Williams-Beuren syndrome chromosomal region 16 protein isoform X1

Overview
NameWilliams-Beuren syndrome chromosomal region 16 protein isoform X1
Smed IDSMED30032953
Length (bp)1565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 (SMED30032953) t-SNE clustered cells

Violin plots show distribution of expression levels for Williams-Beuren syndrome chromosomal region 16 protein isoform X1 (SMED30032953) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 (SMED30032953) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Williams-Beuren syndrome chromosomal region 16 protein isoform X1 (SMED30032953) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032953

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032953h1SMcG0020988 SmedASXL_012213SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032953h1SMcG0020988 SmedASXL_012213SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Human
Match: RCC1L (RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948])

HSP 1 Score: 204.527 bits (519), Expect = 1.945e-59
Identity = 138/403 (34.24%), Postives = 216/403 (53.60%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLI----NNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS-KVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPA-TFHAKT 1399
            V+G + +GALG+   +               RR+ P+ Y  +L   QKIS   AA GYGFTL S K++    V+G G+N DSQLG  +       G+  ++EPS + LP    +   +  ++CG  HS+++       T+ + ++++GNN +GQCGR++++NEIY  S  +H ++ FD  + QV CG+  +  LT+ G VY CG    GQ         SS  ++ G +    V Q++   +  LA++ DG ++GWGN+E+  + S  D +    P  L+    +GKV Q + G T CA+L+ +G +  WG  I+G GPN +    P +IP   FG    L + N   +V R+ CG+ + AA+T+ G L+VWG +I     +    +Q FP R PA +  AKT
Sbjct:   63 VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELD--QKIS--SAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVL-------TDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHF-SGVGKVRQAACGGTGCAVLNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFG----LTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRAPAPSASAKT 449          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Human
Match: RCC1L (RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948])

HSP 1 Score: 204.142 bits (518), Expect = 3.648e-59
Identity = 136/413 (32.93%), Postives = 217/413 (52.54%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLI----NNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS-KVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            V+G + +GALG+   +               RR+ P+ Y  +L   QKIS   AA GYGFTL S K++    V+G G+N DSQLG  +       G+  ++EPS + LP    +   +  ++CG  HS+++       T+ + ++++GNN +GQCGR++++NEIY  S  +H ++ FD  + QV CG+  +  LT+ G VY CG    GQ         SS  ++ G +    V Q++   +  LA++ DG ++GWGN+E+  + S  D +    P  L+    +GKV Q + G T CA+L+ +G +  WG  I+G GPN +    P +IP   FG    L + N   +V R+ CG+ + AA+T+ G L+VWG +I     +    +Q FP R+        +  G DH + +
Sbjct:   63 VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELD--QKIS--SAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVL-------TDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHF-SGVGKVRQAACGGTGCAVLNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFG----LTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTL 459          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Human
Match: RCC1L (RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948])

HSP 1 Score: 153.68 bits (387), Expect = 2.075e-41
Identity = 102/303 (33.66%), Postives = 163/303 (53.80%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLI----NNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDD 1120
            V+G + +GALG+   +               RR+ P+ Y  +L   QKIS   AA GYGFTL S K++    V+G G+N DSQLG  +       G+  ++EPS + LP    +   +  ++CG  HS+++       T+ + ++++GNN +GQCGR++++NEIY  S  +H ++ FD  + QV CG+  +  LT+ G VY CG    GQ         SS  ++ G +    V Q++   +  LA++ DG ++GWGN+E+  + S  D +    P  L+    +GKV Q + G T CA+L+D
Sbjct:   63 VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLEL--DQKIS--SAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVL-------TDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHF-SGVGKVRQAACGGTGCAVLND 353          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Human
Match: RCC1L (RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948])

HSP 1 Score: 91.2781 bits (225), Expect = 4.142e-21
Identity = 46/130 (35.38%), Postives = 77/130 (59.23%), Query Frame = 2
Query:  362 FQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK 739
             Q+  I  AA GYGFTL S K++    V+G G+N DSQLG  +       G+  ++EPS + LP    +   +  ++CG  HS+++       T+ + ++++GNN +GQCGR++++NEIY  S  +H ++
Sbjct:   31 LQQGQISSAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVL-------TDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQ 153          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Human
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 82.4185 bits (202), Expect = 1.219e-16
Identity = 73/255 (28.63%), Postives = 120/255 (47.06%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            ++CG  HS +V       T N  +Y  G+N +GQ G  +         + +  +K +K ++   CG   T + TE G+VY  G N  GQL   D    ++F  I+       +KQ+S   NT  ALTEDG ++ WG+N    I   +  + C  + +      TIGK +  +S G    A +   G+L+ +G    G LG PN+++    T           +L+     KV++VACG +++  +T   ++Y +G
Sbjct:   40 LSCGDEHSAVV-------TGNNKLYMFGSNNWGQLG--LGSKSAISKPTCVKALKPEK-VKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQV------TIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRT----------PQLVSEIPEKVIQVACGGEHTVVLTE-NAVYTFG 267          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Celegans
Match: W09G3.7 (pep chromosome:WBcel235:I:13797345:13802259:-1 gene:WBGene00012370.1 transcript:W09G3.7a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09G3.7)

