  L++T I+D+ L+V++LP I P M+P D+ PLLVFVN+KSGGCQG +LI++FRKLLNP+QVF+L+ GGPLPGLY FRQ+ NYKILVCGGDGT+GW L CLD+ GQD+ C+SPP A++PLGTGNDLARVL WG GYT GE PL +L+DV+ AEE++LDRWT+V   +D   +E  +    +T     NED+S + +MNNYFG+G+DADL LDFHNAR ENPN+FNSR+ NK  Y+KMGLRK+V R   KDL K++ LE DG  ++LP ++G+IILNI+SWG GANPWGP+KDD+F  P HYDG+LEV+GV+G++H+GQI SGIR  +RI Q GH+KI L  D+PVQVDGEP+IQSPG + VLKSAL+A MLKKTK  +R
Sbjct:  327 KVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDRD---RGHVRVYPGKL-QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPNIALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPED-KPEEPAMKAPSQTTGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKATMLKKTKSKRR 956          

HSP 2 Score: 300.442 bits (768), Expect = 4.659e-85
Identity = 131/252 (51.98%), Postives = 171/252 (67.86%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWT--DEDSKEESYIDKRSLKDQNEKEKHE 1171
             H+F+KK+FH+P YCHHCS+++WGL+  G++CEVCNF++HE+C+S V T C+ IA   +  P++HCW+EP   KRKFC VCRK+LD+ PA+ C +CEY +HIECQD+ V +C E A Y P   LLN K  HHW EGNLP  SKC  C K C+SSEC+ GYRCEWCG  +H  C   +P EC FG L+ I LPP SV IPRT++ +E+IIGV  +S   S   D++     S+E S  D    KD+    K E
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENATYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSKT-SLVRDYSCPRSISEEFSSGDTPRFKDEESASKAE 255          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0330371)

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 332/655 (50.69%), Postives = 455/655 (69.47%), Query Frame = 2
Query: 1181 KVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGREN-PLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPG--------------------LYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKR 3082
            KVFDGN S +R+ YR     ++ + + ++   L+AFHI      + + ++    G E+ P+ D +   + +  + KRP I LR ++ +   RG +++YPG L  C+ +   Y  VP++  T  K++I  A+ +F  +   I +++  EV LDR VTER +  +E PWDI+++L KDSIR + L RFY++  +DPHGP + +FVGNL   L+Q  YE++L + +   NK+ SI  IYYE G +VL++    KA   +  L++T I+D+ L+V++LP I P M+P D+ PLLVFVN+KSGGCQG +LI++FRKLLNP+QVF+L+ GGPLPG                    LY FRQ+ NYKILVCGGDGT+GW L CLD+ GQD+ C+SPP A++PLGTGNDLARVL WG GYT GE PL +L+DV+ AEE++LDRWT+V   +D   +E  +    +T     NED+S + +MNNYFG+G+DADL LDFHNAR ENPN+FNSR+ NK  Y+KMGLRK+V R   KDL K++ LE DG  ++LP ++G+IILNI+SWG GANPWGP+KDD+F  P HYDG+LEV+GV+G++H+GQI SGIR  +RI Q GH+KI L  D+PVQVDGEP+IQSPG + VLKSAL+A MLKKTK  +R
Sbjct:  836 KVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDRD---RGHVRVYPGKL-QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPNIALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPED-KPEEPAMKAPSQTTGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKATMLKKTKSKRR 1485          

HSP 2 Score: 299.671 bits (766), Expect = 4.144e-83
Identity = 121/215 (56.28%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRS 1066
             H+F+KK+FH+P YCHHCS+++WGL+  G++CEVCNF++HE+C+S V T C+ IA   +  P++HCW+EP   KRKFC VCRK+LD+ PA+ C +CEY +HIECQD+ V +C E A Y P   LLN K  HHW EGNLP  SKC  C K C+SSEC+ GYRCEWCG  +H  C   +P EC FG L+ I LPP SV IPRT++ +E+IIGV  +S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENATYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKS 219          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0113392)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 332/655 (50.69%), Postives = 455/655 (69.47%), Query Frame = 2
Query: 1181 KVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGREN-PLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPG--------------------LYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKR 3082
            KVFDGN S +R+ YR     ++ + + ++   L+AFHI      + + ++    G E+ P+ D +   + +  + KRP I LR ++ +   RG +++YPG L  C+ +   Y  VP++  T  K++I  A+ +F  +   I +++  EV LDR VTER +  +E PWDI+++L KDSIR + L RFY++  +DPHGP + +FVGNL   L+Q  YE++L + +   NK+ SI  IYYE G +VL++    KA   +  L++T I+D+ L+V++LP I P M+P D+ PLLVFVN+KSGGCQG +LI++FRKLLNP+QVF+L+ GGPLPG                    LY FRQ+ NYKILVCGGDGT+GW L CLD+ GQD+ C+SPP A++PLGTGNDLARVL WG GYT GE PL +L+DV+ AEE++LDRWT+V   +D   +E  +    +T     NED+S + +MNNYFG+G+DADL LDFHNAR ENPN+FNSR+ NK  Y+KMGLRK+V R   KDL K++ LE DG  ++LP ++G+IILNI+SWG GANPWGP+KDD+F  P HYDG+LEV+GV+G++H+GQI SGIR  +RI Q GH+KI L  D+PVQVDGEP+IQSPG + VLKSAL+A MLKKTK  +R
Sbjct:  836 KVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDRD---RGHVRVYPGKL-QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPNIALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPED-KPEEPAMKAPSQTTGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKATMLKKTKSKRR 1485          

HSP 2 Score: 299.671 bits (766), Expect = 3.944e-83
Identity = 121/215 (56.28%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRS 1066
             H+F+KK+FH+P YCHHCS+++WGL+  G++CEVCNF++HE+C+S V T C+ IA   +  P++HCW+EP   KRKFC VCRK+LD+ PA+ C +CEY +HIECQD+ V +C E A Y P   LLN K  HHW EGNLP  SKC  C K C+SSEC+ GYRCEWCG  +H  C   +P EC FG L+ I LPP SV IPRT++ +E+IIGV  +S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENATYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKS 219          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0084497)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 327/675 (48.44%), Postives = 452/675 (66.96%), Query Frame = 2
Query: 1181 KVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGREN-PLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPG--------------------LYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKD-----------------EAKLALQIETNTLN--------------TNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRA 3049
            KVFDGN S +R+ YR     ++ + + ++   L+AFHI      + + ++    G E+ P+ D +   + +  + KRP I LR ++ +   RG +++YPG L  C+ +   Y  VP++  T  K++I  A+ +F  +   I +++  EV LDR VTER +  +E PWDI+++L KDSIR + L RFY++  +DPHGP + +FVGNL   L+Q  YE++L + +   NK+ SI  IYYE G +VL++    KA   +  L++T I+D+ L+V++LP I P M+P D+ PLLVFVN+KSGGCQG +LI++FRKLLNP+QVF+L+ GGPLPG                    LY FRQ+ NYKILVCGGDGT+GW L CLD+ GQD+ C+SPP A++PLGTGNDLARVL WG GYT GE PL +L+DV+ AEE++LDRWT+V   +D  ++                 +A L+   +TN  +               NED+S + +MNNYFG+G+DADL LDFHNAR ENPN+FNSR+ NK  Y+KMGLRK+V R   KDL K++ LE DG  ++LP ++G+IILNI+SWG GANPWGP+KDD+F  P HYDG+LEV+GV+G++H+GQI SGIR  +RI Q GH+KI L  D+PVQVDGEP+IQSPG + VLKSAL+A
Sbjct:  836 KVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDRD---RGHVRVYPGKL-QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPNIALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPSQTTGKKKKAHQAHLSQSQQTNQHHQLPALTSSDISGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKA 1506          

HSP 2 Score: 300.056 bits (767), Expect = 3.278e-83
Identity = 121/215 (56.28%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRS 1066
             H+F+KK+FH+P YCHHCS+++WGL+  G++CEVCNF++HE+C+S V T C+ IA   +  P++HCW+EP   KRKFC VCRK+LD+ PA+ C +CEY +HIECQD+ V +C E A Y P   LLN K  HHW EGNLP  SKC  C K C+SSEC+ GYRCEWCG  +H  C   +P EC FG L+ I LPP SV IPRT++ +E+IIGV  +S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENATYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKS 219          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0305041)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 327/675 (48.44%), Postives = 452/675 (66.96%), Query Frame = 2
Query: 1181 KVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGREN-PLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPG--------------------LYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKD-----------------EAKLALQIETNTLN--------------TNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRA 3049
            KVFDGN S +R+ YR     ++ + + ++   L+AFHI      + + ++    G E+ P+ D +   + +  + KRP I LR ++ +   RG +++YPG L  C+ +   Y  VP++  T  K++I  A+ +F  +   I +++  EV LDR VTER +  +E PWDI+++L KDSIR + L RFY++  +DPHGP + +FVGNL   L+Q  YE++L + +   NK+ SI  IYYE G +VL++    KA   +  L++T I+D+ L+V++LP I P M+P D+ PLLVFVN+KSGGCQG +LI++FRKLLNP+QVF+L+ GGPLPG                    LY FRQ+ NYKILVCGGDGT+GW L CLD+ GQD+ C+SPP A++PLGTGNDLARVL WG GYT GE PL +L+DV+ AEE++LDRWT+V   +D  ++                 +A L+   +TN  +               NED+S + +MNNYFG+G+DADL LDFHNAR ENPN+FNSR+ NK  Y+KMGLRK+V R   KDL K++ LE DG  ++LP ++G+IILNI+SWG GANPWGP+KDD+F  P HYDG+LEV+GV+G++H+GQI SGIR  +RI Q GH+KI L  D+PVQVDGEP+IQSPG + VLKSAL+A
Sbjct:  770 KVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDRD---RGHVRVYPGKL-QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPNIALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPSQTTGKKKKAHQAHLSQSQQTNQHHQLPALTSSDISGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKA 1440          

HSP 2 Score: 300.056 bits (767), Expect = 2.675e-83
Identity = 121/215 (56.28%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRS 1066
             H+F+KK+FH+P YCHHCS+++WGL+  G++CEVCNF++HE+C+S V T C+ IA   +  P++HCW+EP   KRKFC VCRK+LD+ PA+ C +CEY +HIECQD+ V +C E A Y P   LLN K  HHW EGNLP  SKC  C K C+SSEC+ GYRCEWCG  +H  C   +P EC FG L+ I LPP SV IPRT++ +E+IIGV  +S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENATYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKS 219          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkaa (diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZDB-GENE-060616-305])

HSP 1 Score: 269.24 bits (687), Expect = 2.655e-76
Identity = 155/364 (42.58%), Postives = 210/364 (57.69%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWGPEK-----DDKF-----------VKPTHY-DGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL-KSALRAIMLKKTKLG 3076
            LVFVN KSGG QG +++  F+ LLNP QV+NL  GGP PGL  FR V NY+ILVCGGDGTVGW L  +D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILKD+ ++EE  +DRW++ V  +D  +    +  +                I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y +    + +   +CK L + + +E  G  +DL    +EG+ ILNI S  GG+N WG  K     D K            V P    D  LEV+G+ G + MGQIY+G+++ +R+ +   + I  K  LP+Q+DGEP++Q P TI +  K+    +M  + K G
Sbjct:  382 LVFVNPKSGGKQGERVLRKFQYLLNPRQVYNLSNGGPGPGLSFFRDVPNYRILVCGGDGTVGWILDAIDKANLPV---RPPVAVLPLGTGNDLARCLRWGGGY-DGMDLGRILKDIEVSEEGPMDRWSIQVTLEDSQERGDPVPYE----------------IINNYFSIGVDASIAHRFHTMREKHPQKFNSRMKNKLWYFEFATSETI-SASCKKLKECLTIECCGTQLDLSSLSLEGIAILNIPSMHGGSNLWGEAKKSDRMDQKLPEVIVDPEILKVSPQDMSDKRLEVVGLEGAMEMGQIYTGLKSAVRLAKTSQITIRTKKPLPMQIDGEPWMQPPCTIHITHKNQASMLMGPQAKSG 724          

HSP 2 Score: 62.3882 bits (150), Expect = 3.083e-9
Identity = 48/179 (26.82%), Postives = 67/179 (37.43%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLK 1144
            H W      K  +CNVC+  L       + C  C Y  H  C +     C      +   + +     H W+ GN   + KC  C K   S   + G RC WC    H  C  Q P  C  GP K  ILPP ++              V +R N       + D+DS+  +  D + L+
Sbjct:  208 HLWRMKHFNKPVYCNVCQNMLLGLRKQGLCCTCCRYTVHGRCANKNPAPCTRTYVMSKKETGI---AVHDWVSGNCD-SGKCDGCQKKIKSLHGLTGKRCVWCHTMRHDACATQEPFTCDCGPFKVHILPPWAI-----------YPVVKERPNCIKNGGSFPDDDSELNTTPDGQVLR 371          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkaa (diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZDB-GENE-060616-305])

HSP 1 Score: 269.626 bits (688), Expect = 3.379e-76
Identity = 155/364 (42.58%), Postives = 210/364 (57.69%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWGPEK-----DDKF-----------VKPTHY-DGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL-KSALRAIMLKKTKLG 3076
            LVFVN KSGG QG +++  F+ LLNP QV+NL  GGP PGL  FR V NY+ILVCGGDGTVGW L  +D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILKD+ ++EE  +DRW++ V  +D  +    +  +                I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y +    + +   +CK L + + +E  G  +DL    +EG+ ILNI S  GG+N WG  K     D K            V P    D  LEV+G+ G + MGQIY+G+++ +R+ +   + I  K  LP+Q+DGEP++Q P TI +  K+    +M  + K G
Sbjct:  421 LVFVNPKSGGKQGERVLRKFQYLLNPRQVYNLSNGGPGPGLSFFRDVPNYRILVCGGDGTVGWILDAIDKANLPV---RPPVAVLPLGTGNDLARCLRWGGGY-DGMDLGRILKDIEVSEEGPMDRWSIQVTLEDSQERGDPVPYE----------------IINNYFSIGVDASIAHRFHTMREKHPQKFNSRMKNKLWYFEFATSETI-SASCKKLKECLTIECCGTQLDLSSLSLEGIAILNIPSMHGGSNLWGEAKKSDRMDQKLPEVIVDPEILKVSPQDMSDKRLEVVGLEGAMEMGQIYTGLKSAVRLAKTSQITIRTKKPLPMQIDGEPWMQPPCTIHITHKNQASMLMGPQAKSG 763          

HSP 2 Score: 62.3882 bits (150), Expect = 3.448e-9
Identity = 48/179 (26.82%), Postives = 67/179 (37.43%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLK 1144
            H W      K  +CNVC+  L       + C  C Y  H  C +     C      +   + +     H W+ GN   + KC  C K   S   + G RC WC    H  C  Q P  C  GP K  ILPP ++              V +R N       + D+DS+  +  D + L+
Sbjct:  247 HLWRMKHFNKPVYCNVCQNMLLGLRKQGLCCTCCRYTVHGRCANKNPAPCTRTYVMSKKETGI---AVHDWVSGNCD-SGKCDGCQKKIKSLHGLTGKRCVWCHTMRHDACATQEPFTCDCGPFKVHILPPWAI-----------YPVVKERPNCIKNGGSFPDDDSELNTTPDGQVLR 410          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkg (diacylglycerol kinase, gamma [Source:ZFIN;Acc:ZDB-GENE-081105-39])

HSP 1 Score: 266.159 bits (679), Expect = 1.088e-75
Identity = 155/397 (39.04%), Postives = 216/397 (54.41%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWG---------------PE----------KDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMNSSN 3151
            LV VN KSGG QG +++  F+ LLNP QV++LE GGP+ GL  FR V ++++L CGGDG+VGW L C+D     +    PP+A+LPLGTGNDLAR LRWGGGY  G   ++ L+D+  + E+ LDRW + +  DD ++                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  + +   TCK L++ I +E DG  +DL    +EG+ +LNI S  GG+N WG               PE          K+ KF      D LLEV+G+ G I MGQIY+G+++ G R+ Q  ++ I     LP+Q+DGEP++Q P TI +       ++L                GPP + P       N
Sbjct:  319 LVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGGSL-VKFLRDIEHSTEVLLDRWNIDIVPDDKEE----------------KGDPVPYSIVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETI-SATCKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRITHKNQVPMLL----------------GPPQKTPFFFFKKRN 678          

HSP 2 Score: 60.8474 bits (146), Expect = 9.339e-9
Identity = 41/143 (28.67%), Postives = 60/143 (41.96%), Query Frame = 2
Query:  590 TAVARPLSHCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVC 1012
            T V     H W      K  +CN C   L       + C +C+Y  H  C    +  C   + Y  +    N  Q H W+EGN   ++KC  C+++    + + G  C WC    H  C   +  EC  GPL++  L PS +C
Sbjct:  131 TNVQEDGQHIWKLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCI--STYAKSRRHTNAMQ-HVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPSYIC 268          

HSP 3 Score: 58.151 bits (139), Expect = 5.654e-8
Identity = 32/121 (26.45%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVAR----PLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F++PAYC++C  ++ G+   G  C +C + VHE+C+S+    C  I++ A +R     + H W E  +  +  C+ C + +        + C  C+   H +C   +   C  G
Sbjct:  139 HIWKLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPC--ISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGG 255          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: BX548053.1 (diacylglycerol kinase beta-like [Source:NCBI gene;Acc:567728])

HSP 1 Score: 267.314 bits (682), Expect = 3.249e-75
Identity = 155/397 (39.04%), Postives = 216/397 (54.41%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWG---------------PE----------KDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMNSSN 3151
            LV VN KSGG QG +++  F+ LLNP QV++LE GGP+ GL  FR V ++++L CGGDG+VGW L C+D     +    PP+A+LPLGTGNDLAR LRWGGGY  G   ++ L+D+  + E+ LDRW + +  DD ++                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  + +   TCK L++ I +E DG  +DL    +EG+ +LNI S  GG+N WG               PE          K+ KF      D LLEV+G+ G I MGQIY+G+++ G R+ Q  ++ I     LP+Q+DGEP++Q P TI +       ++L                GPP + P       N
Sbjct:  426 LVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGGSL-VKFLRDIEHSTEVLLDRWNIDIVPDDKEE----------------KGDPVPYSIVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETI-SATCKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRITHKNQVPMLL----------------GPPQKTPFFFFKKRN 785          

HSP 2 Score: 60.077 bits (144), Expect = 1.564e-8
Identity = 41/143 (28.67%), Postives = 60/143 (41.96%), Query Frame = 2
Query:  590 TAVARPLSHCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVC 1012
            T V     H W      K  +CN C   L       + C +C+Y  H  C    +  C   + Y  +    N  Q H W+EGN   ++KC  C+++    + + G  C WC    H  C   +  EC  GPL++  L PS +C
Sbjct:  255 TNVQEDGQHIWKLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCI--STYAKSRRHTNAMQ-HVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPSYIC 392          

HSP 3 Score: 57.3806 bits (137), Expect = 9.997e-8
Identity = 32/121 (26.45%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVAR----PLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F++PAYC++C  ++ G+   G  C +C + VHE+C+S+    C  I++ A +R     + H W E  +  +  C+ C + +        + C  C+   H +C   +   C  G
Sbjct:  263 HIWKLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPC--ISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGG 379          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: BX548053.1 (diacylglycerol kinase beta-like [Source:NCBI gene;Acc:567728])

HSP 1 Score: 266.929 bits (681), Expect = 4.012e-75
Identity = 155/397 (39.04%), Postives = 216/397 (54.41%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWG---------------PE----------KDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMNSSN 3151
            LV VN KSGG QG +++  F+ LLNP QV++LE GGP+ GL  FR V ++++L CGGDG+VGW L C+D     +    PP+A+LPLGTGNDLAR LRWGGGY  G   ++ L+D+  + E+ LDRW + +  DD ++                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  + +   TCK L++ I +E DG  +DL    +EG+ +LNI S  GG+N WG               PE          K+ KF      D LLEV+G+ G I MGQIY+G+++ G R+ Q  ++ I     LP+Q+DGEP++Q P TI +       ++L                GPP + P       N
Sbjct:  418 LVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGGSL-VKFLRDIEHSTEVLLDRWNIDIVPDDKEE----------------KGDPVPYSIVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETI-SATCKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRITHKNQVPMLL----------------GPPQKTPFFFFKKRN 777          

HSP 2 Score: 62.003 bits (149), Expect = 4.234e-9
Identity = 46/158 (29.11%), Postives = 67/158 (42.41%), Query Frame = 2
Query:  590 TAVARPLSHCWTEPGTFKRKFCNVCRKKL--DDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVS 1057
            T V     H W      K  +CN C   L       + C +C+Y  H  C    +  C   + Y  +    N  Q H W+EGN   ++KC  C+++    + + G  C WC    H  C   +  EC  GPL++  L PS +C P   +S  S I V+
Sbjct:  249 TNVQEDGQHIWKLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCI--STYAKSRRHTNAMQ-HVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPSYIC-PVVLVSSVSRIAVT 400          

HSP 3 Score: 57.3806 bits (137), Expect = 1.013e-7
Identity = 32/121 (26.45%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVAR----PLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F++PAYC++C  ++ G+   G  C +C + VHE+C+S+    C  I++ A +R     + H W E  +  +  C+ C + +        + C  C+   H +C   +   C  G
Sbjct:  257 HIWKLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPC--ISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGG 373          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 351/892 (39.35%), Postives = 531/892 (59.53%), Query Frame = 2
Query:  413 FKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHH-WLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKD-------GRENPLDDKSNFKSQLTFDSKRP-IIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPI-GNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML 3058
            F  AH+F K +  +P +CHHC++ +WGL   GF CEVCNF+ HEKCL  V T+C+ +A + V  P++HC+  PG +K+KFC+VCRK L+++  +RCE+CE H H +C  +  ++C++      +    N   +HH W EGN   +++C +C KNC SSE ++G +CEWCG  +H+ C+  +  EC FG L++++LPP+ V +     S      +S+  N+++      DED++ +  I     +     +  +   K++DG+ ++KR   R  +  +   S+ V+E  L+A++I  +  +Y +  + ++         R   ++D    K    F    P   ++R     +E    LKIYPG +    +V   Y  +P+NK+ T + VI   + +   +  N+ NF+LVEV +     +R +   +E  +D +  +RK SIR +  TRFY++  E P    + IF+  L   L+   Y  +L E L + +K  S+   Y   G +VL   C  +AE  + ++KDT I ++ L  +I+P I+   +P +  PLLVFVN KSGG +G  L+ +FRKLLNPHQVF L  GGPLPG + F +V  +++LVCGGDGTVGW L  L+      AC  P IAVLPLGTGNDL RVLRWG GY SGE P  IL  V  AE + +DRWT+++        +A+ A+ +  N + +  D   ++ MNNY G+G+DA+L+LDFH+AR   P KFNSR HNK VY+K GL+K+ +    ++LH+ + L+ D   ++LP IEGLI LNI SWG GA+ WG + D+++ KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL   +PVQVDGEP+IQ PG I +  +  +  ML
Sbjct:   72 FSPAHSFRKVTLTKPTFCHHCTDFIWGL--AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQ----CHHDGQQNHDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRISE--NIQAEQ----DEDNENDGIIQGSVKETPTSADSSKQSLKIYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTLMQQTLVSDDIINRNGAMEDG---KVGSVFKEATPEAWMIRAKPKEREI---LKIYPGWM----KVGVAYISIPVNKEHTVQTVIQEVLIQLGRQKENLENFRLVEVLMSSKQVQRMVLPFEEIIFDRLNEVRKTSIRQMNQTRFYIEENEKPE-IKIHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLVKDTSINNKQLHGVIIPHIMHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGY-SGEDPYSILISVNEAENVLMDRWTILL--------DAQEAVDVMENGI-SEPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDNDNRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 927          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 335/896 (37.39%), Postives = 503/896 (56.14%), Query Frame = 2
Query:  413 FKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDY------AKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKD-------GRENPLDDKSNFKSQLTFDSKRP-IIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML 3058
            F  AH+F K +  +P +CHHC++ +WGL   GF CEVCNF+ HEKCL  V T+C+ +A + V  P++HC+  PG +K+KFC+VCRK L+++  +RCE+CE H H +C  +  ++C++   +    + ++    HHW EGN   +++C +C KNC SSE ++G +CEWCG  +H+ C+  +  EC FG L++++LPP+ V +     S      +S+  N+++           E+ ++       Q E   H  Y       K++DG+ ++KR   R  +  +   S+ V+E  L+A++I  +  +Y +  + ++         R   ++D    K    F    P   ++R     +E    LKIYPG +    +V   Y  +P+NK+ T +                                            +IQ +       ++L  F  K  E P    + IF+  L   L+   Y  +L E L + +K  S+   Y   G +VL   C  +AE  + ++KDT I ++ L  +I+P I+   +P +  PLLVFVN KSGG +G  L+ +FRKLLNPHQVF L  GGPLPG + F +V  +++LVCGGDGTVGW L  L+      AC  P IAVLPLGTGNDL RVLRWG GY SGE P  IL  V  AE + +DRWT+++        +A+ A+ +  N + +  D   ++ MNNY G+G+DA+L+LDFH+AR   P KFNSR HNK VY+K GL+K+ +    ++LH+ + L+ D   ++LP IEGLI LNI SWG GA+ WG + D+++ KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL   +PVQVDGEP+IQ PG I +  +  +  ML
Sbjct:   39 FSPAHSFRKVTLTKPTFCHHCTDFIWGL--AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQ-CHHDGQQNHVSDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRISE--NIQA-----------EQGFMAHTGSIGQAEYGTHRQYRAGKQSLKIYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTLMQQTLVSDDIINRNGAMEDG---KVGSVFKEATPEAWMIRAKPKEREI---LKIYPGWM----KVGVAYISIPVNKEHTVQ-------------------------------------------TVIQEVL------IQLGHFVFKN-EKPE-IKIHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLVKDTSINNKQLHGVIIPHIMHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGY-SGEDPYSILISVNEAENVLMDRWTILL--------DAQEAVDVMENGI-SEPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDNDNRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 844          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 335/895 (37.43%), Postives = 501/895 (55.98%), Query Frame = 2
Query:  413 FKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHH-WLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAK----VFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKD-------GRENPLDDKSNFKSQLTFDSKRP-IIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML 3058
            F  AH+F K +  +P +CHHC++ +WGL   GF CEVCNF+ HEKCL  V T+C+ +A + V  P++HC+  PG +K+KFC+VCRK L+++  +RCE+CE H H +C  +  ++C++      +    N   +HH W EGN   +++C +C KNC SSE ++G +CEWCG  +H+ C+  +  EC FG L++++LPP+ V +     S      +S+  N+++    +         +I        N    H D+ K    ++DG+ ++KR   R  +  +   S+ V+E  L+A++I  +  +Y +  + ++         R   ++D    K    F    P   ++R     +E    LKIYPG +    +V   Y  +P+NK+ T +                                            +IQ +       ++L  F  K  E P    + IF+  L   L+   Y  +L E L + +K  S+   Y   G +VL   C  +AE  + ++KDT I ++ L  +I+P I+   +P +  PLLVFVN KSGG +G  L+ +FRKLLNPHQVF L  GGPLPG + F +V  +++LVCGGDGTVGW L  L+      AC  P IAVLPLGTGNDL RVLRWG GY SGE P  IL  V  AE + +DRWT+++        +A+ A+ +  N + +  D   ++ MNNY G+G+DA+L+LDFH+AR   P KFNSR HNK VY+K GL+K+ +    ++LH+ + L+ D   ++LP IEGLI LNI SWG GA+ WG + D+++ KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL   +PVQVDGEP+IQ PG I +  +  +  ML
Sbjct:   72 FSPAHSFRKVTLTKPTFCHHCTDFIWGL--AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQ----CHHDGQQNHDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRISE--NIQAEQGLYCLYHLLWALFITSIPKVTVNAL-VHADFCKQSLKIYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTLMQQTLVSDDIINRNGAMEDG---KVGSVFKEATPEAWMIRAKPKEREI---LKIYPGWM----KVGVAYISIPVNKEHTVQ-------------------------------------------TVIQEVL------IQLGHFVFKN-EKPE-IKIHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLVKDTSINNKQLHGVIIPHIMHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGY-SGEDPYSILISVNEAENVLMDRWTILL--------DAQEAVDVMENGI-SEPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDNDNRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 883          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 327/891 (36.70%), Postives = 488/891 (54.77%), Query Frame = 2
Query:  413 FKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHH-WLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKD-------GRENPLDDKSNFKSQLTFDSKRP-IIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML 3058
            F  AH+F K +  +P +CHHC++ +WGL   GF CEVCNF+ HEKCL  V T+C+ +A + V  P++HC+  PG +K+KFC+VCRK L+++  +RCE+CE H H +C  +  ++C++      +    N   +HH W EGN   +++C +C KNC SSE ++G +CEWCG  +H+ C+  +  EC FG L++++LPP+ V +     S      +S+    +    D    D      +D          +      K++DG+ ++KR   R  +  +   S+ V+E  L+A++I  +  +Y +  + ++         R   ++D    K    F    P   ++R     +E    LKIYPG +    +V   Y  +P+NK+ T +                                            +IQ +       ++L  F  K  E P    + IF+  L   L+   Y  +L E L + +K  S+   Y   G +VL   C  +AE  + +     I     + ++L  +    +P +  PLLVFVN KSGG +G  L+ +FRKLLNPHQVF L  GGPLPG + F +V  +++LVCGGDGTVGW L  L+      AC  P IAVLPLGTGNDL RVLRWG GY SGE P  IL  V  AE + +DRWT+++        +A+ A+ +  N + +  D   ++ MNNY G+G+DA+L+LDFH+AR   P KFNSR HNK VY+K GL+K+ +    ++LH+ + L+ D   ++LP IEGLI LNI SWG GA+ WG + D+++ KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL   +PVQVDGEP+IQ PG I +  +  +  ML
Sbjct:   72 FSPAHSFRKVTLTKPTFCHHCTDFIWGL--AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQ----CHHDGQQNHDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRISENIQAEQGRFDILS-DQGPHRLVDA-------APDSPALVLKIYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTLMQQTLVSDDIINRNGAMEDG---KVGSVFKEATPEAWMIRAKPKEREI---LKIYPGWM----KVGVAYISIPVNKEHTVQ-------------------------------------------TVIQEVL------IQLGHFVFKN-EKPE-IKIHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLFCLRVI----YLFILLFYLQHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGY-SGEDPYSILISVNEAENVLMDRWTILL--------DAQEAVDVMENGI-SEPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDNDNRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 870          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKA (diacylglycerol kinase alpha [Source:NCBI gene;Acc:100124931])

HSP 1 Score: 252.677 bits (644), Expect = 2.405e-71
Identity = 150/362 (41.44%), Postives = 203/362 (56.08%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADG--HTIDLPQIEGLIILNIMSWGGGANPWGPEKD--------------DKFVKPTHY--------DGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIM 3055
            LVFVN KSGG QG +++  F+ LLNP QV NL  GGP PGL  FR V  Y+ILVCGGDGTVGW L  +D          PP+AVLPLGTGNDLAR L WGGGY  GE  ++ LKD+  +  +K+DRW + V  ++PD+    +  +                I+NNYF +G+DA +A  FHN R + P KFNSRM NK  Y +    + V+ +TCK L + I +E  G    +    +EG+ ++NI S  GG+N WG  K               +    P           D  LEV+G+ G I MGQIY+G+++ G R+     L I     LP+Q+DGEP++Q P   TV ++A+ A++
Sbjct:  268 LVFVNPKSGGKQGERVLRKFQYLLNPRQVHNLIKGGPSPGLNFFRDVPEYRILVCGGDGTVGWILDAIDKANLPY---RPPVAVLPLGTGNDLARCLSWGGGY-DGENLMKFLKDIEKSVPIKMDRWNIEVIPENPDEKGDPVPYE----------------IINNYFSIGVDASIAHRFHNMREKYPEKFNSRMKNKLWYFEFATSETVF-STCKKLKEVITIECCGSPLKLSSLSLEGIAVINIPSMHGGSNLWGETKKHWGEPRNASCHNAPEAITDPDALKSCVQDLSDKRLEVVGLEGAIEMGQIYTGLKSAGKRLATCSELTIRTTKPLPMQIDGEPWMQPP--CTVRQAAIIALL 606          

HSP 2 Score: 58.9214 bits (141), Expect = 4.437e-8
Identity = 35/110 (31.82%), Postives = 53/110 (48.18%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARP----LSHCWTEPGTFKRKFCNVCRKKLDDNPAI---RCEICEYHSHIEC 733
            H +  K F+RP YC+ C  +++G+   G  C  C F VHE+C  +    C  I++ A +R      +H W   G    K C+ C+KK+    ++   RC  C    H EC
Sbjct:  125 HLWRLKHFNRPVYCNVCEALLFGVRKQGLCCTFCKFTVHERCARKAPNSC--ISTYAKSRKDFSEQAHVWMRGGCEASK-CDKCQKKIKSFQSLTGQRCVWCHTKVHDEC 231          

HSP 3 Score: 53.9138 bits (128), Expect = 1.891e-6
Identity = 42/135 (31.11%), Postives = 57/135 (42.22%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNF-KQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSV 1009
            H W      +  +CNVC   L       + C  C++  H  C     N+C    A     S  +F +Q H W+ G     SKC  C K   S + + G RC WC    H  C    P+ C  G LK+ ILPP+ +
Sbjct:  125 HLWRLKHFNRPVYCNVCEALLFGVRKQGLCCTFCKFTVHERCARKAPNSCISTYAK----SRKDFSEQAHVWMRGGCEA-SKCDKCQKKIKSFQSLTGQRCVWCHTKVHDECASS-PL-CDGGILKDHILPPACI 252          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkq (diacylglycerol kinase, theta [Source:MGI Symbol;Acc:MGI:102918])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 359/918 (39.11%), Postives = 537/918 (58.50%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHH-WLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEI-----NEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFP-----WDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMN 3142
             H+F K +  +P +CH CS+ +WGL   GF+C+VCNF+ HEKCL QV T CT+IA + V  P++HC+   G +KRKFC VCRK L+  PA RCE+CE H H +C  +  ++C++           ++  +HH W EGNLP  ++C +C K C SS+ +AG RCEWCG  +H++C   +  EC FG L++++LPPS V +     S      + +   ++    D   + S   +    R +    E  K     K+FDGN S+++  +R    ++   ++ V+E  L+A++I     ++ +  +      +  G+    +++++ K     DS     ++R   S   T+  LKIYPG L    +V   Y  + +N ++T++ V+   +  F  +  +   FQL+EV +     +R +  DE P     WDI    R+ S+R +  TRFY+ A      P V++FVG L   L+   Y  +L E +       S+  +Y   G ++L  TC  +AE  Y + +DT +  RPL  ++LP ++   +P D  PLLVFVN KSGG +G +L+ +FRKLLNPHQVF L  GGPLPG + F QV ++++LVCGGDGTVGW L+ L+ T +  AC  P +A+LPLGTGNDL RVLRWG GY SGE P  +L  V  A+ + +DRWT+++ + + D          E N + T      ++ MNNY G+G+DA+L+LDFH AR E P KF SR HNK VY+++GL+K+ +    + LHK+I L+ +   ++LP IEGLI +NI SWG GA+ WG + D +F KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL    PVQVDGEP++Q+PG + +  +A +  ML+K K  K RKA ++       +P P  N
Sbjct:   54 GHSFRKVTLTKPTFCHLCSDFIWGL--AGFLCDVCNFMSHEKCLKQVKTPCTSIAPSLVRVPVAHCFGSLGLYKRKFCVVCRKSLE-VPAFRCEVCELHVHPDCVPFACSDCRQCHQDGQQ----DYDTYHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSTALAPECTFGRLRSMVLPPSCVRLLSRNFSKMHCFRIPETMVLELGDGDDGVDGSA--AIGTGREVLTATESTKQT--LKIFDGNDSMRKNQFRLVTVSRLARNEEVMEAALRAYYISEDPKDFQLQALPLSGNAQALGKAGTTEEEAS-KGSCPRDSVPEAWVIR---SLPRTQEILKIYPGWL----KVGVAYVSIRVNSQSTARSVVQEVLPLFGQQVEDKERFQLIEVLMSSRQVQRTVLADEEPLLDRLWDI----RQTSVRQVSQTRFYV-AETRATAPRVSLFVGGLPPGLSPQDYSNLLHEAMATKAAVVSVSHVYSLQGAVILDVTCFAEAERLYMLARDTAVHGRPLTALVLPDVLHTKLPPDCCPLLVFVNPKSGGLKGRELLCSFRKLLNPHQVFELTNGGPLPGFHLFSQVPSFRVLVCGGDGTVGWVLAALEETRRHLACPEPSVAILPLGTGNDLGRVLRWGAGY-SGEDPFSVLVSVDEADAVLMDRWTILLDAHEIDS--------TENNVVETEPPK--IVQMNNYCGIGIDAELSLDFHQAREEEPGKFTSRFHNKGVYVRVGLQKISH---SRSLHKEIRLQVEQQEVELPSIEGLIFINIPSWGSGADLWGSDNDSRFEKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISATAPKVHMLRKAK-QKPRKAGANRDTRVDTLPAPEGN 932          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkb (diacylglycerol kinase, beta [Source:MGI Symbol;Acc:MGI:2442474])

HSP 1 Score: 278.87 bits (712), Expect = 3.812e-79
Identity = 153/354 (43.22%), Postives = 204/354 (57.63%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDD-----------------------KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            LVFVN KSGG QG ++   F+ LLNP QV++L   GP+PGL+ FR V ++++L CGGDGTVGW L C++          PP+A+LPLGTGNDLAR LRWGGGY  GE  ++ILKD+  + E+ LDRW   V  +D D+                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH+ + +E DG  IDL  I  EG+ ILNI S  GG+N WG  K                         KF      D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+Q+DGEP++Q+P TI +
Sbjct:  431 LVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKAN---VVKHPPVAILPLGTGNDLARCLRWGGGY-EGENLMKILKDIESSTEIMLDRWKFEVTPNDKDE----------------KGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSE-TFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 763          

HSP 2 Score: 72.7886 bits (177), Expect = 2.495e-12
Identity = 51/183 (27.87%), Postives = 78/183 (42.62%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKL--DDNPAIRCEICEYHSHIECQDYVVNNC-KEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQN 1153
            H W      K  +CN+C   L       + C  C+Y  H  C      +C K       N  +++    H+W+EGN P  +KC  C+K     + + G  C WC    H  C   +  EC  GPLK+ ILPP+++C     ++M S  G S     +ST++       +     DK  ++  N
Sbjct:  237 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKKNTDVMH----HYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTIC--PVVLTMPS-AGASVPEERQSTAKKEKSSSQQPNKATDKNKMQRAN 410          

HSP 3 Score: 53.1434 bits (126), Expect = 2.603e-6
Identity = 33/119 (27.73%), Postives = 54/119 (45.38%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F++PAYC+ C  ++ G+   G  C  C + VHE+C+++    C  T + S      + H W E G    K C+ C K +        + C  C+   H +C  ++   C  G
Sbjct:  237 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKKNTDVMHHYWVE-GNCPTK-CDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCG 353          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkb (diacylglycerol kinase, beta [Source:MGI Symbol;Acc:MGI:2442474])