HSP 1 Score: 144.05 bits (362), Expect = 7.623e-38
Identity = 112/412 (27.18%), Postives = 195/412 (47.33%), Query Frame = 2
Query:  245 GVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFP---ILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGS--SVIHGIKF--DKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLN----LPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVSG-----AYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            G++++GAL I +L+ N        AR    + YFN        SI+  ++G+GF+LF+ K+     +YG G+N+  Q+G Q   +NIN +    I  +   IP  E ++    I+ G  HS+I          N  ++ +G+N FGQCGR   + +   GS  S +  + F   +PI  + C   T+F++   G+V+  G N+ GQ  +   G      ++ G +E   ++++S   +T+LA +E+GE++ WG  E+       D       I+LN    +  ++G +I V +  ++    + +G +  WG+ ++G+GP     K PT +  P F G           V  V+ G    +AI   G L++WG +  S         Q FP ++      +   +G DHS+ +
Sbjct:   30 GLSASGALAIPKLVANSDDVTAGEARFPKRIAYFN------TKSIKFISSGFGFSLFASKN----RLYGAGINNRFQIGGQ--LTNINKYQDYYISAKKINIPGDEILE----ISSGRAHSLI--------RTNLGVFAIGDNNFGQCGRNPENMDYVVGSEESPLLPLSFPTSEPIISIHCSMDTSFVVDSSGAVFSFGLNEDGQCGNEAYGIQWEPAKVRGDVEGSKIQKVSGSTDTLLACSENGEIFIWGQTEYGQAAGATDE------IQLNTSRHVANSLGPIICVDSTQSSVVARNSRGNVFVWGVGVLGMGPEAESLKTPTQMDQPLFDG---------KMVTSVSAGNSCMSAINEDGRLFIWGENRYSSLGLGHQKRQLFPYQLFLPGDVRKAALGPDHSLFL 402          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Celegans
Match: W09G3.7 (pep chromosome:WBcel235:I:13797345:13802221:-1 gene:WBGene00012370.1 transcript:W09G3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09G3.7)

HSP 1 Score: 144.05 bits (362), Expect = 7.623e-38
Identity = 112/412 (27.18%), Postives = 195/412 (47.33%), Query Frame = 2
Query:  245 GVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFP---ILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGS--SVIHGIKF--DKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLN----LPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVSG-----AYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            G++++GAL I +L+ N        AR    + YFN        SI+  ++G+GF+LF+ K+     +YG G+N+  Q+G Q   +NIN +    I  +   IP  E ++    I+ G  HS+I          N  ++ +G+N FGQCGR   + +   GS  S +  + F   +PI  + C   T+F++   G+V+  G N+ GQ  +   G      ++ G +E   ++++S   +T+LA +E+GE++ WG  E+       D       I+LN    +  ++G +I V +  ++    + +G +  WG+ ++G+GP     K PT +  P F G           V  V+ G    +AI   G L++WG +  S         Q FP ++      +   +G DHS+ +
Sbjct:   30 GLSASGALAIPKLVANSDDVTAGEARFPKRIAYFN------TKSIKFISSGFGFSLFASKN----RLYGAGINNRFQIGGQ--LTNINKYQDYYISAKKINIPGDEILE----ISSGRAHSLI--------RTNLGVFAIGDNNFGQCGRNPENMDYVVGSEESPLLPLSFPTSEPIISIHCSMDTSFVVDSSGAVFSFGLNEDGQCGNEAYGIQWEPAKVRGDVEGSKIQKVSGSTDTLLACSENGEIFIWGQTEYGQAAGATDE------IQLNTSRHVANSLGPIICVDSTQSSVVARNSRGNVFVWGVGVLGMGPEAESLKTPTQMDQPLFDG---------KMVTSVSAGNSCMSAINEDGRLFIWGENRYSSLGLGHQKRQLFPYQLFLPGDVRKAALGPDHSLFL 402          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 81.6481 bits (200), Expect = 5.067e-16
Identity = 55/194 (28.35%), Postives = 92/194 (47.42%), Query Frame = 2
Query:  752 IRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            +  V CGE  T  LT+DG ++  GSN  GQL        S  I       +  + QIS   +  +++T+DG V+ WG+NEH  +  +   +    P R+   + I  ++QV++GS  C  LD+ G++  WG    G   ++         P P        L G    +VRV  G ++  A+++ G+++ WG +
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGMESKFTWQGTPRRV---QEINDIVQVASGSNHCIALDEGGRVFVWGEQADGRCIHR---------PEPV-----EQLSG--VPIVRVLAGARHCLALSASGAVFTWGQN 217          