HSP 1 Score: 278.87 bits (712), Expect = 3.812e-79
Identity = 153/354 (43.22%), Postives = 204/354 (57.63%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDD-----------------------KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            LVFVN KSGG QG ++   F+ LLNP QV++L   GP+PGL+ FR V ++++L CGGDGTVGW L C++          PP+A+LPLGTGNDLAR LRWGGGY  GE  ++ILKD+  + E+ LDRW   V  +D D+                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH+ + +E DG  IDL  I  EG+ ILNI S  GG+N WG  K                         KF      D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+Q+DGEP++Q+P TI +
Sbjct:  431 LVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKAN---VVKHPPVAILPLGTGNDLARCLRWGGGY-EGENLMKILKDIESSTEIMLDRWKFEVTPNDKDE----------------KGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSE-TFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 763          

HSP 2 Score: 72.7886 bits (177), Expect = 2.495e-12
Identity = 51/183 (27.87%), Postives = 78/183 (42.62%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKL--DDNPAIRCEICEYHSHIECQDYVVNNC-KEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQN 1153
            H W      K  +CN+C   L       + C  C+Y  H  C      +C K       N  +++    H+W+EGN P  +KC  C+K     + + G  C WC    H  C   +  EC  GPLK+ ILPP+++C     ++M S  G S     +ST++       +     DK  ++  N
Sbjct:  237 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKKNTDVMH----HYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTIC--PVVLTMPS-AGASVPEERQSTAKKEKSSSQQPNKATDKNKMQRAN 410          

HSP 3 Score: 53.1434 bits (126), Expect = 2.603e-6
Identity = 33/119 (27.73%), Postives = 54/119 (45.38%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F++PAYC+ C  ++ G+   G  C  C + VHE+C+++    C  T + S      + H W E G    K C+ C K +        + C  C+   H +C  ++   C  G
Sbjct:  237 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKKNTDVMHHYWVE-GNCPTK-CDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCG 353          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkg (diacylglycerol kinase, gamma [Source:MGI Symbol;Acc:MGI:105060])

HSP 1 Score: 271.937 bits (694), Expect = 4.267e-77
Identity = 161/377 (42.71%), Postives = 210/377 (55.70%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDDKFV---------KPTHY--------DGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML----KKTKLGKRRKADSSN 3103
            LV VN KSGG QG +++  F  LLNP QVFNL+ GGP PGL  F    ++++L CGGDGTVGW L C+D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILK++  +  + LDRW L V      ++E +   Q+  N            IMNNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH  I LE DG  +DL  I  EG+ ILNI S  GG N WG  K ++ V          P           D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+QVDGEP++Q   TI +       +M+    K +    RRK+ S +
Sbjct:  394 LVLVNPKSGGRQGERILRKFHYLLNPEQVFNLDNGGPTPGLNFFHDTPDFRVLACGGDGTVGWILDCIDKAN---FTKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL-TKILKEIEQSPLVMLDRWYLEVMP----REEVENGDQVPYN------------IMNNYFSIGVDASIAHRFHMMREKHPEKFNSRMKNKLWYFEFGTSE-TFAATCKKLHDHIELECDGVEVDLSNIFLEGIAILNIPSMYGGTNLWGETKKNRAVIRESRKSVTDPKELKCCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPQCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD 749          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkg (diacylglycerol kinase, gamma [Source:MGI Symbol;Acc:MGI:105060])

HSP 1 Score: 272.322 bits (695), Expect = 7.999e-77
Identity = 161/377 (42.71%), Postives = 210/377 (55.70%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDDKFV---------KPTHY--------DGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML----KKTKLGKRRKADSSN 3103
            LV VN KSGG QG +++  F  LLNP QVFNL+ GGP PGL  F    ++++L CGGDGTVGW L C+D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILK++  +  + LDRW L V      ++E +   Q+  N            IMNNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH  I LE DG  +DL  I  EG+ ILNI S  GG N WG  K ++ V          P           D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+QVDGEP++Q   TI +       +M+    K +    RRK+ S +
Sbjct:  433 LVLVNPKSGGRQGERILRKFHYLLNPEQVFNLDNGGPTPGLNFFHDTPDFRVLACGGDGTVGWILDCIDKAN---FTKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL-TKILKEIEQSPLVMLDRWYLEVMP----REEVENGDQVPYN------------IMNNYFSIGVDASIAHRFHMMREKHPEKFNSRMKNKLWYFEFGTSE-TFAATCKKLHDHIELECDGVEVDLSNIFLEGIAILNIPSMYGGTNLWGETKKNRAVIRESRKSVTDPKELKCCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPQCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD 788          

HSP 2 Score: 55.4546 bits (132), Expect = 4.134e-7
Identity = 39/136 (28.68%), Postives = 59/136 (43.38%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNC-KEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVC 1012
            H WT     K  +CN CR  L       + C  C+Y  H  C    ++ C K  +    +  ++     H W+EGN   + KC  C+K+    + +    C WC    H  C  ++   C  G LK+ IL P+S+C
Sbjct:  269 HAWTLKHFKKPTYCNFCRAMLMGVGKQGLCCIYCKYTVHQRCVSKTIHGCVKTNSKAKRSGEVMQ----HAWVEGN--SSVKCDRCHKSIKCYQSVTARHCVWCRMTFHRKC--ELSTVCDGGELKDHILLPTSIC 396          

HSP 3 Score: 53.5286 bits (127), Expect = 1.994e-6
Identity = 29/109 (26.61%), Postives = 47/109 (43.12%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTA--VARPLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQ 736
            H +  K F +P YC+ C  ++ G+   G  C  C + VH++C+S+    C    S A      + H W E  +  +  C+ C K +       A  C  C    H +C+
Sbjct:  269 HAWTLKHFKKPTYCNFCRAMLMGVGKQGLCCIYCKYTVHQRCVSKTIHGCVKTNSKAKRSGEVMQHAWVEGNSSVK--CDRCHKSIKCYQSVTARHCVWCRMTFHRKCE 375          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q6P5E8|DGKQ_MOUSE (Diacylglycerol kinase theta OS=Mus musculus OX=10090 GN=Dgkq PE=1 SV=1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 359/918 (39.11%), Postives = 537/918 (58.50%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHH-WLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEI-----NEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFP-----WDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMN 3142
             H+F K +  +P +CH CS+ +WGL   GF+C+VCNF+ HEKCL QV T CT+IA + V  P++HC+   G +KRKFC VCRK L+  PA RCE+CE H H +C  +  ++C++           ++  +HH W EGNLP  ++C +C K C SS+ +AG RCEWCG  +H++C   +  EC FG L++++LPPS V +     S      + +   ++    D   + S   +    R +    E  K     K+FDGN S+++  +R    ++   ++ V+E  L+A++I     ++ +  +      +  G+    +++++ K     DS     ++R   S   T+  LKIYPG L    +V   Y  + +N ++T++ V+   +  F  +  +   FQL+EV +     +R +  DE P     WDI    R+ S+R +  TRFY+ A      P V++FVG L   L+   Y  +L E +       S+  +Y   G ++L  TC  +AE  Y + +DT +  RPL  ++LP ++   +P D  PLLVFVN KSGG +G +L+ +FRKLLNPHQVF L  GGPLPG + F QV ++++LVCGGDGTVGW L+ L+ T +  AC  P +A+LPLGTGNDL RVLRWG GY SGE P  +L  V  A+ + +DRWT+++ + + D          E N + T      ++ MNNY G+G+DA+L+LDFH AR E P KF SR HNK VY+++GL+K+ +    + LHK+I L+ +   ++LP IEGLI +NI SWG GA+ WG + D +F KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL    PVQVDGEP++Q+PG + +  +A +  ML+K K  K RKA ++       +P P  N
Sbjct:   54 GHSFRKVTLTKPTFCHLCSDFIWGL--AGFLCDVCNFMSHEKCLKQVKTPCTSIAPSLVRVPVAHCFGSLGLYKRKFCVVCRKSLE-VPAFRCEVCELHVHPDCVPFACSDCRQCHQDGQQ----DYDTYHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSTALAPECTFGRLRSMVLPPSCVRLLSRNFSKMHCFRIPETMVLELGDGDDGVDGSA--AIGTGREVLTATESTKQT--LKIFDGNDSMRKNQFRLVTVSRLARNEEVMEAALRAYYISEDPKDFQLQALPLSGNAQALGKAGTTEEEAS-KGSCPRDSVPEAWVIR---SLPRTQEILKIYPGWL----KVGVAYVSIRVNSQSTARSVVQEVLPLFGQQVEDKERFQLIEVLMSSRQVQRTVLADEEPLLDRLWDI----RQTSVRQVSQTRFYV-AETRATAPRVSLFVGGLPPGLSPQDYSNLLHEAMATKAAVVSVSHVYSLQGAVILDVTCFAEAERLYMLARDTAVHGRPLTALVLPDVLHTKLPPDCCPLLVFVNPKSGGLKGRELLCSFRKLLNPHQVFELTNGGPLPGFHLFSQVPSFRVLVCGGDGTVGWVLAALEETRRHLACPEPSVAILPLGTGNDLGRVLRWGAGY-SGEDPFSVLVSVDEADAVLMDRWTILLDAHEIDS--------TENNVVETEPPK--IVQMNNYCGIGIDAELSLDFHQAREEEPGKFTSRFHNKGVYVRVGLQKISH---SRSLHKEIRLQVEQQEVELPSIEGLIFINIPSWGSGADLWGSDNDSRFEKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISATAPKVHMLRKAK-QKPRKAGANRDTRVDTLPAPEGN 932          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|P52824|DGKQ_HUMAN (Diacylglycerol kinase theta OS=Homo sapiens OX=9606 GN=DGKQ PE=1 SV=2)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 351/906 (38.74%), Postives = 521/906 (57.51%), Query Frame = 2
Query:  407 PAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKD--------GRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPW-DIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADS 3097
            PA    H+F K +  +P +CH CS+ +WGL   GF+C+VCNF+ HEKCL  V   CT++A + V  P++HC+   G  KRKFC VCRK L+  PA+ CE+CE H H +C  +  ++C++      +    +    HHW EGNLP  ++C +C K C SS+ +AG RCEWCG  +H++C   +  EC FG L++++LPP+ V +      +      ++   +   +E     D  + S       + Q   E  +   K+FDG+ +++R  +R    ++   ++ V+E  L+A HI        +C +            G+          +S  + ++     ++R     +E    LKIYPG L    +V   Y  V +  K+T++ V++  +     ++ +  +FQLVEV +     +R +  DE P  D +Q +R+ S+R +  TRFY+    D   P V++FVG L   L+   Y  +L E         S+  IY   G +VL   C  +AE  Y +LKD  ++ R L  ++LP ++   +P D  PLLVFVN KSGG +G  L+ +FRKLLNPHQVF+L  GGPLPGL+ F QV  +++LVCGGDGTVGW L  L+ T    AC  P +A+LPLGTGNDL RVLRWG GY SGE P  +L  V  A+ + +DRWT+++     D  EA  A   E +T   + +   ++ M+NY G+G+DA+L+LDFH AR E P KF SR+HNK VY+++GL+K+ +    + LHKQI L+ +   ++LP IEGLI +NI SWG GA+ WG + D +F KP   DGLLEV+GV+G++HMGQ+  G+R+GIRI Q  + ++TL    PVQVDGEP++Q+PG + +  +  +  ML+K K   RR   +
Sbjct:   55 PAAAPGHSFRKVTLTKPTFCHLCSDFIWGL--AGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLE-APALHCEVCELHLHPDCVPFACSDCRQ---CHQDGHQDHDTHHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRL------LPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAWAGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEV---LKIYPGWL----KVGVAYVSVRVTPKSTARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVRQVSQTRFYVAESRD-VAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGY-SGEDPFSVLLSVDEADAVLMDRWTILL-----DAHEAGSA---ENDT--ADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHS---RSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKVHMLRKAKQKPRRAGTT 926          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q6NS52|DGKB_MOUSE (Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2)

HSP 1 Score: 278.87 bits (712), Expect = 3.827e-78
Identity = 153/354 (43.22%), Postives = 204/354 (57.63%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDD-----------------------KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            LVFVN KSGG QG ++   F+ LLNP QV++L   GP+PGL+ FR V ++++L CGGDGTVGW L C++          PP+A+LPLGTGNDLAR LRWGGGY  GE  ++ILKD+  + E+ LDRW   V  +D D+                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH+ + +E DG  IDL  I  EG+ ILNI S  GG+N WG  K                         KF      D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+Q+DGEP++Q+P TI +
Sbjct:  438 LVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKAN---VVKHPPVAILPLGTGNDLARCLRWGGGY-EGENLMKILKDIESSTEIMLDRWKFEVTPNDKDE----------------KGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSE-TFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 770          

HSP 2 Score: 72.7886 bits (177), Expect = 1.625e-11
Identity = 51/183 (27.87%), Postives = 78/183 (42.62%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKL--DDNPAIRCEICEYHSHIECQDYVVNNC-KEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQN 1153
            H W      K  +CN+C   L       + C  C+Y  H  C      +C K       N  +++    H+W+EGN P  +KC  C+K     + + G  C WC    H  C   +  EC  GPLK+ ILPP+++C     ++M S  G S     +ST++       +     DK  ++  N
Sbjct:  244 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKKNTDVMH----HYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTIC--PVVLTMPS-AGASVPEERQSTAKKEKSSSQQPNKATDKNKMQRAN 417          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|P49621|DGKB_RAT (Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.129e-77
Identity = 152/354 (42.94%), Postives = 204/354 (57.63%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDD-----------------------KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            LVFVN KSGG QG ++   F+ LLNP QV++L   GP+PGL+ FR V ++++L CGGDGTVGW L C++          PP+A+LPLGTGNDLAR LRWGGGY  GE  ++ILKD+  + E+ LDRW   V  +D D+                  D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH+ + +E DG  IDL  I  +G+ ILNI S  GG+N WG  K                         KF      D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+Q+DGEP++Q+P TI +
Sbjct:  437 LVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKAN---VVKHPPVAILPLGTGNDLARCLRWGGGY-EGENLMKILKDIESSTEIMLDRWKFEVTPNDKDE----------------KGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSE-TFSATCKKLHESVEIECDGVQIDLINISLQGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 769          

HSP 2 Score: 72.0182 bits (175), Expect = 2.973e-11
Identity = 49/182 (26.92%), Postives = 77/182 (42.31%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKL--DDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQN 1153
            H W      K  +CN+C   L       + C  C+Y  H  C     +  K       N  +++    H+W+EGN P  +KC  C+K     + + G  C WC    H  C   +  EC  GPLK+ ILPP+++C     ++M +  G S     +ST++       +     DK  ++  N
Sbjct:  244 HVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCARAPPSCIKTYVKSKKNTDVMH----HYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTIC--PVVLTMPT-AGTSVPEERQSTAKKEKGSSQQPNKVTDKNKMQRAN 416          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|P49620|DGKG_RAT (Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.591e-77
Identity = 162/377 (42.97%), Postives = 212/377 (56.23%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDDKFV---------KPTHY--------DGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML----KKTKLGKRRKADSSN 3103
            LV VN KSGG QG +++  F  LLNP QVFNL+ GGP PGL  F+   ++++L CGGDGTVGW L C+D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILK++  +  + LDRW L V      ++E +   Q+  N            IMNNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  +  +  TCK LH  I LE DG  +DL  I  EG+ ILNI S  GG N WG  K ++ V          P           D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I  K  LP+QVDGEP++Q P  I +       +M+    K +    RRK+ S +
Sbjct:  433 LVLVNPKSGGRQGERILQKFHYLLNPKQVFNLDKGGPTPGLNFFQDTPDFRVLACGGDGTVGWILDCIDKAN---FTKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL-TKILKEIEQSPLVMLDRWYLEVMP----REEVENGDQVPYN------------IMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSE-TFAATCKKLHDHIELECDGVEVDLSNIFLEGIAILNIPSMYGGTNLWGETKKNRAVIRESRKSVTDPKELKCCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVTIRTKKLLPMQVDGEPWMQPPCMIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD 788          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A4E0S0S3 (Diacylglycerol kinase OS=Fasciola hepatica OX=6192 GN=D915_005279 PE=3 SV=1)

HSP 1 Score: 1110.9 bits (2872), Expect = 0.000e+0
Identity = 529/891 (59.37%), Postives = 677/891 (75.98%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDE-DSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQV-TSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIED-PHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRR 3085
             H+FI+K+ H+PA CHHC E++WGL++ GF CE+CN L HE+C + V++ CT+IA   +  P+SHCW+E   FKRKFCNVCRK+L+D+ ++RCE+CEY+ H ECQDY VN+CK+GA Y P   +   +Q HHW EGNLPPNSKC  C K C+SSEC+ GYRC+WCG  +H  C  Q+  EC FGPL++I+LP   + +PR+ I +E IIG+++R   ++ SEDW+   DSKE+S+ D+RS K+  ++   ++Y  VFDG G LKRR  R F+F+K+MS+ + +++CLK FH+ G  D Y + E+N++DGREN L+  +NF+SQL FD K+P I+LR  E  +ET   +KIY GDL Y      S ++ V I   TTS + +  A+ +F C  L   +  L  VC DR VTER + + E    ++ +LR +S R+ +LTRF ++  ED P    V++FVGNL ENL+Q +YE +LLEKLG + +W +I+ IYYESGCLVL+Y   E+AE  YE+LKD+ + D+PL  ++LPRI PRM+P+ + PLLVFVNLKSGGCQG  LI AFR+LLNP QVFNL+YGGPLPGLYCFR + +YKILVCGGDGTVGW LSCLD  GQDAACNSP IA LPLGTGNDLARVLRWG GY+S E PL ILKDVV AEE++LDRWT VV+ D+  KDE KLAL+++TN  NTNED+SI+IIMNNYFG+G+DADL+LDFHNARSENP+KFNSR+HNK VY K+GLRKM+ RT CKDLHKQIV+ ADG+ + LP IEGLI+LNI+SWGGGANPWG EKDD F KPTHYDGLLEV+G+SG++HMGQIYSG+  GIR+ QAGHLKI LK +LP+Q+DGEPFI   G I VL+SALRA ML+K K  KRR
Sbjct:  123 GHSFIRKNLHKPACCHHCGELIWGLLSTGFQCEICNLLTHERCHAAVYSPCTSIAPLRIKSPMSHCWSESVHFKRKFCNVCRKRLEDSLSVRCEVCEYYCHTECQDYAVNDCKKGATYMPGKPVTPPRQTHHWREGNLPPNSKCATCRKTCWSSECLTGYRCQWCGLTAHAACLSQLAEECDFGPLRDIMLPACCISLPRSTIPIEHIIGITRRPRSRAISEDWSSSGDSKEDSWQDRRSPKETIDRASSDEYVCVFDGIGGLKRRSGRSFSFSKTMSTYSAVKRCLKTFHLAGTPDFYNVYEVNDRDGRENKLNANANFRSQLRFDVKQPSIVLRAKEP-EETVFSVKIYAGDLGYLLPPNASDHETVLITTSTTSADAVAAALDKFGCGHLGPEDCYLSTVCTDRVVTERRMSSHELLVALLSQLRHESSRTAQLTRFEIRFTEDSPGSHTVSVFVGNLKENLSQRLYECILLEKLGESCRWDTIDAIYYESGCLVLTYRSSERAERAYELLKDSMLMDKPLTALLLPRIHPRMLPEGVQPLLVFVNLKSGGCQGMDLIVAFRRLLNPFQVFNLDYGGPLPGLYCFRHLSSYKILVCGGDGTVGWVLSCLDIVGQDAACNSPAIAPLPLGTGNDLARVLRWGSGYSSAEDPLTILKDVVTAEEVQLDRWTFVVRPDEEFKDETKLALELQTNASNTNEDNSIMIIMNNYFGIGIDADLSLDFHNARSENPSKFNSRIHNKGVYFKIGLRKMINRTACKDLHKQIVVVADGNIVMLPPIEGLIVLNILSWGGGANPWGVEKDDVFAKPTHYDGLLEVVGISGVVHMGQIYSGLGTGIRLAQAGHLKILLKTELPIQIDGEPFIHPAGQIVVLRSALRATMLRKVKRMKRR 1012          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: G4V6E6 (Diacylglycerol kinase OS=Schistosoma mansoni OX=6183 GN=Smp_036180 PE=3 SV=1)

HSP 1 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 522/893 (58.45%), Postives = 684/893 (76.60%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDE-DSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDL-VYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPH-GPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEK-DDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRR 3085
              H+FI+++ H+PAYCHHC EV+WG+++ GF CE+CN L HE+C + V + CT++A   +  P+SHCW++ G FKRKFCNVCRK+L+D+ ++RCE+CEY+ H++CQDY +N+CK+GA  +P   L + +Q HHW EGNLP NSKC IC K C+SSEC+ GYRC+WCG  SH  C +++  EC FGPL++I+LP   V +PR  I +E +IGV+KR   ++ S DW+   +SKE+S+ D RS ++  ++   ++Y  VFDG G+LKRR  R F+F+KSMS+ + +++ LK FH+ G  D Y + E+NE DG EN L+   N ++QL FD K+P I++R  E  +E+   +K+Y GDL +  A     Y+EV IN +TT+ +V+ MA+  F C  +N ++  L  VC+DR+V+E+ +  D+ P  ++ +LR++S R  + TRF L+ +EDP   P V++FVGNL ENL+Q +YE++LL+KLG   +W SIEVIYYESGCLVL+Y   EKAE  YE+L ++   D+PL  ++LP I P+ +P  I PLLVFVNLKSGGCQG  LI AFR+LLNP QVFNL+YGGPLPGLYCFR + +YKILVCGGDGTVGWTLSCLD  GQDAACN+PPIA LPLGTGNDL+RVLRWG GY+S + PL ILKDVV AEE+KLDRWTL+V+ ++  KDE KLAL+++TN  NTNED+SI+IIMNNYFG+G+DADLALDFHNARSENP+KFNSR+HNK VY K+GLRKM+ RT CKDLHKQIV+ ADG  + LP IEGL++LNI+SWGGGANPW  EK DD+FVKPTHYDGLLEV+G+SG++HMGQIYSG+  GIR+ QA HLKI LK++LP+QVDGEPFI  PG ITVL+SAL A ML+K K  KRR
Sbjct:   84 QGHSFIRRTLHKPAYCHHCGEVIWGILSSGFQCEICNLLAHERCQTVVSSPCTSVAPLQIKSPVSHCWSDVGRFKRKFCNVCRKRLEDSLSVRCEVCEYYCHVDCQDYSINDCKQGATCSPGKPLCSPRQTHHWREGNLPTNSKCFICRKTCWSSECLTGYRCQWCGRTSHAGCIEKVEDECDFGPLRDIMLPSFCVSLPRMNIPIEHVIGVTKRPRGRAISADWSSSGESKEDSWQDTRSPRETIDRASSDEYVYVFDGVGALKRRSCRSFSFSKSMSTYSAVKRFLKTFHLAGTPDYYNVYEVNEHDGTENKLNYHVNLRNQLRFDLKQPSILIRSKEP-EESTITIKVYAGDLRLLLAPYVPPYEEVTINSETTASKVVAMALNNFGCGHMNPDDCYLSSVCVDRTVSEQLLNKDDRPMLLLDQLREESARISQFTRFELRFVEDPPISPSVSLFVGNLKENLSQRLYERVLLDKLGEKCRWDSIEVIYYESGCLVLNYHSSEKAEQAYELLNESIFMDKPLTALLLPTIRPQSLPKGIQPLLVFVNLKSGGCQGVDLIVAFRRLLNPFQVFNLDYGGPLPGLYCFRHLVSYKILVCGGDGTVGWTLSCLDIVGQDAACNAPPIAPLPLGTGNDLSRVLRWGSGYSSADDPLTILKDVVAAEEVKLDRWTLIVRPEEDFKDETKLALELQTNASNTNEDNSIMIIMNNYFGIGIDADLALDFHNARSENPSKFNSRIHNKGVYFKIGLRKMINRTICKDLHKQIVVVADGKIVMLPPIEGLVVLNILSWGGGANPWTVEKHDDEFVKPTHYDGLLEVVGISGVVHMGQIYSGLGTGIRLAQAAHLKIWLKSELPIQVDGEPFIHPPGQITVLRSALSANMLRKVKRPKRR 975          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A4Z2D636 (Diacylglycerol kinase OS=Schistosoma japonicum OX=6182 GN=EWB00_004395 PE=3 SV=1)

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 520/892 (58.30%), Postives = 680/892 (76.23%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDE-DSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDL-VYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPH-GPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRR 3085
              H+FI+++ H+PAYCHHC EV+WGL++ GF CE+CN L HE+C + V + CT++A   +  P+SHCW++ G FKRKFCNVCRK+L+D+ ++RCE+CEY+ H++CQDY +N+CK+GA  +P   + + +Q HHW EGNLP NSKC IC K C+SSEC+ GYRC+WC    H  C +++  EC FGPL++I+LP   V +PR  I +E +IGV+KR   ++ S DW+   +SKE+S+ D RS ++  ++   ++Y  VFDG G+LKRR  R F+F+KSMS+ + +++ LK FH+ G  D Y + E+NE DG EN L+   N +SQL FD K+P I++R  E    T   +++Y GDL +  A     Y+EV I  +TT+ +V+ MA+  F C  ++ ++  L  VC+DR+V+E+ +  D+ P  I+ +LR++S R  + TRF L+ + DP  GP V++FVGNL ENL+Q +YE++LLEKLG   +W SIEVIYYESGCLVL+Y   EKAE  YE+L ++   D+PL  ++LP I P+ +P  I PLLVFVNLKSGGCQG  LI AFR+LLNP QVFNL+YGGPLPGLYCFR + +YKILVCGGDGTVGWTLSCLD  GQDAACN+PPIA LPLGTGNDL+RVLRWG GY+S + PL ILKDVV AEE+KLDRWTL+V+ ++  KDE K AL+++TN  NTNED+SI+IIMNNYFG+G+DADLALDFHNARSENP+KFNSR+HNK VY K+GLRKM+ RT CKDLHKQI++ ADG  + LP IEGL++LNI+SWGGGANPW  EKDD+FVKPTHYDGLLEV+G+SG++HMGQIYSG+  GIR+ QAGHLKI LK++LP+QVDGEPFI  PG ITVL+SALRA ML+K K  KRR
Sbjct:   81 QGHSFIRRTLHKPAYCHHCGEVIWGLLSSGFQCEICNLLAHERCQTVVSSPCTSVAPLHIKSPVSHCWSDLGHFKRKFCNVCRKRLEDSLSVRCEVCEYYCHVDCQDYSINDCKQGATCSPGKPVCSPRQTHHWREGNLPTNSKCFICRKTCWSSECLTGYRCQWCSRTGHAGCIEKVDDECDFGPLRDIMLPSFCVSLPRMNIPIEHVIGVTKRPRGRAISADWSSSGESKEDSWQDTRSPRETIDRASSDEYVCVFDGVGALKRRSCRSFSFSKSMSTYSAVKRFLKTFHLSGTPDYYNVYEVNEHDGTENKLNYHVNLRSQLRFDLKQPSILIRSKEPEDSTI-TIRVYAGDLRLLLAPHVPPYEEVTITSETTASKVVAMALNNFGCGHMSPDDCYLSSVCVDRTVSEQLLNKDDRPMLILDQLREESARMSQFTRFELRFVADPPIGPSVSLFVGNLKENLSQRLYERVLLEKLGEKCRWDSIEVIYYESGCLVLNYHSSEKAERAYELLNESVFMDKPLTALLLPTIHPQNLPKGIQPLLVFVNLKSGGCQGIDLIVAFRRLLNPFQVFNLDYGGPLPGLYCFRHLVSYKILVCGGDGTVGWTLSCLDIVGQDAACNAPPIAPLPLGTGNDLSRVLRWGSGYSSADDPLTILKDVVAAEEVKLDRWTLIVRPEEDFKDETKCALELQTNASNTNEDNSIMIIMNNYFGIGIDADLALDFHNARSENPSKFNSRIHNKGVYFKIGLRKMINRTICKDLHKQIIVVADGKIVILPPIEGLVVLNILSWGGGANPWSVEKDDEFVKPTHYDGLLEVVGISGVVHMGQIYSGLSTGIRLAQAGHLKIWLKSELPIQVDGEPFIHPPGQITVLRSALRANMLRKVKRPKRR 971          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A4S2LYV2 (Diacylglycerol kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_004063 PE=3 SV=1)

HSP 1 Score: 1066.6 bits (2757), Expect = 0.000e+0
Identity = 514/900 (57.11%), Postives = 663/900 (73.67%), Query Frame = 2
Query:  413 FKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDE-DSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLV-YCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLK-AIEDPHGP-GVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSS 3100
             +  H F K++ H+PA CHHC EV+WGL++ GF CE CN L HE+C   V++ CT++A   V    SHCW++P  FKRKFCNVCRK+L+   ++RCE+CEY+ H++CQDY VN+CK GA++ P   +    Q HHW EGNLPPNSKC  C K C+SSEC+ GYRC+WCG  +H  C  Q+  +C FG L++I+LP   V +PR    +E II + KR   ++ SE+W+   DSKE+S+ D RS ++  +    ++Y  VFDG G L+R  +  F F+K+MS+ +V+++CLKAFH+ G  + + + E+N++DGREN L+   NF+SQL FD+K+P I+LR  E  +ET   +K+Y GDL     Q  S Y+EV I+  TTS + + +A+ +F C  L  ++  L  VC+DR V ER + +DE       +LR++S R+ +LTR  L+  ++D  G   V++FVGNL ENL+Q +YE +LLEKLG   +W +I+ IYYESGCLVL+Y   EKAE  Y++LKD  + D+ L  ++LP I PR +P  + PLLVFVNLKSGGCQG  LI AFR+LLNP QVFNL+YGGPLPGLYCFR + +YKIL+CGGDGTVGWTLSCLD  GQDAACNSPPIA LPLGTGNDLARVLRWG GY+S E PL ILKDVV AEE++LDRWT VV+  +  KDE KLAL+ + N   TNE++SI+IIMN+YFG+G+DADL+LDFHNARSENP+KFNSR+HNK VY K+GLRKM+ RT CKDLHKQIV+ ADG  + LP IEGLI+LNI SWGGGANPWG EKDD F KPTHYDGLLEV+G+SG++HMGQIYSG+ +GIR+ QAGHLKI LK +LP+Q+DGEPFI  PG I VL+SALRAIML+K K  KRR  + S
Sbjct:  121 LRLGHLFFKRTLHKPACCHHCGEVIWGLISTGFQCEFCNLLAHERCHLSVYSSCTSVAPLHVKFHTSHCWSDPVHFKRKFCNVCRKRLEGTMSVRCEVCEYYCHVDCQDYAVNDCKRGASFQPGKPMFPPPQTHHWREGNLPPNSKCAHCRKTCWSSECLTGYRCQWCGLTAHASCVPQLSDKCDFGTLRDIMLPAQCVSLPRPTTPIEHIIEIIKRPRSRTLSEEWSSSGDSKEDSWQDHRSPRETADLASSDEYVCVFDGIGGLRRHSWHSFTFSKTMSTYSVVKRCLKAFHLAGTPEIFNVYEVNDRDGRENKLNLNVNFRSQLLFDAKQPSIVLRVKEP-EETEMLIKVYAGDLRNILPQNASDYEEVWIDPSTTSADCLNIALEKFGCGHLGSDDCYLSSVCMDRQVYERRLADDELLVSFFSQLRQESARTSQLTRLELRFVVDDAAGSHAVSLFVGNLKENLSQRLYECILLEKLGEEYRWDTIDAIYYESGCLVLTYRASEKAERAYDLLKDAMLMDKQLTALLLPTIHPRHLPAGVQPLLVFVNLKSGGCQGLDLIVAFRRLLNPFQVFNLDYGGPLPGLYCFRHLSSYKILICGGDGTVGWTLSCLDIVGQDAACNSPPIAPLPLGTGNDLARVLRWGSGYSSTEDPLSILKDVVAAEEVQLDRWTFVVRPAEEFKDETKLALETQNNAPTTNEENSIMIIMNSYFGIGIDADLSLDFHNARSENPSKFNSRIHNKGVYFKIGLRKMMNRTACKDLHKQIVVVADGKLLTLPPIEGLIVLNIHSWGGGANPWGLEKDDVFSKPTHYDGLLEVVGISGVVHMGQIYSGLGSGIRLAQAGHLKILLKTELPIQIDGEPFIHPPGQIVVLRSALRAIMLRKVKRIKRRTVEGS 1019          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A267GA50 (Diacylglycerol kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009469g1 PE=3 SV=1)

HSP 1 Score: 1057.74 bits (2734), Expect = 0.000e+0
Identity = 493/925 (53.30%), Postives = 668/925 (72.22%), Query Frame = 2
Query:  407 PAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTD---EDSKEES---------YIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTK---LGKRRKADSSNTGP-PSRIPLP 3133
            P   H H+FIK++FHRP YCHHC+E++WGL++ GF C +C+F VH++CL  V + CT IA   V RP+SHCW+EP  FKRKFCNVCRK+LDD PA+RCEICEY+ H+ECQD+V N+CKE A Y P    L     HHW EGNLP NSKC +C + C+SSEC++GYRCEWCG  +H  C + +P EC FG L  I+L PS+V +PRT I ++ I G+ +R+  ++ SEDW+    + +++E+         Y D+RS KD+  +E +ED  K++DGNG+ +R+ YR  +  +  +   + E  L+ +H+   +  Y + E+NE+DG E  LD+ +  K Q  FDS+RP ++LR+ E +   R  +++YP  L Y A+V + +K V + K+TT++E I+ A+++F  E L+ +   LVEV LD+ V+ER +  DE P  ++  +R++S+R   LTRFY++ + DP   G+ ++VGNL   ++Q VYEK+L+EKLG  NKW SI+VIYYE G +VL Y    + +  Y  L+D    D+P++V++LP++ P MIPD   P+LV VN+KSGGCQG +LITAFRKLLNPHQVFNL+YGGPLPGLY FRQV  YKILVCGGDGTVGW LSCLD+ G DA CN PP+A++PLGTGNDL+RVLRWG GY+  E PL IL+DV  AE + LDRWT++   ++ +KDE K+ LQ E+N  NTNED++ + +MNNYFG+GLDAD++LDFH AR+ENP+KFNSR HNK VY KM +RKM+ + +CKDLH+QI++E DG  IDLP +EG+IILNI+SW  GANPWG EKDD F +P H+DG LEV+GV+GM+HMGQI+SG+R+G RI Q GH+KITLK D+PVQ+DGEP++QS G + VL+SALRA MLKK K    G+   A+ S   P PS+ P P
Sbjct:   62 PESGHKHSFIKRTFHRPTYCHHCAEMLWGLLSQGFTCSLCSFTVHDRCLKSVLSPCTCIAPNMVLRPVSHCWSEPAHFKRKFCNVCRKRLDDYPAVRCEICEYYCHLECQDFVTNDCKECATYGPESQQLG--PAHHWREGNLPGNSKCAVCKRTCWSSECLSGYRCEWCGLTAHAGCHRALPAECSFGILGEIVLRPSAVTLPRTDIPLDKIYGLQRRNTSRTISEDWSSSGGDSTRDEAAAVANQASGYQDRRSPKDR--QEVNEDLVKIYDGNGAAQRKQYRIVSIQRGTTLAQLTECALRVYHVLDDARLYTLVELNERDGSERRLDESAPLKQQFRFDSRRPAVVLRYREKDA-NRASIRVYPTGLQYFARVPTNFKYVTVTKETTAQETIVYALKKFGVEQLDASQLDLVEVSLDKQVSERTLARDEKPLQLLHSVRRESVRQYMLTRFYIQPVIDPRYTGLALYVGNLKTGMSQRVYEKILMEKLGSENKWDSIDVIYYEYGAMVLVYKNPRRLQQAYNSLRDQWFDDKPMLVLLLPQLHPEMIPDGTTPVLVLVNVKSGGCQGIELITAFRKLLNPHQVFNLDYGGPLPGLYVFRQVSYYKILVCGGDGTVGWALSCLDNVGPDAKCNYPPMAIVPLGTGNDLSRVLRWGSGYSGQEYPLNILRDVAEAEVVTLDRWTVIFHPEEKEKDETKVQLQYESNAANTNEDNASIFVMNNYFGIGLDADVSLDFHLARNENPSKFNSRFHNKGVYFKMSVRKMMSKGSCKDLHRQIIVEVDGKVIDLPPLEGIIILNILSWASGANPWGTEKDDNFNRPNHWDGQLEVVGVTGMVHMGQIFSGLRSGNRIAQGGHIKITLKGDIPVQIDGEPWVQSSGQVVVLRSALRASMLKKCKGKSKGRGALAEPSFYNPEPSQCPTP 981          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: DGKQ (diacylglycerol kinase theta [Source:HGNC Symbol;Acc:HGNC:2856])

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 336/897 (37.46%), Postives = 509/897 (56.74%), Query Frame = 2
Query:  407 PAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCK-----EGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDG--------RENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML 3058
            PA    H+  + +  +P +CHHCS+ +WGL  VG++CEVCNF+ HEKCL  V T+C+ +A++ V  P++HC+  P + K++FC VCRK L+   A+RCE+CE H H +C  +  ++C+      G  Y            HHW EGN+   ++C IC + C SS+ ++G RCEWCG  +H  C+  IP EC  G L+++IL PSSV +     S      +S+     S+ +        E+     R      E ++     KVFDG+ ++KR  +R  +  +   ++ V+E  L+AF+I  +  +Y +    ++ G        R    D+K+ FK     DS     +LR      E    LKI  G L    +    Y  + + K +T   V+   + +   +   ++ + L+       +                     S+R +  TRFY+   ++     V + +G L +NLN   Y ++L + L + +   +I  +Y   G + L  +C  +AE  Y + +DT I  + L  +++P I+   +     PLLVFVN KSGG +G +++  FRKLLNPHQVF L  GGPLPGL+ FR+V ++++LVCGGDGTVGW L  L++     +C  P I+++PLGTGNDLARVLRWG GY SG+ P  +L  V  A+E+++DRWT++  + + ++D           T N   +   ++ MNNYFG+G+DA+L+LDFH+AR E P KFNSR HNK VY+K+GL+K+ +    ++LHK + LE D   I+LP IEGLI LNI SWG GA+ WG + D +F KP   DG+LEV+GV+G++HMGQ+ SG+R+GIRI Q  +++IT+   +PVQVDGEP+IQ+PG I +  +  +  ML
Sbjct:   53 PASNLGHSLRRVTLTKPTFCHHCSDFIWGL--VGYLCEVCNFMSHEKCLKHVRTVCSCMAASVVRVPVAHCFG-PASQKKRFCCVCRKNLEGTAALRCEVCELHVHSDCAPFSCSDCRLCHQDGGQEYD--------MYHHHWREGNIASGARCEICRRACSSSDVLSGMRCEWCGITAHASCYVIIPPECSLGRLRSMILHPSSVRVCSRNFSKMHCYRISE-----SSQQCELGNPGGEKRLGPPRKTPTATEWKQ---TLKVFDGDDAVKRNQFRLVSIPRITKNEEVVEAALRAFYIPDEPQDYELQIHTQQQGLLTDDIINRNGTPDNKAVFK-----DSPPEAWLLRAKPQEAEL---LKICAGWL----RSGIAYISITVGKSSTVDSVLKEVLIQLGKQVTVLHLYLLINTITGIHI---------------------SLRQMNQTRFYVVENQN-RVVQVELLLGGLPQNLNTEEYTQLLQQHLEIKSHLVTISQVYAGQGAVALQISCFSEAERIYMLARDTSINGKQLTCLVIPEIMKSKLIQGCSPLLVFVNPKSGGLKGREILYGFRKLLNPHQVFELTSGGPLPGLHTFREVPHFRMLVCGGDGTVGWVLGVLEAIRHKLSCPEPAISIVPLGTGNDLARVLRWGAGY-SGDDPYNVLVSVSEADEVEMDRWTILFDAQEMNED----------GTQNGFLEPPKIVQMNNYFGLGIDAELSLDFHHAREEEPGKFNSRFHNKGVYVKVGLQKLSH---TRNLHKDLKLEVDKQDIELPSIEGLIFLNIPSWGSGADLWGSDSDSRFEKPRIDDGMLEVVGVTGVVHMGQVQSGLRSGIRIAQGSYIRITVTKPIPVQVDGEPWIQAPGQIIISAAGPKVHML 882          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:103047572])

HSP 1 Score: 261.922 bits (668), Expect = 7.257e-74
Identity = 152/351 (43.30%), Postives = 209/351 (59.54%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWGPEK--DDKFVKPTH------------------YDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            LVFVN KSGG QG +++  F+ LLNP QV+NL  GGP PGL+ FR ++ YKILVCGGDGTVGW L  +D    D A N PP+A+LPLGTGNDLAR LRWGGGY  G    +ILK++  +  +K+DRW + V  +  D++E    L  E              I+NNYF +G+DA +A  FH  R ++P KFNSR  NK  Y ++   + +   +CK+L + + ++  G  +DL    +EG+ +LNI S  GG+N WG  K  +D +    H                   D LLEV+G+ G I MGQIY+G+++ G R+ Q   + I  K  LP+Q+DGEP++Q P TI +
Sbjct:  381 LVFVNPKSGGKQGGRVLRKFQYLLNPRQVYNLSNGGPNPGLHFFRNLQKYKILVCGGDGTVGWVLDAIDKA--DMAIN-PPVAILPLGTGNDLARCLRWGGGY-EGSDLSEILKEIEESVVMKMDRWKVQVVPN--DENEVGDPLPSE--------------IINNYFSIGVDASIAHRFHTMREKHPQKFNSRAKNKLWYFELATSETI-SASCKNLRECLTIQCCGVRLDLSSHSLEGIAVLNIPSMHGGSNLWGETKKTEDVYKDGGHCPQVITDTDVLERSSQDMSDKLLEVVGLEGAIEMGQIYTGLKSKGHRLAQTTQIMIKTKKALPMQIDGEPWMQPPCTIHI 710          

HSP 2 Score: 59.6918 bits (143), Expect = 1.995e-8
Identity = 37/116 (31.90%), Postives = 46/116 (39.66%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F+RP YC  C  ++ GL   G  C VC   VH  C ++  + C  T I S        H W        K C +C KK+      RC  C    H EC      NC  G
Sbjct:  215 HVWRMKHFNRPTYCFVCQNMLLGLGKQGLSCNVCKCTVHSHCANKYHSPCAATFITSKEEIGLAVHAWVSADCDSSK-CEICHKKIKALAGKRCVWCHLTRHNECVSVGSVNCDCG 329          

HSP 3 Score: 58.5362 bits (140), Expect = 4.151e-8
Identity = 41/157 (26.11%), Postives = 66/157 (42.04%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKS 1078
            H W      +  +C VC+  L       + C +C+   H  C +   + C   A +  +   +     H W+  +   +SKC IC+K     + +AG RC WC    H  C     + C  GPLK+ +LPP ++C    K      +  S  +N+ S
Sbjct:  215 HVWRMKHFNRPTYCFVCQNMLLGLGKQGLSCNVCKCTVHSHCANKYHSPC--AATFITSKEEIGLA-VHAWVSADCD-SSKCEICHKKI---KALAGKRCVWCHLTRHNECVSVGSVNCDCGPLKDHVLPPWAICSVNKKDGGSHCLEESDLANITS 364          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkaa (diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZDB-GENE-060616-305])

HSP 1 Score: 250.751 bits (639), Expect = 5.701e-70
Identity = 141/359 (39.28%), Postives = 207/359 (57.66%), Query Frame = 2
Query: 2054 VNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWG-PEKDDK--------FVKPTHY--------DGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL-KSALRAIMLKKTK 3070
            +++  GG QG +++  F+ LLNP QV+NL  GGP PGL  FR +++Y+ILVCGGDGTVGW L  +D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILKD+  +  +++DRW++ V  +D  +    +  +                I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y +    + +   +CK L + + +E  G  +DL    +EG+ +LNI S  GG+N WG  +K D+         V P           D  LEV+G+ G + MGQIY+G+++ +R+ +   + I  K  LP+Q+DGEP++Q P TI +  K+    +M  ++K
Sbjct:  395 MDVSDGGKQGERVLRKFQYLLNPRQVYNLSSGGPGPGLCFFRDLQDYRILVCGGDGTVGWILDAIDKASLPV---RPPVAVLPLGTGNDLARCLRWGGGY-DGVDLGRILKDIEFSTPVQMDRWSVEVVLEDSQERGDPVPYE----------------IINNYFSIGVDASIAHRFHTMREKHPQKFNSRMKNKLWYFEFATSETI-SASCKKLKECLTIECCGVQLDLSNLSLEGIAVLNIPSMHGGSNLWGEAKKSDRGGQDLPEVIVDPEELKVSPQDLSDKRLEVVGLEGAMEMGQIYTGLKSAVRLAKTSQITIRTKKPLPMQIDGEPWMQPPCTIHITHKNQASMLMAPQSK 732          

HSP 2 Score: 65.0846 bits (157), Expect = 4.218e-10
Identity = 42/134 (31.34%), Postives = 57/134 (42.54%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSV 1009
            H W      K  +CNVC+  L       + C  C+Y  H  C +   + C     Y  +   +     H W+ GN   + KC  C K   S   + G RC WC    H  C  Q P EC  GPL++ ILPP ++
Sbjct:  208 HLWRMKHFNKPVYCNVCQNMLLGLRKQGLCCTCCKYTVHGRCANRNPDPCTR--TYVMSKKDIGVST-HDWVSGNCD-SGKCDRCQKKIKSLHGLTGKRCVWCHTLRHDECVNQEPSECNCGPLRDHILPPWAI 337          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgke (diacylglycerol kinase, epsilon [Source:ZFIN;Acc:ZDB-GENE-090512-7])

HSP 1 Score: 234.958 bits (598), Expect = 7.491e-66
Identity = 143/345 (41.45%), Postives = 197/345 (57.10%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVK--NYKILVCGGDGTVGWTLSCLDST---GQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPL-QILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKND-LPVQVDGEPFIQSPGTITVLKSALRAIML 3058
            LV  N +SG   G  L+  FR LLNP QVF+L    P   L     +   + ++LVCGGDGTVGW L  +D+    GQD     P + +LPLGTGNDL+  L WG GY +GE P+ Q++++V+ AE +K+DRW + V S      + K+                  + MNNYF VG DA +AL+FH  R + P+ F+SR+ NK VY   G +  + +  CKDL K+I LE DG  + LP +EG+I+ NI  WGGG   W    D+        DGLLEV+GV G  H  QI   + N +R+ QA  +++ LK+  +P+QVDGEP+ Q P TIT+     +A+ML
Sbjct:  215 LVLANTRSGNNMGEVLLGEFRTLLNPVQVFDLSEIQPAKALQLCTLLPPGSVRVLVCGGDGTVGWVLDAIDTMKLKGQDQFI--PRVTILPLGTGNDLSNSLGWGSGY-AGEIPVEQVIRNVLDAELVKMDRWKVQVASKGTYFRKPKV------------------LSMNNYFSVGPDALMALNFHAHREKTPSVFSSRIINKAVYFLYGTKDCLVQE-CKDLDKRIELELDGERVALPSLEGIIVCNIGYWGGGCRLWEGMGDEPCPPTRLDDGLLEVVGVFGSFHCAQIQVKLANPVRLGQAHTVRLVLKSSRMPMQVDGEPWAQGPCTITITHKT-QALML 536          

HSP 2 Score: 53.5286 bits (127), Expect = 1.096e-6
Identity = 39/133 (29.32%), Postives = 57/133 (42.86%), Query Frame = 2
Query:  614 HCWTEPGTF-KRKFCNVCRKKLDDNPAIRC-EICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIP--IECKFGPLKNIILPP 1000
            H W     F K  +C VC + +       C  IC     +   D+ +  CKE  A  P  +  +F   H W+ GN+P  S C +C + C +   +  YRC WC    H  C   +    +C  G   +II+PP
Sbjct:   56 HGWHYTDLFNKPTYCCVCTQPILQGAFCECCGICSDEVCVRKADHTLP-CKEIMA--PAQADGSF--LHRWVRGNVPLASYCTVCKQQCGTQPKLCDYRCVWCQATVHDDCKAGLSGGEQCDLGEFCSIIIPP 183          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkzb (diacylglycerol kinase zeta [Source:NCBI gene;Acc:103036104])

HSP 1 Score: 237.269 bits (604), Expect = 6.304e-64
Identity = 153/376 (40.69%), Postives = 205/376 (54.52%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACN-SPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP------QIEGLIILNIMSWGGGANPWG-PEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALR--AIMLKKTKLGKRRKADSSNTGPPSRIPLPLMN 3142
            LVFVN KSGG QG+++I +F   LNP QVF+L  GGP  GL  +R+V N +ILVCGGDGTVGW LS LD    D   N  P +AVLPLGTGNDLAR L WG GYT  E   +IL  V     ++LDRW L V+ +    ++ K   Q +   +N         + NNYF +G DA + L+FH +R   P KFNSR+ NK  Y        + R++ KDL K I +  DG  +DL       +++ L+ LNI  +  G  PWG P +   F    H DG +EVIG + M  +  +  G  +G R+ Q   + +T    +PVQVDGEP   +P   ++++  LR  A M++KTK                RI LP +N
Sbjct:  309 LVFVNPKSGGNQGSKIIRSFMWFLNPRQVFDLSQGGPKDGLEMYRKVPNLRILVCGGDGTVGWILSVLD----DLQLNPQPAVAVLPLGTGNDLARTLNWGAGYTD-EPVSKILSHVEDGNIVQLDRWNLSVEPNPEATEDEKDEHQTDKLPIN---------VFNNYFSLGFDAHVTLEFHESREAKPEKFNSRLRNKMFYAGTAFSDFLMRSS-KDLSKHIRVVCDG--MDLTSKVQELKLQCLLFLNIPRYCAGTTPWGNPSEHHDFEPQRHDDGCIEVIGFT-MTSLATLQVG-GHGERLHQCREVMLTTFKPIPVQVDGEPCRLAP---SIIRITLRNQANMVQKTK---------------RRISLPQLN 647          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007062.1 (pep scaffold:Pmarinus_7.0:GL477921:5350:38314:1 gene:ENSPMAG00000006363.1 transcript:ENSPMAT00000007062.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 418.313 bits (1074), Expect = 1.187e-132
Identity = 240/637 (37.68%), Postives = 371/637 (58.24%), Query Frame = 2
Query: 1181 KVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEY-------------CMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLD-RSVTERPIGNDEFPWDIIQRLRKD-SIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIK--DRPLMVXXXXXXXXXXXXXXXXXX----LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            KVFDG+ + +   Y   +  +   +  V+E  L+ + + G   +Y              M  +     R      +++  S++  D+     ++R   S+ E    +KIY   L  C  V   Y    I++  T + VI   +     ++ + ++++L EV +  R V  R +  ++   D +  +RK  S++ + LTRFY+ A  D  G    + VG L   L    Y  +L +         +I  IY + G + L  +   +AE  + +  D++I   D+ + + +LP +I    P+ +       LV +N +SGG QG +L+ +FRK +NPHQVF+L  GGPLPGL+ FR+V  +++LVCGGDGTVGW LS L+      AC  PP+A+LPLGTGNDLARVLRWG GY SGE PL +L +V  A+E+K+DRWT+++ +++P+  + + ++               ++ MNNYFG+G+DADL+L FHNAR E+P KFNSR+HNK+VY+K+GL+K+ +    ++LH+ I ++ D   IDLP +EGLI LNI SWG GA+ WG + + KF KP  +DGLLEV+GV+G++HMGQ+  G+R+GIRI Q   +++ L+ + P+QVDGEP++Q PG I V
Sbjct:    7 KVFDGDEAARAGRYHTVSVPRISRTDDVVEAALREYFLPGNPTDYELRSLSLAPKRAVSMATVTWATTRAQRATPETSSLSRVFRDTLPEAYVIRAKRSSSEV---VKIYADWL--CKGVA--YVSFRIDESHTVRSVITEVLLLLGRKNESPDDYRLTEVMMHCREVQRRVLVMEQSMLDHLHEIRKQLSVQRINLTRFYITAKLDGDG-NTQLLVGGLPPGLAAPDYLSLLHQPGSYKQNTATITQIYSKQGAVALEVSSCAEAERLFRLANDSKITVDDKIISINLLPTLILHPQPEQMPRSCHPLLVLINPRSGGMQGRELLHSFRKAVNPHQVFDLACGGPLPGLHVFREVPRFRLLVCGGDGTVGWVLSLLEDIKLKLACTQPPVAILPLGTGNDLARVLRWGPGY-SGEDPLSVLINVDEAQEVKMDRWTILLDANEPECAQERTSMPRPYQ----------IVQMNNYFGIGVDADLSLGFHNAREEDPGKFNSRLHNKSVYVKVGLQKITHN---RNLHRDIKVQVDNVDIDLPSVEGLIFLNIPSWGSGADLWGSDSEGKFSKPCMHDGLLEVVGVTGVMHMGQVQGGLRSGIRIAQGQFIRVVLQRETPIQVDGEPWLQPPGNIIV 621          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007078.1 (pep scaffold:Pmarinus_7.0:GL477921:24257:38296:1 gene:ENSPMAG00000006363.1 transcript:ENSPMAT00000007078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 379.022 bits (972), Expect = 6.770e-122
Identity = 176/328 (53.66%), Postives = 247/328 (75.30%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            LV +N +SGG QG +L+ +FRK +NPHQVF+L  GGPLPGL+ FR+V  +++LVCGGDGTVGW LS L+      AC  PP+A+LPLGTGNDLARVLRWG GY SGE PL +L +V  A+E+K+DRWT+++ +++P+  + + ++   T+T   ++D  +   MNNYFG+G+DADL+L FHNAR E+P KFNSR+HNK+VY+K+GL+K+ +    ++LH+ I ++ D   IDLP +EGLI LNI SWG GA+ WG + + KF KP  +DGLLEV+GV+G++HMGQ+  G+R+GIRI Q   +++ L+ + P+QVDGEP++Q PG I V
Sbjct:   13 LVLINPRSGGMQGRELLHSFRKAVNPHQVFDLACGGPLPGLHVFREVPRFRLLVCGGDGTVGWVLSLLEDIKLKLACTQPPVAILPLGTGNDLARVLRWGPGY-SGEDPLSVLINVDEAQEVKMDRWTILLDANEPECAQERTSMPRSTHTRVYDKD--VCTCMNNYFGIGVDADLSLGFHNAREEDPGKFNSRLHNKSVYVKVGLQKITHN---RNLHRDIKVQVDNVDIDLPSVEGLIFLNIPSWGSGADLWGSDSEGKFSKPCMHDGLLEVVGVTGVMHMGQVQGGLRSGIRIAQGQFIRVVLQRETPIQVDGEPWLQPPGNIIV 334          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007068.1 (pep scaffold:Pmarinus_7.0:GL477921:19741:38299:1 gene:ENSPMAG00000006363.1 transcript:ENSPMAT00000007068.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 377.481 bits (968), Expect = 7.058e-120
Identity = 195/445 (43.82%), Postives = 286/445 (64.27%), Query Frame = 2
Query: 1706 SIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXX----LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITV 3028
            S++ + LTRFY+ A  D  G    + VG L   L    Y  + +       K   +  + +     V++        + +    +    DR ++ + LP +     P+ +       LV +N +SGG QG +L+ +FRK +NPHQVF+L  GGPLPGL+ FR+V  +++LVCGGDGTVGW LS L+      AC  PP+A+LPLGTGNDLARVLRWG GY SGE PL +L +V  A+E+K+DRWT+++ +++P+  + + ++       +  E    ++ MNNYFG+G+DADL+L FHNAR E+P KFNSR+HNK+VY+K+GL+K+ +    ++LH+ I ++ D   IDLP +EGLI LNI SWG GA+ WG + + KF KP  +DGLLEV+GV+G++HMGQ+  G+R+GIRI Q   +++ L+ + P+QVDGEP++Q PG I V
Sbjct:    1 SVQRINLTRFYITAKLDGDG-NTQLLVGGLPPGLAAPDYLSLRVYLCQSAPKLIKVWALVHAVWSAVIAQETSSLMMVTFLKRHECNCCDRHVITVPLPSVNLHPQPEQMPRSCHPLLVLINPRSGGMQGRELLHSFRKAVNPHQVFDLACGGPLPGLHVFREVPRFRLLVCGGDGTVGWVLSLLEDIKLKLACTQPPVAILPLGTGNDLARVLRWGPGY-SGEDPLSVLINVDEAQEVKMDRWTILLDANEPECAQERTSM---PRLGDETESQYQIVQMNNYFGIGVDADLSLGFHNAREEDPGKFNSRLHNKSVYVKVGLQKITHN---RNLHRDIKVQVDNVDIDLPSVEGLIFLNIPSWGSGADLWGSDSEGKFSKPCMHDGLLEVVGVTGVMHMGQVQGGLRSGIRIAQGQFIRVVLQRETPIQVDGEPWLQPPGNIIV 437          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002929.1 (pep scaffold:Pmarinus_7.0:GL476935:158222:277059:-1 gene:ENSPMAG00000002642.1 transcript:ENSPMAT00000002929.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.159 bits (679), Expect = 1.737e-76
Identity = 150/358 (41.90%), Postives = 206/358 (57.54%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWGP--------------------------EKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL 3031
            LVFVN KSGG QG +++  F+ LLNP QV+NL  GGP PGL  FR V ++++L CGGDGTVGW L C+D     +    PP+AVLPLGTGNDLAR L WGGGY  G    + LKDV  +  L LDRW++ V + D                L+   D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  + ++  TCK L++ + +E DG  +DL    +EG+ +LNI S  GG+N WG                           +++ KF +    D LLEV+G+ G + MGQIY+G+++ G R+ Q   + I     LP+Q+DGEP++Q P TI ++
Sbjct:  311 LVFVNPKSGGKQGEKILRKFQYLLNPRQVYNLNKGGPFPGLNFFRDVPDFRVLTCGGDGTVGWVLDCIDKL---SLPKRPPVAVLPLGTGNDLARCLHWGGGYEGGSL-RKTLKDVENSTPLMLDRWSIEVIATD----------------LDEKGDPVPYSIINNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTSETLF-ATCKKLYEFMEVECDGVQLDLANSSLEGITVLNIPSMHGGSNLWGETNTRRVSRRSSMRRSGREKVQATIADQRELKFCQQDLSDHLLEVVGLDGAMEMGQIYTGLKSAGSRLAQCSSVTIRTTKLLPMQIDGEPWMQPPCTIKII 647          

HSP 2 Score: 65.0846 bits (157), Expect = 7.944e-11
Identity = 39/134 (29.10%), Postives = 59/134 (44.03%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD--NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSV 1009
            H W      K  +CN C+  L       + C  C+Y  H  C      NC    A +   + +     H+W+EGN P  +KC  C+K+    + + G  C WC    H  C   +  EC  G LK+ +LPP+++
Sbjct:  115 HVWKLKHFNKPAYCNFCKAMLIGLGKQGLCCTFCKYTVHERCVAKAPLNCISTYAKSKKSATV---MDHYWVEGNCP--AKCDKCHKSIKCYQGLTGLHCVWCHITLHNKCASHVKPECDCGQLKDHVLPPNTI 243          

HSP 3 Score: 56.9954 bits (136), Expect = 2.532e-8
Identity = 36/119 (30.25%), Postives = 53/119 (44.54%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKL---DDNPAIRCEICEYHSHIECQDYVVNNCKEG 766
            H +  K F++PAYC+ C  ++ GL   G  C  C + VHE+C+++    C  T   S   A  + H W E G    K C+ C K +        + C  C    H +C  +V   C  G
Sbjct:  115 HVWKLKHFNKPAYCNFCKAMLIGLGKQGLCCTFCKYTVHERCVAKAPLNCISTYAKSKKSATVMDHYWVE-GNCPAK-CDKCHKSIKCYQGLTGLHCVWCHITLHNKCASHVKPECDCG 231          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: dgkzb (diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB-GENE-111104-4])

HSP 1 Score: 231.876 bits (590), Expect = 8.047e-66
Identity = 142/351 (40.46%), Postives = 199/351 (56.70%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDL-PQIEGL-----IILNIMSWGGGANPWG-PEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALR--AIMLKKTK 3070
            +VF+N KSGG QG +++ +   LLNP QVF+L  GGP   L  +R+V N ++L CGGDGTVGW LS LD   Q      PP+A+LPLGTGNDLAR L WGGGYT  E   ++L  V     ++LDRW L V+   P+ D  +   +  T+  + N +   L + NNYF +G DA + L+FH +R  NP KFNSR  NK  Y        + R++ +DL K + +  DG  +DL P+I+ L     + LNI  +  G  PWG P     F    H DG +EVIG + M  +  +  G  +G R+ Q     +      PVQVDGEP   +P   ++++ +LR  A+M++K+K
Sbjct:  207 VVFINPKSGGNQGNKIMQSLMWLLNPRQVFDLGAGGPQEALELYRKVPNLRVLACGGDGTVGWILSVLD---QLQIVPPPPVAILPLGTGNDLARTLNWGGGYTD-EPISKVLSHVEEGATVQLDRWNLDVR---PNPDVGRDEQEQGTSKPSPNPNQLPLDVFNNYFSLGFDARVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSS-RDLAKHVRVMCDG--VDLTPKIQELKLQCIVFLNIPRYCAGTVPWGNPADHHDFEPQRHDDGYIEVIGFT-MASLAALQVG-GHGERLHQCREAVLATLRTTPVQVDGEPCRLAP---SIIRISLRNQALMVQKSK 542          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO34591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX6])

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 346/887 (39.01%), Postives = 521/887 (58.74%), Query Frame = 2
Query:  416 KHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPG-TFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESY--IDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKT 3067
            +  H F++K+F RP YCHHC++++WG    GF+C+VCNF+ H++C+  V   C +IA+T V  P++H W+    +F++KFC+VCR++L+D PA RC++C+Y+ H  CQD+ V +CK+ A Y P L     KQ HHW EGN   +SKC+ C  +C S EC+A  +C WC  +SHT C + +P EC +G L  + LPP  V  P                          D+  K   +    +R ++    +       KV+DGN +   R  +     ++     V+++ LK+FHI    D Y + +  ++     PLD +     Q      +P+I LR   ++K  +G ++IY G  +    V   +K +P+   T+  ++I +AM++F   + N  ++ L EV L + V ER +   E PW  +  +RK SIR ++LTRFYL+    P GP VT+ +G+L  +++++ YE ML   LG     +S  +    S  ++     G +       L+ T I  +   V ILP + P ++P +  PLLVFVN KSGG QG  +++AF++LLNPHQV+NL  GGPLPGLY F+ +  ++IL+CGGDGTVGW LSCLD          PP A++PLGTGND++RVL+WG GY+SG+TPL +L  V  AE + LDRW ++  S D   D       I        E+   + +MNNY G+G+DADL LDFH  R E P KF SR+ NK VY ++GLRKM  +T      +++ +E DG  + LP +EG++ILNI SW  GA+ WGP+KDD+F   ++ D L+EV+G++G++ MGQI SGIR+G+R+ Q   + I LK ++PVQ+DGEP++QSPG + +++ AL  + +  +
Sbjct:   32 QSGHRFVRKTFTRPTYCHHCTDMLWGFTNQGFMCDVCNFVTHDRCMIFVTIPCVSIATTLVKIPVAHTWSGLSFSFRKKFCSVCRRRLEDIPAFRCQVCDYYVHEACQDFSVTDCKQSATYVPFLGKRAVKQDHHWREGNFSASSKCVSCKHSCGSGECLASLKCSWCAQSSHTNCSQLLPKECHYGYLHRVSLPPFCVSFP--------------------------DKTPKPRHFHTFSERGVQKGFSRFYRMKKIKVYDGNLT-SPRASKSVTVPRNAKISKVLDETLKSFHINDDPDNYYLAKAVDE---RKPLDPE-EIPVQFPEKESKPLIFLRIKSADKR-KGYIRIYAGTEI---DVPVLFKTLPVIASTSVSDIISVAMKKFGIWNQNQEDYALTEVHLIKGVQERVMEAHECPWKTLMDIRKQSIRDMKLTRFYLRRRNSPLGP-VTMCIGDLPTSMDRSKYEIMLNGVLG-ERMLSSKFLFEIGSHSIIHKNPDGYEGVTALTKLRRTPIDGKTAFVKILPSMHPEVLPPESDPLLVFVNCKSGGGQGDDILSAFQRLLNPHQVYNLMDGGPLPGLYAFKDLPRFRILICGGDGTVGWVLSCLDDVSTALTYKKPPSAIVPLGTGNDMSRVLQWGSGYSSGDTPLSLLIAVDHAEVVHLDRWFVMFDSVDSLSDMKSNVSAIGLTA--GREEEPNMFVMNNYLGIGIDADLCLDFHLRREEAPEKFTSRLRNKGVYFRVGLRKMANKTKWV-FSEEVEIEVDGEKLQLPTLEGIVILNIGSWAAGADLWGPDKDDEFRPSSYCDCLVEVVGLTGVMQMGQIQSGIRSGVRLAQGAQINIKLKCEIPVQIDGEPWMQSPGNV-IIRPALMQVTIATS 877          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO42510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1H8])

HSP 1 Score: 260.381 bits (664), Expect = 9.312e-74
Identity = 145/345 (42.03%), Postives = 201/345 (58.26%), Query Frame = 2
Query: 2048 VFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGP----------------EKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIR-NGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL 3031
            VF+N KSGG QG++L+  F+ LLNP QVFNL  GGP PGL  F+ + ++++L CGGDGTVGW L+ +D          PP+AVLPLGTGNDLAR L+WGGGY  G    ++L  V     L +DRW + V   D D  E              N DS  L I+NNYF +G+DA +AL FH  R +NP KFNSR+ NK  Y + G  + +   TCK+L   I +  DG  ++LP +EG+ I+NI S  GGAN WG                 + D  +      DG LEV+G+   +++GQI +G+R +G+R+ Q   ++I  K   P+Q+DGEP++Q   T+ ++
Sbjct:  366 VFINPKSGGRQGSRLMHKFQYLLNPRQVFNLGDGGPAPGLKFFQHLSDFRVLCCGGDGTVGWVLATIDKLQMRF---RPPVAVLPLGTGNDLARCLKWGGGYEGGSIS-KVLSQVQRGSVLSMDRWQIDVT--DVDSSE--------------NGDSPPLNIINNYFSIGVDASVALKFHLQREKNPEKFNSRLKNKFRYFECGTSETL-SATCKNLQDAIQVICDGKILELPNLEGIAIVNIPSVYGGANLWGETDKKKAKKSRSKSGSKDNDLAWAVQDIGDGQLEVVGLESSLYVGQIIAGVRTHGLRLAQCSSIEIKTKRLFPMQIDGEPWMQPAATMKIV 689          

HSP 2 Score: 84.7297 bits (208), Expect = 1.395e-16
Identity = 53/175 (30.29%), Postives = 76/175 (43.43%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLDD---NPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYID 1129
            H W +    +  +CN+C  +L        ++C  C+Y  H  C      +C     Y  +         HHW+EGN P   KC  CNK   S+ C+ G RC WC    H  C   +  EC  G  +  ILPP S+  P   +S +      KR+N  + S D T   +K  SY++
Sbjct:  186 HQWRQKHFNRPAYCNMCHNQLTGFARKQGLQCLFCKYTVHERCVQRAPASCIN--TYVKSKRTGKMTMDHHWVEGNCP--GKCFKCNKTVKSTNCLTGLRCAWCQMVVHNKCATNVSPECNLGVHREHILPPMSI-TPAGLVSTD-----RKRTNSSAESPDST---TKPNSYVN 347          

HSP 3 Score: 54.299 bits (129), Expect = 3.152e-7
Identity = 35/120 (29.17%), Postives = 52/120 (43.33%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLM-TVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVAR-PLSHCWTEPGTFKRKF-CNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGA 769
            H + +K F+RPAYC+ C   + G     G  C  C + VHE+C+ +    C  T + S    +  + H W E     + F CN   K  +    +RC  C+   H +C   V   C  G 
Sbjct:  186 HQWRQKHFNRPAYCNMCHNQLTGFARKQGLQCLFCKYTVHERCVQRAPASCINTYVKSKRTGKMTMDHHWVEGNCPGKCFKCNKTVKSTNCLTGLRCAWCQMVVHNKCATNVSPECNLGV 305          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO48435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW1])

HSP 1 Score: 238.424 bits (607), Expect = 6.228e-68
Identity = 141/343 (41.11%), Postives = 191/343 (55.69%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYK--ILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITL-KNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKK 3064
            LVF N KSG   G +L+ AFR +LNP QV +L    P   L   R +  ++  +LVCGGDG+VGW L  LD         SP I +LPLGTGNDLARVL WG GY   E    +L  ++ A+  +LDRW + V+          L ++    T +          MNNYF VG DA + L+FH  R   P  F SR+ NK +Y   G R  V +  CK+LH+ + LE D   ++LP +EG++ILNI SW GG + W    DD    PT  DGLLEV+G+   +H+ ++   + +  RI QA  +K +     LPVQVDGEP+ Q+P  IT+     +A+MLK+
Sbjct:  206 LVFANCKSGDNDGERLLQAFRGVLNPVQVIDLHEVPPETALEFCRLLPGHRCRVLVCGGDGSVGWVLDALDKVKLKL---SPYIGILPLGTGNDLARVLGWGSGYAGEEDANDVLNSILKADVTELDRWKVTVEC------AGFLGVRKPRKTYS----------MNNYFSVGCDAKVVLNFHRHRESQPTLFTSRLFNKAMYGVYGARD-VLQQECKNLHEMVELELDDKKVELPDLEGIVILNISSWCGGCDMWNSCSDDDGRPPTASDGLLEVVGLYSSLHIARLQVSLADPHRIGQAHKIKASENAKHLPVQVDGEPWEQAPCVITITHHN-QALMLKR 527          

HSP 2 Score: 61.6178 bits (148), Expect = 1.487e-9
Identity = 40/125 (32.00%), Postives = 54/125 (43.20%), Query Frame = 2
Query:  641 KRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYV--VNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSV 1009
            K  +CN C   L     + CE C    H EC +    V  CK  A      S L     HH++ GNLP  S C +C   C ++  +   RC WC    H  C +   + C FG  + +ILPP  +
Sbjct:   59 KPSYCNACENALVR--GLHCENCTLSVHDECLETANEVFTCK--ALVLSRRSSLK----HHYIRGNLPLCSYCSVCGCLCGTAPRLCDQRCIWCQEKVHDDCLRNQSMICDFGRYRTLILPPHCI 175          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO38287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC5])

HSP 1 Score: 229.95 bits (585), Expect = 4.582e-62
Identity = 146/371 (39.35%), Postives = 202/371 (54.45%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPL-QILKDVVIAEELKLDRWTL-VVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEG----LIILNIMSWGGGANPWG-PEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPL 3136
            +VF+N KSGG QG +++  F+ LLNP QVF+L   GP  GL  +R+V N ++L CGGDGTVGW LS LD    +     PP+A+LPLGTGNDL+R L WGGGY   + PL +IL  V     ++LDRW L VV S   D + A+  L               L +MNNYF +G DA++ L+FH +R  +P KFNSR+ NK  Y K      + +   KD +K   LE DG  I    +E     L+ LNI  +  G +PWG P +D +F+     DG +EV+ ++          G  +G R+ Q  ++ +T    +P+QVDGEP    P  I +     +A M++K    KRR   SS    P+  P P+
Sbjct:  294 VVFINPKSGGNQGLRIMHKFQWLLNPRQVFDLSREGPREGLELYRKVPNVRLLACGGDGTVGWILSELDKLKFNP---RPPVAILPLGTGNDLSRALNWGGGY--ADEPLSKILTHVDEGSVVQLDRWDLEVVPSGYTDGEIAESRLP--------------LNVMNNYFSLGFDAEVCLEFHESREAHPAKFNSRVKNKLFYGKASSTTFI-QGKAKDFYKHTKLECDGVDITEKLLEAKPMCLLFLNISKYSAGTSPWGNPGRDHEFLPQRSDDGYIEVLALTSATLATTRVGG--HGERLAQCRNVIMTTSKSIPMQVDGEPCRLQPSRIRI-SVRNQADMIQKV---KRRALGSSGESEPAPSPEPV 638          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO40684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6N0])

HSP 1 Score: 122.479 bits (306), Expect = 1.960e-28
Identity = 66/136 (48.53%), Postives = 87/136 (63.97%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDP 2452
            LVFVN KSG  QG + I  F++LLNP QVF+L  GGP  GL  FR+ + ++ILVCGGDG+VGW +  +D       C    I VLPLGTGNDL+RVL WG  +    +  Q L+ +  A+ L LDRW ++V+  +P
Sbjct:  241 LVFVNSKSGDNQGVKFIRKFKQLLNPLQVFDLGVGGPTNGLKFFRRFRRFRILVCGGDGSVGWVMKEVDLMKMATQCQ---IGVLPLGTGNDLSRVLGWGTSFADENSVPQFLQHLERAKPLMLDRWAIMVQECNP 373          

HSP 2 Score: 116.701 bits (291), Expect = 1.481e-26
Identity = 55/121 (45.45%), Postives = 80/121 (66.12%), Query Frame = 2
Query: 2531 IMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHM 2893
            +MNNYFG+G+DA + LDFH  R E+P K+ SR  N   Y  +G +++V RT  K++ +++  + DGH I LP ++G+++LNI S+ GGAN WG  +DD F  P+  D +LEVI V G   M
Sbjct:  602 VMNNYFGIGIDAKITLDFHTRREEHPEKYRSRTRNMIWYGVLGGKEIVQRTY-KNIDQRV--KCDGHRISLPSLQGIVVLNITSYMGGANFWGGGRDDGFTDPSFDDNILEVIAVLGAKQM 719          

HSP 3 Score: 80.4925 bits (197), Expect = 2.878e-15
Identity = 44/137 (32.12%), Postives = 59/137 (43.07%), Query Frame = 2
Query:  614 HCWTEPGTFKRKFCNVCRKKLD--DNPAIRCEICEYHSHIECQDYVVNNCK---EGAAYTPNLSLLN---FKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPP 1000
            H W      +  FCNVC+  L    +  + CE+C + SH  C     NNCK     A    N    N       H WLEGNL P ++C +C + C S   +  +RC WC    H  C   +  +C  G     +LPP
Sbjct:   82 HNWYSCAHARPTFCNVCKDILSGVTSKGLSCEVCRFKSHKRCAAKAPNNCKWTTMQAIRKDNEDCDNSDPMSMPHQWLEGNLTPGARCTVCERPCGSKRRLLDFRCLWCNMTVHHSCKLSVVSKCTLGENSLSVLPP 218          

HSP 4 Score: 55.8398 bits (133), Expect = 8.689e-8
Identity = 42/165 (25.45%), Postives = 66/165 (40.00%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVAR---------PLS--HCWTEPGTFKRKFCNVC-------RKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNL--PPNSKCII 859
            H +   +  RP +C+ C +++ G+ + G  CEVC F  H++C ++    C      A+ +         P+S  H W E        C VC       R+ LD     RC  C    H  C+  VV+ C  G      L  +  K      +G +  P NS  ++
Sbjct:   82 HNWYSCAHARPTFCNVCKDILSGVTSKGLSCEVCRFKSHKRCAAKAPNNCKWTTMQAIRKDNEDCDNSDPMSMPHQWLEGNLTPGARCTVCERPCGSKRRLLD----FRCLWCNMTVHHSCKLSVVSKCTLGENSLSVLPPMFIKGLSELAKGEVVKPRNSPLLV 242          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:101168014])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 331/898 (36.86%), Postives = 522/898 (58.13%), Query Frame = 2
Query:  404 FPAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCK--------EGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDK--SNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLD-RSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPH-GPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLK 3061
            +P+    H F K +  +P +CH CS+ +WGL   GF+CEVCNF+ HEKCL  + T+C+ +A + V  P+ HC+  P   K++FC VCRK+ + + A+RCE+CE H H +C  +   +C+        +GA  T +         HHW EGNLP  S+C +C ++C SSE M G RCEWC   +H  C+  +P+EC  G L+ ++L P+ V +     S      +++  +     E + D D    +  D +    ++ K+      +VFDG+  + R  YR     ++M ++ ++E  L+AF++ G    +   E+ E    ++ + ++  S   ++ +        +LR    +K+    +++Y    V   +V   +  V ++ ++T   VI   + +   ++  ++ F+L+EV +  + V  + + ++E   + ++ +RK S+R +  TRFYL  +E+ +    V + +G L   L    Y +++ E L + +   ++  IY   G   L  +C  +AE  Y + +DT    + L  +++P+I    +  D+ PLLVFVN KSGG +G +L+ +FRKLLNPHQVF+L  GGPL G + FR+V  ++ILVCGGDGTVGW L  L++      C  PPI ++PLGTGNDLARVLRWG GY S E P  IL  V  A+E+ +DRWT+++ + D  +D        + N L   +    ++ MNNYFG+G+DA+L+LDFH AR ++P+KF SR HNK VY+K+GL+K+ +    + LHK++ L+ D   + LP IEGLI +NI SWG GA+ WG E D +F KP   DGLLEV+GV+G++HMGQ+ SG+R+GIRI Q  ++++T+    PVQVDGEP+IQ PG I +  +  +  ML+
Sbjct:   27 YPSSAPGHRFRKVTLTKPTFCHSCSDFVWGL--AGFLCEVCNFMCHEKCLKTLRTVCSCMAPSQVQVPVVHCFG-PAGQKKRFCGVCRKQTEGSSALRCEVCELHVHADCAPFTCADCRCCHLDGTLDGAQETFH---------HHWREGNLPSASRCEVCRRSCSSSEAMVGMRCEWCSVTTHPSCYHSVPLECAVGRLRCMLLKPACVRLDSRNFSKMHCYRITE--SCGHEPETFDDSDQAAAAPRDLQPAPAESGKQ----LLRVFDGDDGVNRGFYRLVPLCRAMRNEELVEAALRAFYLPGDPQNF---ELEEVSASQSDITNRNGSGPDNRSSLKDGGESWLLRAKPRDKDL---IQVY----VSLPRVRDTHVSVCVSVRSTVASVIGEVLFQLDKQAEEVSRFRLLEVFMGGKQVQRQTLMSEENILEKLRDIRKVSLRQMNQTRFYL--VENQNLAVNVNLLIGGLPPLLTTEQYLQLIQEHLAIKSHLVTVSQIYSSQGAAELQVSCFSEAERIYMLARDTSCNSKTLSSLVVPQIQINKLERDVSPLLVFVNPKSGGLRGRELLYSFRKLLNPHQVFDLSNGGPLVGFHTFREVPRFRILVCGGDGTVGWVLGVLEAVRHKLVCREPPIGIVPLGTGNDLARVLRWGAGY-SCEDPHSILVSVDEADEVLMDRWTILLDAQDISEDSK------DHNYLEPPK----IVQMNNYFGLGIDAELSLDFHQAREDDPDKFTSRFHNKGVYVKVGLQKISHS---RSLHKELQLQVDNQNVPLPSIEGLIFINIPSWGSGADLWGSEVDGRFGKPRIDDGLLEVVGVTGVVHMGQVQSGLRSGIRIAQGNYVRLTVSKPTPVQVDGEPWIQPPGIIIISAAGPKVRMLR 880          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:101165301])

HSP 1 Score: 268.855 bits (686), Expect = 1.178e-76
Identity = 152/364 (41.76%), Postives = 212/364 (58.24%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDDKFVK----------PTHY--------DGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL-KSALRAIMLKKTK 3070
            LVFVN KSGG QG +++  F+ LLNP QV+NL  GGP PGL+ FR +  Y+ILVCGGDGTVGW L  +D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILK++  +E + +DRW++ V  +DP +    +  +                I+NNYF +G+DA +A  FH+ R ++P +FNSRM NK  Y +    + +   +CK L++ +V+E  G  +DL ++  EG+ ILNI S  GG+N WG  K    V           P H         D   EV+G+ G + MGQIY+G+++ G R+ QA  + I     LP+Q+DGEP++Q P TI +  K+    +M + TK
Sbjct:  328 LVFVNPKSGGKQGERVLRKFQGLLNPRQVYNLSNGGPTPGLHFFRTLTQYRILVCGGDGTVGWLLDAIDRANLQV---HPPVAVLPLGTGNDLARCLRWGGGY-EGTDLREILKEIEKSEVIPVDRWSVRVIPNDPQEAGDPVPQE----------------IINNYFSIGVDASIAHRFHSMREKHPQRFNSRMKNKLWYFEFATSETI-SASCKKLNESLVIECCGKRLDLSRVALEGIAILNIPSMHGGSNLWGESKKPDSVSEVGRGEVITDPEHLKTVTQDMSDKRFEVVGLEGAMEMGQIYTGLKSAGHRLAQASQITIRTTKALPMQIDGEPWMQPPCTIHITHKNQANMLMAQPTK 670          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:101165301])

HSP 1 Score: 268.47 bits (685), Expect = 3.343e-76
Identity = 152/364 (41.76%), Postives = 212/364 (58.24%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDDKFVK----------PTHY--------DGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL-KSALRAIMLKKTK 3070
            LVFVN KSGG QG +++  F+ LLNP QV+NL  GGP PGL+ FR +  Y+ILVCGGDGTVGW L  +D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILK++  +E + +DRW++ V  +DP +    +  +                I+NNYF +G+DA +A  FH+ R ++P +FNSRM NK  Y +    + +   +CK L++ +V+E  G  +DL ++  EG+ ILNI S  GG+N WG  K    V           P H         D   EV+G+ G + MGQIY+G+++ G R+ QA  + I     LP+Q+DGEP++Q P TI +  K+    +M + TK
Sbjct:  371 LVFVNPKSGGKQGERVLRKFQGLLNPRQVYNLSNGGPTPGLHFFRTLTQYRILVCGGDGTVGWLLDAIDRANLQV---HPPVAVLPLGTGNDLARCLRWGGGY-EGTDLREILKEIEKSEVIPVDRWSVRVIPNDPQEAGDPVPQE----------------IINNYFSIGVDASIAHRFHSMREKHPQRFNSRMKNKLWYFEFATSETI-SASCKKLNESLVIECCGKRLDLSRVALEGIAILNIPSMHGGSNLWGESKKPDSVSEVGRGEVITDPEHLKTVTQDMSDKRFEVVGLEGAMEMGQIYTGLKSAGHRLAQASQITIRTTKALPMQIDGEPWMQPPCTIHITHKNQANMLMAQPTK 713          

HSP 2 Score: 57.7658 bits (138), Expect = 7.691e-8
Identity = 32/105 (30.48%), Postives = 47/105 (44.76%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIEC 733
            H +  K F++P YC  C  ++ GL   G  C  C++ VH +C ++    C  T + S       SH W +      K C VC KK+ +    RC  C+   H  C
Sbjct:  212 HMWRMKHFNKPTYCSQCENMLLGLGKQGLCCICCSYTVHNQCANKKLETCPPTFVKSKQEIGKSSHGWIKVDCNNSK-CEVCSKKIKNLTGKRCVWCQEMRHEAC 315          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:101165301])

HSP 1 Score: 268.47 bits (685), Expect = 3.343e-76
Identity = 152/364 (41.76%), Postives = 212/364 (58.24%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQI--EGLIILNIMSWGGGANPWGPEKDDKFVK----------PTHY--------DGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVL-KSALRAIMLKKTK 3070
            LVFVN KSGG QG +++  F+ LLNP QV+NL  GGP PGL+ FR +  Y+ILVCGGDGTVGW L  +D          PP+AVLPLGTGNDLAR LRWGGGY  G    +ILK++  +E + +DRW++ V  +DP +    +  +                I+NNYF +G+DA +A  FH+ R ++P +FNSRM NK  Y +    + +   +CK L++ +V+E  G  +DL ++  EG+ ILNI S  GG+N WG  K    V           P H         D   EV+G+ G + MGQIY+G+++ G R+ QA  + I     LP+Q+DGEP++Q P TI +  K+    +M + TK
Sbjct:  371 LVFVNPKSGGKQGERVLRKFQGLLNPRQVYNLSNGGPTPGLHFFRTLTQYRILVCGGDGTVGWLLDAIDRANLQV---HPPVAVLPLGTGNDLARCLRWGGGY-EGTDLREILKEIEKSEVIPVDRWSVRVIPNDPQEAGDPVPQE----------------IINNYFSIGVDASIAHRFHSMREKHPQRFNSRMKNKLWYFEFATSETI-SASCKKLNESLVIECCGKRLDLSRVALEGIAILNIPSMHGGSNLWGESKKPDSVSEVGRGEVITDPEHLKTVTQDMSDKRFEVVGLEGAMEMGQIYTGLKSAGHRLAQASQITIRTTKALPMQIDGEPWMQPPCTIHITHKNQANMLMAQPTK 713          

HSP 2 Score: 57.7658 bits (138), Expect = 7.691e-8
Identity = 32/105 (30.48%), Postives = 47/105 (44.76%), Query Frame = 2
Query:  425 HTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLC--TTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIEC 733
            H +  K F++P YC  C  ++ GL   G  C  C++ VH +C ++    C  T + S       SH W +      K C VC KK+ +    RC  C+   H  C
Sbjct:  212 HMWRMKHFNKPTYCSQCENMLLGLGKQGLCCICCSYTVHNQCANKKLETCPPTFVKSKQEIGKSSHGWIKVDCNNSK-CEVCSKKIKNLTGKRCVWCQEMRHEAC 315          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkg (diacylglycerol kinase beta [Source:NCBI gene;Acc:105356367])

HSP 1 Score: 264.618 bits (675), Expect = 9.806e-76
Identity = 149/355 (41.97%), Postives = 204/355 (57.46%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLP--QIEGLIILNIMSWGGGANPWGPEKDD-------------------------KFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRN-GIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTIT 3025
            LV VN KSGG QG +++  FR LLNP QV++LE GGP+ GL  F  V ++++L CGGDGTVGW L C++          PP+A+LPLGTGNDLAR LRWGGGY  G   L++L+D+  +EE+ LDRW + +   D ++                N D     I+NNYF +G+DA +A  FH  R ++P KFNSRM NK  Y + G  + +   TCK L++ I +E DG T+DL    +EG+ +LNI S  GG+N WG  K                           KF      D LLEV+G+ G I MGQIY+G+++ G R+ Q   + I     LP+Q+DGEP++Q P T++
Sbjct:  271 LVLVNPKSGGRQGERVLRKFRYLLNPRQVYSLEQGGPMVGLNFFHDVPDFRVLACGGDGTVGWILDCIEKANFS---KHPPVAILPLGTGNDLARCLRWGGGYEGGSL-LKVLRDIEHSEEVVLDRWHIDIVPCDQEE----------------NGDPVPNSIVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETI-SATCKKLNECIEVECDGVTLDLSNTSLEGIAVLNIPSMHGGSNLWGETKKRRNYSRMSKKVTDKIPSITVTGAKVLKFCMQDFSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCASVTIRTSRRLPMQIDGEPWMQPPCTVS 604          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000023623.1 (SMESG000023623.1)

HSP 1 Score: 2018.82 bits (5229), Expect = 0.000e+0
Identity = 1046/1048 (99.81%), Postives = 1046/1048 (99.81%), Query Frame = 2
Query:   35 MSYNFIWELRPALPSQPDLFGWPGGDSDSEXXXXXXXXXXXXGSISQQRTRPIESSNESCQNVASCNNDDSIQHEEINSVGITLKVPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMNSSNAVPNCSFRQ 3178
            MSYNFIWE RPALPSQPDLFGWPGGDSDSEDLNDALLANTNNGSISQQRTRPIESSNESCQNVASCNNDDSIQHEEINSVGITLKVPPSSSAEASNSSTLNNSLNHSNNEISKITAISSSS SFPAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVMILPRIIPRMIPDDIIPLLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMNSSNAVPNCSFRQ
Sbjct:    1 MSYNFIWEPRPALPSQPDLFGWPGGDSDSEDLNDALLANTNNGSISQQRTRPIESSNESCQNVASCNNDDSIQHEEINSVGITLKVPPSSSAEASNSSTLNNSLNHSNNEISKITAISSSSTSFPAFKHAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVMILPRIIPRMIPDDIIPLLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMNSSNAVPNCSFRQ 1048          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000020956.1 (SMESG000020956.1)

HSP 1 Score: 1314.29 bits (3400), Expect = 0.000e+0
Identity = 620/902 (68.74%), Postives = 755/902 (83.70%), Query Frame = 2
Query:  419 HAHTFIKKSFHRPAYCHHCSEVMWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTSEDWT-DEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSK-YKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPS 3118
            H H FIKK+FHRPAYCHHC+EVM G++  G+ CEVCNF+VHE+CL  V + C+T+A + V +P+SHCW+E   FKRKFCNVCRK+LD++ A RCEICEYH+H++C+DYV+++CKE AAYTP L+L ++ QFHHW EGNLP NSKC IC K C+S+EC+ G+RCEWCG  SH  C KQIP EC FG LK I+LPP  VC+PRTK+SME+IIGV + SN +     W+ DE+SKE+S+++KRS K+Q+EKE  ++Y KVFDGN SLKR+ YR FNFNK+MSSQ  +EQCLK+F++ GK+DEY M EINEKDG +  + D ++FKSQL +D+KRP I+LRH E+ +    KLK+YPGD+     ++S  YKE+P+ K+T ++EV+I A+R+F CE L+   F LVEVC+D++VTER I +DE PWDIIQRL++DS+RSLRLTRFY+KA +DPHGPGV IFVGNL+ENL++  YE+ML+EKLG  NKW  ++VIYYE+GCL+L Y+ GEKAE+ YEILKDT + +R +MV++LPRII  +IPDDI PLLVFVN+KSGG QG  LITAFRKLLNPHQVFNL++GGPLPGLYCFR +K+YKILVCGGDGTVGW LSCLDST QDAAC+SPPIAVLP+GTGNDLARVL WGGGYT+ E P  ILKDVV+AE +KLDRWTLVV+SDD +KDEAKLALQ+ETN  NTNED+SILIIMNNYFG+G+DADLALDFHNARSENP KFNSRMHNK+VYLKMGLRKM+YRTTCKDLHKQI++EAD   +DLP IEGLI+LNIMSW GGANPW  E+DD+F KPTHYDG+LEV+GVSG++HMGQI+SG+R+GIRI QA HLKITLKNDLPVQVDGEPFIQSPG I VLKSAL+A MLKK K  KRR  + S  GP S
Sbjct:   89 HGHNFIKKTFHRPAYCHHCAEVMLGILRTGYYCEVCNFMVHERCLPNVVSYCSTVAVSLVTKPVSHCWSEKNYFKRKFCNVCRKRLDESLAYRCEICEYHTHVDCKDYVISDCKETAAYTPYLNLSSYNQFHHWREGNLPSNSKCEICRKVCWSNECLTGFRCEWCGITSHAGCLKQIPEECTFGDLKEILLPPRVVCLPRTKVSMENIIGVPRPSNSRFAPGTWSSDEESKEDSFVEKRSPKEQSEKESSDEYVKVFDGNSSLKRKSYRCFNFNKAMSSQNAVEQCLKSFYLPGKTDEYYMVEINEKDGSQRTITDVASFKSQLKYDNKRPAIMLRHKETKEHNTEKLKVYPGDITSHVNISSSHYKEIPVTKETAAREVLITALRKFNCEHLDHLKFHLVEVCMDKNVTEREIPSDEHPWDIIQRLKQDSVRSLRLTRFYIKACDDPHGPGVAIFVGNLMENLDEKTYERMLIEKLGPQNKWDKMDVIYYENGCLILCYSSGEKAELAYEILKDTVLMERQIMVILLPRIISSLIPDDIQPLLVFVNIKSGGGQGNHLITAFRKLLNPHQVFNLDFGGPLPGLYCFRNLKSYKILVCGGDGTVGWALSCLDSTSQDAACDSPPIAVLPVGTGNDLARVLNWGGGYTT-EDPYSILKDVVLAENVKLDRWTLVVRSDDGEKDEAKLALQLETNVCNTNEDNSILIIMNNYFGIGIDADLALDFHNARSENPEKFNSRMHNKSVYLKMGLRKMMYRTTCKDLHKQIIVEADSKILDLPPIEGLIVLNIMSWAGGANPWATERDDRFHKPTHYDGMLEVVGVSGVVHMGQIHSGLRSGIRIGQASHLKITLKNDLPVQVDGEPFIQSPGQIVVLKSALKATMLKKCKRVKRRNTEPSVLGPVS 989          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000017153.1 (SMESG000017153.1)

HSP 1 Score: 988.793 bits (2555), Expect = 0.000e+0
Identity = 482/910 (52.97%), Postives = 654/910 (71.87%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLM-TVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSN----VKSTSEDWTDEDS-KEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHI-FGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPG-VTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKD---DKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKADSSNTGPPS 3118
             H F+KK+FH+P  CHHC+E +WGL+ T G++C++CN+LVHEKC+ Q+   C  + S  +  P +HCW+E   FKRKFCNVCRK+L+D   +RCEICEY+ H EC D+ ++NCK+ A  + +    + +  HH+ EGNLP NSKC IC K C S EC+ G RCEWCG   HT C+++IP EC  G L +IILP S+V +PRT   +E I  + +        ++  +D++D DS +EES  +++S+K++ +KE + D+ +++DG    K++  RY +  KS S Q VIE  +KAF + F + +   + EINEKD  +  L +   FK QL FD +RP +IL+    N E R  + IYPGDL     ++    ++PI  +T +  ++++A+RR   E +N + F LVE  LD  +TER I  DE  W I++RL+K+S+R+  LTRFY++++ DP+G G V ++VGNL + L+Q +YE++L+++L   N+W +IEVIYY+SG LVL Y+  EKAE  Y ILK++   D  L  +ILPR+    IP+DI PLLVFVN+KSGGCQGT+LI++FRKLLNPHQVFNL+YGGPLPGL+C+R + N+KILVCGGDGTVGW LSCLD+ GQDA C  PP+A++PLGTGNDLARVLRWG GYT  E PL +LKDVV AEE++LDRWT+++K ++ +KDE K ALQ++ N  NTNE+++ + +MNNYFG+G+DADL LDFH AR ENP KF SR+HNK +Y KMGLRKMV RT CKDLH +I LE DG  I+LP +EG+IILNI+SWG GANPWG   D    KF KPTHYDG+LEV+GV+G++HMGQI+SG+R G R+ Q GH++ITLK  +PVQVDGEP+IQSP  ITVL+SAL+A MLKK K  K  + ++    PP+
Sbjct:   95 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWP--SKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYY-DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVE-RDYISIYPGDLTKSCNISINPIKIPITIETDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQANAANTNEETTRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQIELPPLEGIIILNILSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLKKRKRRKVNRRNTEPGIPPT 1000          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000017153.1 (SMESG000017153.1)

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 476/890 (53.48%), Postives = 644/890 (72.36%), Query Frame = 2
Query:  422 AHTFIKKSFHRPAYCHHCSEVMWGLM-TVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSN----VKSTSEDWTDEDS-KEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHI-FGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPG-VTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVXXXXXXXXXXXXXXXXXXLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKD---DKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML 3058
             H F+KK+FH+P  CHHC+E +WGL+ T G++C++CN+LVHEKC+ Q+   C  + S  +  P +HCW+E   FKRKFCNVCRK+L+D   +RCEICEY+ H EC D+ ++NCK+ A  + +    + +  HH+ EGNLP NSKC IC K C S EC+ G RCEWCG   HT C+++IP EC  G L +IILP S+V +PRT   +E I  + +        ++  +D++D DS +EES  +++S+K++ +KE + D+ +++DG    K++  RY +  KS S Q VIE  +KAF + F + +   + EINEKD  +  L +   FK QL FD +RP +IL+    N E R  + IYPGDL     ++    ++PI  +T +  ++++A+RR   E +N + F LVE  LD  +TER I  DE  W I++RL+K+S+R+  LTRFY++++ DP+G G V ++VGNL + L+Q +YE++L+++L   N+W +IEVIYY+SG LVL Y+  EKAE  Y ILK++   D  L  +ILPR+    IP+DI PLLVFVN+KSGGCQGT+LI++FRKLLNPHQVFNL+YGGPLPGL+C+R + N+KILVCGGDGTVGW LSCLD+ GQDA C  PP+A++PLGTGNDLARVLRWG GYT  E PL +LKDVV AEE++LDRWT+++K ++ +KDE K ALQ++ N  NTNE+++ + +MNNYFG+G+DADL LDFH AR ENP KF SR+HNK +Y KMGLRKMV RT CKDLH +I LE DG  I+LP +EG+IILNI+SWG GANPWG   D    KF KPTHYDG+LEV+GV+G++HMGQI+SG+R G R+ Q GH++ITLK  +PVQVDGEP+IQSP  ITVL+SAL+A ML
Sbjct:   95 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWP--SKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYY-DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVE-RDYISIYPGDLTKSCNISINPIKIPITIETDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQANAANTNEETTRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQIELPPLEGIIILNILSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 980          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000051710.1 (SMESG000051710.1)

HSP 1 Score: 223.402 bits (568), Expect = 2.463e-61
Identity = 148/362 (40.88%), Postives = 199/362 (54.97%), Query Frame = 2
Query: 2045 LVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSS-------ILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDL-PQIEG-----LIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIMLKKTKLGKRRKA 3091
            LVF+N KSGG  G +L+  F+ LLNP QVF++   GP  GL  F ++ N +ILVCGGDGTVGW +S +DS    A   SPPIA+LPLGTGNDLAR   WG GYT  E+  +I+  V   +   LDRW L    +   +  +K  L ++ N   T+E S+        L + NNYF +G DA  AL+FH +R  NP KFNSR+ NK  Y  +G + ++ R+  KDL   I L  DG  ID  P+I+      L+ LNI  + GG  PWG      F   +  DG LEV+G++          G  +  RICQ  +  +T    +P+QVDGEP    P  I++    +  I+LK     KRR +
Sbjct:  295 LVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSL---AIFPSPPIAILPLGTGNDLARATHWGSGYTD-ESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQ-NKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSW-KDLCDYITLVCDG--IDFTPRIKEMKPHLLLFLNIQRYSGGTQPWG-NPAGGFGPQSFNDGKLEVVGLTAASLATLQVGG--HADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKP----KRRSS 641          
The following BLAST results are available for this feature:
BLAST of Diacylglycerol kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+038.74diacylglycerol kinase theta [Source:HGNC Symbol;Ac... [more]
DGKQ0.000e+038.41diacylglycerol kinase theta [Source:HGNC Symbol;Ac... [more]
DGKG8.411e-7843.24diacylglycerol kinase gamma [Source:HGNC Symbol;Ac... [more]
DGKG3.231e-7743.24diacylglycerol kinase gamma [Source:HGNC Symbol;Ac... [more]
DGKB3.539e-7743.22diacylglycerol kinase beta [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgk-10.000e+045.84Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-10.000e+046.00Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-10.000e+044.89Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-12.098e-15854.12Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-12.293e-15854.12Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG311404.659e-8552.28gene:FBgn0051140 transcript:FBtr0300963[more]
CG311404.144e-8350.69gene:FBgn0051140 transcript:FBtr0330371[more]
CG311403.944e-8350.69gene:FBgn0051140 transcript:FBtr0113392[more]
CG311403.278e-8348.44gene:FBgn0051140 transcript:FBtr0084497[more]
CG311402.675e-8348.44gene:FBgn0051140 transcript:FBtr0305041[more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgkaa2.655e-7642.58diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZD... [more]
dgkaa3.379e-7642.58diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZD... [more]
dgkg1.088e-7539.04diacylglycerol kinase, gamma [Source:ZFIN;Acc:ZDB-... [more]
BX548053.13.249e-7539.04diacylglycerol kinase beta-like [Source:NCBI gene;... [more]
BX548053.14.012e-7539.04diacylglycerol kinase beta-like [Source:NCBI gene;... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+039.35diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKQ0.000e+037.39diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKQ0.000e+037.43diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKQ0.000e+036.70diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKA2.405e-7141.44diacylglycerol kinase alpha [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dgkq0.000e+039.11diacylglycerol kinase, theta [Source:MGI Symbol;Ac... [more]
Dgkb3.812e-7943.22diacylglycerol kinase, beta [Source:MGI Symbol;Acc... [more]
Dgkb3.812e-7943.22diacylglycerol kinase, beta [Source:MGI Symbol;Acc... [more]
Dgkg4.267e-7742.71diacylglycerol kinase, gamma [Source:MGI Symbol;Ac... [more]
Dgkg7.999e-7742.71diacylglycerol kinase, gamma [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P5E8|DGKQ_MOUSE0.000e+039.11Diacylglycerol kinase theta OS=Mus musculus OX=100... [more]
sp|P52824|DGKQ_HUMAN0.000e+038.74Diacylglycerol kinase theta OS=Homo sapiens OX=960... [more]
sp|Q6NS52|DGKB_MOUSE3.827e-7843.22Diacylglycerol kinase beta OS=Mus musculus OX=1009... [more]
sp|P49621|DGKB_RAT1.129e-7742.94Diacylglycerol kinase beta OS=Rattus norvegicus OX... [more]
sp|P49620|DGKG_RAT2.591e-7742.97Diacylglycerol kinase gamma OS=Rattus norvegicus O... [more]
back to top
BLAST of Diacylglycerol kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S0S30.000e+059.37Diacylglycerol kinase OS=Fasciola hepatica OX=6192... [more]
G4V6E60.000e+058.45Diacylglycerol kinase OS=Schistosoma mansoni OX=61... [more]
A0A4Z2D6360.000e+058.30Diacylglycerol kinase OS=Schistosoma japonicum OX=... [more]
A0A4S2LYV20.000e+057.11Diacylglycerol kinase OS=Opisthorchis felineus OX=... [more]
A0A267GA500.000e+053.30Diacylglycerol kinase OS=Macrostomum lignano OX=28... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+037.46diacylglycerol kinase theta [Source:HGNC Symbol;Ac... [more]
dgkab7.257e-7443.30diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkaa5.701e-7039.28diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZD... [more]
dgke7.491e-6641.45diacylglycerol kinase, epsilon [Source:ZFIN;Acc:ZD... [more]
dgkzb6.304e-6440.69diacylglycerol kinase zeta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007062.11.187e-13237.68pep scaffold:Pmarinus_7.0:GL477921:5350:38314:1 ge... [more]
ENSPMAT00000007078.16.770e-12253.66pep scaffold:Pmarinus_7.0:GL477921:24257:38296:1 g... [more]
ENSPMAT00000007068.17.058e-12043.82pep scaffold:Pmarinus_7.0:GL477921:19741:38299:1 g... [more]
ENSPMAT00000002929.11.737e-7641.90pep scaffold:Pmarinus_7.0:GL476935:158222:277059:-... [more]
dgkzb8.047e-6640.46diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345910.000e+039.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425109.312e-7442.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484356.228e-6841.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382874.582e-6239.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406841.960e-2848.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+036.86diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
dgkab1.178e-7641.76diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkab3.343e-7641.76diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkab3.343e-7641.76diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkg9.806e-7641.97diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023623.10.000e+099.81SMESG000023623.1[more]
SMESG000020956.10.000e+068.74SMESG000020956.1[more]
SMESG000017153.10.000e+052.97SMESG000017153.1[more]
SMESG000017153.10.000e+053.48SMESG000017153.1[more]
SMESG000051710.12.463e-6140.88SMESG000051710.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032957 ID=SMED30032957|Name=Diacylglycerol kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3674bp
CTATATAAATCTTATATGAATTTAAGTATTTTAAATGTCATATAATTTTA
TTTGGGAGCTTCGGCCGGCTCTGCCTTCACAACCAGACTTATTTGGATGG
CCGGGTGGAGACAGTGATTCTGAGGATTTAAATGATGCTTTATTGGCTAA
TACCAATAATGGTAGTATTTCACAGCAACGAACGAGGCCCATCGAATCTT
CAAACGAATCATGTCAAAATGTCGCGTCTTGTAATAATGATGATTCCATC
CAACATGAAGAAATAAATTCAGTTGGGATAACACTCAAAGTTCCTCCATC
TTCAAGTGCTGAAGCATCTAATTCATCAACTTTAAACAACTCACTTAATC
ATTCAAATAATGAAATTTCTAAAATTACAGCCATATCATCGTCATCCGCC
TCGTTTCCGGCTTTCAAGCATGCACATACATTTATCAAAAAATCTTTTCA
TCGGCCAGCTTATTGTCATCATTGCAGTGAAGTCATGTGGGGCCTAATGA
CGGTTGGATTCGTCTGTGAAGTGTGCAATTTCCTTGTTCATGAGAAATGT
TTATCCCAAGTGTTCACTTTATGCACCACAATTGCATCAACTGCAGTCGC
GAGACCATTATCTCACTGCTGGACAGAACCCGGAACTTTCAAAAGAAAAT
TTTGCAATGTCTGCAGAAAAAAACTCGATGACAATCCTGCTATTCGTTGT
GAAATATGCGAATATCATTCTCATATTGAGTGCCAGGATTATGTCGTCAA
CAATTGCAAGGAAGGTGCAGCATACACACCGAATTTATCATTGCTCAATT
TCAAGCAATTTCATCATTGGCTTGAAGGAAACCTTCCTCCGAATTCCAAA
TGCATTATTTGTAATAAGAATTGCTATTCATCCGAATGCATGGCCGGCTA
TAGATGCGAGTGGTGTGGCAATGCAAGTCACACAATTTGCTTCAAACAAA
TCCCAATAGAATGCAAATTCGGTCCATTGAAAAATATCATTCTCCCTCCC
AGCAGTGTCTGCATACCGAGGACAAAAATATCAATGGAGAGCATTATCGG
AGTTTCCAAACGATCAAATGTCAAATCAACTTCCGAAGACTGGACAGATG
AAGACAGTAAAGAAGAAAGCTACATTGATAAGCGGTCACTGAAAGATCAA
AATGAAAAAGAAAAACATGAAGATTACGCCAAGGTTTTTGATGGTAATGG
CAGCCTCAAAAGACGTGTATATCGTTATTTCAATTTCAATAAGTCAATGT
CTTCTCAGACTGTAATAGAGCAATGCTTGAAGGCATTCCACATATTCGGC
AAATCCGATGAATATTGCATGTGTGAAATCAATGAAAAAGATGGGAGAGA
AAACCCATTGGACGATAAGTCTAATTTTAAAAGCCAATTAACATTTGATT
CTAAACGGCCAATTATAATTCTGCGGCACAATGAATCTAATAAAGAGACT
AGGGGTAAATTGAAAATTTATCCTGGGGATTTAGTGTATTGTGCCCAGGT
TACCTCTAAGTATAAAGAAGTTCCAATAAATAAGAAAACGACATCCAAAG
AAGTTATAATAATGGCAATGAGGCGGTTCCAATGTGAGAGCTTAAATATT
AACAATTTCCAATTGGTTGAGGTGTGTCTTGATAGGTCAGTTACTGAACG
ACCAATCGGAAACGATGAATTTCCTTGGGATATTATTCAACGATTACGAA
AAGATTCCATTCGAAGTTTAAGGTTGACGCGATTCTATTTAAAAGCTATT
GAAGATCCCCATGGTCCAGGTGTTACTATATTTGTGGGAAATTTAGTAGA
AAATCTCAATCAAAACGTTTACGAGAAAATGCTTTTAGAAAAATTGGGTG
TCAACAATAAATGGACTAGTATAGAAGTCATATATTATGAAAGTGGTTGT
CTAGTTCTTTCTTATACATGTGGAGAAAAAGCTGAAATATGTTATGAAAT
ACTCAAAGATACAGAAATAAAAGACCGGCCATTAATGGTTATGATTCTTC
CTCGAATAATTCCTAGAATGATTCCAGATGACATAATCCCATTATTAGTT
TTTGTTAATTTAAAATCCGGAGGCTGTCAGGGCACGCAACTCATAACTGC
ATTTAGAAAATTACTCAATCCTCATCAGGTTTTCAATCTTGAATATGGTG
GCCCTCTTCCTGGGCTTTATTGCTTTAGGCAGGTAAAAAATTATAAAATT
TTAGTCTGTGGAGGAGATGGTACAGTCGGGTGGACTTTATCCTGCCTAGA
TAGTACCGGTCAAGATGCAGCTTGCAATTCGCCTCCTATAGCTGTATTAC
CTCTCGGTACTGGCAATGATTTGGCTCGAGTATTACGTTGGGGTGGAGGT
TACACTTCAGGAGAAACCCCGTTACAAATTTTGAAAGATGTTGTCATTGC
AGAAGAATTAAAACTTGACAGGTGGACTCTAGTTGTCAAGTCTGATGATC
CAGACAAAGATGAGGCCAAATTGGCCCTTCAGATAGAAACAAATACACTC
AATACGAATGAGGATTCATCTATTTTAATAATCATGAATAATTATTTCGG
AGTTGGCCTTGATGCGGATTTGGCTCTTGATTTTCACAATGCTCGATCAG
AAAATCCTAATAAATTCAATAGCAGAATGCACAATAAAACTGTATATTTA
AAAATGGGACTCAGAAAAATGGTCTATCGGACAACGTGTAAAGATCTTCA
TAAACAAATTGTTTTAGAAGCCGATGGACATACAATCGATTTACCCCAAA
TAGAAGGTCTGATAATTCTCAATATCATGTCTTGGGGTGGAGGTGCAAAT
CCCTGGGGGCCTGAAAAAGATGACAAGTTTGTCAAGCCAACGCATTATGA
TGGTTTATTGGAAGTAATTGGAGTCTCAGGAATGATTCATATGGGCCAGA
TTTATTCAGGAATTAGAAATGGAATCAGAATATGTCAAGCTGGACATTTG
AAAATTACTCTGAAAAACGACCTACCTGTTCAAGTTGATGGAGAGCCATT
CATTCAGTCTCCCGGCACTATAACAGTTTTGAAGTCTGCATTGAGAGCTA
TTATGCTAAAGAAGACAAAACTCGGAAAACGTCGTAAGGCAGACAGCTCT
AACACCGGACCTCCGTCACGTATACCATTACCTCTGATGAATTCTTCAAA
CGCTGTTCCCAATTGCAGCTTCCGACAATAACTATAGCATTATTTTTTAT
TAAGCAATCAACGAATTTTATTATTTTTGACCAAACTGCTGAAGCAATTT
CTATTATATTTCTGTTACACTACTCATCTTATTAGATGTCAACTAATTTT
TATTAGAGAAACTTTGATCATCATATTATTATTATTAATTTTTACAGATA
ATCACGGCGGTTTGACCCTGCTGCAATAAGTATTACAGATGTAACTATAA
TGTATTTATATTAGAGTTGTTTATTTGTTAGTTTTGTTGATTTTTGGTCA
TTAATCAACTTGAGTTTAATGAAGATTTATTGATGCTTGGTAGGATTGCA
TTTGATAAATGTTTTCTAGATTTCTTCTCAATTTCAACTGCATTTTCAGA
TTAGTGCAATTTGCTGTTCATCCGTTTTGTGGTTTTAGTGTTTATTTTAT
GTCGATTTTGAAAGAATTACATTTGACCTTAAGTTTAATCGAAATTATTT
TATAAATGATGTAAGCTGAGATCG
back to top

protein sequence of SMED30032957-orf-1

>SMED30032957-orf-1 ID=SMED30032957-orf-1|Name=SMED30032957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1049bp
MSYNFIWELRPALPSQPDLFGWPGGDSDSEDLNDALLANTNNGSISQQRT
RPIESSNESCQNVASCNNDDSIQHEEINSVGITLKVPPSSSAEASNSSTL
NNSLNHSNNEISKITAISSSSASFPAFKHAHTFIKKSFHRPAYCHHCSEV
MWGLMTVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPG
TFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPN
LSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHT
ICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSNVKSTS
EDWTDEDSKEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFN
FNKSMSSQTVIEQCLKAFHIFGKSDEYCMCEINEKDGRENPLDDKSNFKS
QLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINK
KTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDI
IQRLRKDSIRSLRLTRFYLKAIEDPHGPGVTIFVGNLVENLNQNVYEKML
LEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPL
MVMILPRIIPRMIPDDIIPLLVFVNLKSGGCQGTQLITAFRKLLNPHQVF
NLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSP
PIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLV
VKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDF
HNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHT
IDLPQIEGLIILNIMSWGGGANPWGPEKDDKFVKPTHYDGLLEVIGVSGM
IHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLK
SALRAIMLKKTKLGKRRKADSSNTGPPSRIPLPLMNSSNAVPNCSFRQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003951NAD+ kinase activity
GO:0004143diacylglycerol kinase activity
GO:0016301kinase activity
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017438ATP-NAD_kinase_N
IPR037607DGK
IPR035979RBD_domain_sf
IPR020454DAG/PE-bd
IPR000756Diacylglycerol_kin_accessory
IPR002219PE/DAG-bd
IPR000159RA_dom
IPR001206Diacylglycerol_kinase_cat_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR029071Ubiquitin-like_domsf
IPR016064NAD/diacylglycerol_kinase_sf
IPR000082SEA_dom
Vocabulary: biological process
TermDefinition
GO:0007205protein kinase C-activating G-protein coupled receptor signaling pathway
GO:0035556intracellular signal transduction
GO:0007165signal transduction
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020454Diacylglycerol/phorbol-ester bindingPRINTSPR00008DAGPEDOMAINcoord: 128..142
score: 29.77
coord: 157..168
score: 39.85
coord: 169..181
score: 35.34
coord: 144..153
score: 44.26
IPR001206Diacylglycerol kinase, catalytic domainSMARTSM00046dagk_c4a_7coord: 669..797
e-value: 1.5E-54
score: 197.2
IPR001206Diacylglycerol kinase, catalytic domainPFAMPF00781DAGK_catcoord: 669..774
e-value: 2.3E-23
score: 82.2
IPR001206Diacylglycerol kinase, catalytic domainPROSITEPS50146DAGKcoord: 665..803
score: 35.911
IPR000159Ras-associating (RA) domainSMARTSM00314RA_5coord: 378..468
e-value: 0.47
score: 11.0
coord: 472..574
e-value: 7.4E-6
score: 35.5
IPR000159Ras-associating (RA) domainPFAMPF00788RAcoord: 382..447
e-value: 1.4E-4
score: 22.4
coord: 474..571
e-value: 1.0E-10
score: 42.1
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 472..574
score: 13.68
IPR000756Diacylglycerol kinase, accessory domainSMARTSM00045dagk_c4b_2coord: 833..988
e-value: 1.3E-79
score: 280.4
IPR000756Diacylglycerol kinase, accessory domainPFAMPF00609DAGK_acccoord: 833..988
e-value: 2.5E-54
score: 183.9
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 131..180
e-value: 1.2E-9
score: 48.0
coord: 194..241
e-value: 1.2E-4
score: 31.4
coord: 260..310
e-value: 3.1E-4
score: 30.1
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 131..181
e-value: 6.5E-11
score: 41.9
coord: 260..311
e-value: 2.9E-8
score: 33.5
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 260..310
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 131..180
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 130..180
score: 14.625
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 193..241
score: 10.299
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 259..310
score: 10.6
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 131..180
e-value: 3.31219E-14
score: 65.5911
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 129..189
e-value: 6.5E-16
score: 59.9
NoneNo IPR availableGENE3DG3DSA:2.60.200.40coord: 832..1000
e-value: 7.7E-17
score: 63.6
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 465..576
e-value: 1.8E-12
score: 49.5
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 190..243
e-value: 2.5E-5
score: 25.9
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 258..311
e-value: 2.4E-17
score: 64.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1013..1034
NoneNo IPR availablePANTHERPTHR11255:SF34DIACYLGLYCEROL KINASE THETAcoord: 129..1021
NoneNo IPR availableCDDcd17111RA1_DAGK-thetacoord: 379..467
e-value: 2.45949E-23
score: 93.0323
NoneNo IPR availableCDDcd01783RA2_DAGK-thetacoord: 474..570
e-value: 2.18245E-32
score: 118.868
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 127..181
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 191..243
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 257..315
IPR017438Inorganic polyphosphate/ATP-NAD kinase, N-terminalGENE3DG3DSA:3.40.50.10330coord: 669..779
e-value: 2.0E-9
score: 38.9
IPR037607Diacylglycerol kinasePANTHERPTHR11255DIACYLGLYCEROL KINASEcoord: 129..1021
IPR016064NAD kinase/diacylglycerol kinase-like domain superfamilySUPERFAMILYSSF111331NAD kinase/diacylglycerol kinase-likecoord: 669..1009
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 474..571
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 574..654