HSP 2 Score: 70.4774 bits (171), Expect = 1.906e-12
Identity = 89/360 (24.72%), Postives = 145/360 (40.28%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKG---------INFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKF--DKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKV-----VKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIV------SGAYNQTFPVRMPATF--HAKTLYMGADHSIIV--GAP 1441
            + GCG   + QLG++            +  S I +PE++ G         +  + CG  H+V +       T +  ++++G+N  GQ GR         GS  I+ + +     I Q+  G   T  +T+DG V+  GSN++GQL     G  S F     G   +V     + Q++   N  +AL E G V+ WG           D  C  +P  +     +  +++V AG+  C  L   G + TWG    G LG + +  +          G G          VV  ACG  ++  +T  G  + +G+D +           +T P  +      H   +  GA H+I +  GAP
Sbjct:    5 LLGCGHTGEGQLGVR------------LSESTIQVPERIIGAPNDMDGTAVTSVTCGEQHTVFL-------TKDGKMWSVGSNMDGQLGR----GSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQL-----GMESKFTW--QGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWGEQA--------DGRCIHRPEPVEQLSGV-PIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLG----------VVEAACGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPTAVSDLIGSHVTRIAAGACHTIAICKGAP 315          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 81.6481 bits (200), Expect = 5.067e-16
Identity = 55/194 (28.35%), Postives = 92/194 (47.42%), Query Frame = 2
Query:  752 IRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            +  V CGE  T  LT+DG ++  GSN  GQL        S  I       +  + QIS   +  +++T+DG V+ WG+NEH  +  +   +    P R+   + I  ++QV++GS  C  LD+ G++  WG    G   ++         P P        L G    +VRV  G ++  A+++ G+++ WG +
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLGMESKFTWQGTPRRV---QEINDIVQVASGSNHCIALDEGGRVFVWGEQADGRCIHR---------PEPV-----EQLSG--VPIVRVLAGARHCLALSASGAVFTWGQN 217          

HSP 2 Score: 70.4774 bits (171), Expect = 1.906e-12
Identity = 89/360 (24.72%), Postives = 145/360 (40.28%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKG---------INFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKF--DKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKV-----VKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIV------SGAYNQTFPVRMPATF--HAKTLYMGADHSIIV--GAP 1441
            + GCG   + QLG++            +  S I +PE++ G         +  + CG  H+V +       T +  ++++G+N  GQ GR         GS  I+ + +     I Q+  G   T  +T+DG V+  GSN++GQL     G  S F     G   +V     + Q++   N  +AL E G V+ WG           D  C  +P  +     +  +++V AG+  C  L   G + TWG    G LG + +  +          G G          VV  ACG  ++  +T  G  + +G+D +           +T P  +      H   +  GA H+I +  GAP
Sbjct:    5 LLGCGHTGEGQLGVR------------LSESTIQVPERIIGAPNDMDGTAVTSVTCGEQHTVFL-------TKDGKMWSVGSNMDGQLGR----GSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQL-----GMESKFTW--QGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWGEQA--------DGRCIHRPEPVEQLSGV-PIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLG----------VVEAACGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPTAVSDLIGSHVTRIAAGACHTIAICKGAP 315          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Celegans
Match: glo-4 (X-linked retinitis pigmentosa GTPase regulator homolog [Source:UniProtKB/Swiss-Prot;Acc:Q5DX34])

HSP 1 Score: 69.3218 bits (168), Expect = 4.352e-12
Identity = 74/277 (26.71%), Postives = 111/277 (40.07%), Query Frame = 2
Query:  563 GINFIACGLGHSVIVAEIDAID-------------------TNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQL-ASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFG--GGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            G  F  CG+GHS  +A +  +D                    ++  ++T G   +GQ G    +N      + ++G+     + Q+ CG   T +LT+ G V  CGS  YGQ+    DI    +F  +  G     V+ I+      + +TED  V+ WG N                P  L +   + K I+        A L +     +      G  P ++    P  IP    G       LDGN   +V VACG+ +SA ITS G+LY WG
Sbjct:  796 GNRFGQCGVGHSFRIANLHQVDGDWPAIEKIACGQFHSAFICSDGSLWTFGWGVWGQLGHGGRNNSNQLVPTRVNGLICK--VTQIACGRAHTVVLTDTGRVLVCGSGSYGQMGVDDDIKKVFAFTPLPLGPLR--VRDIATHYYHSICITEDNRVFEWGRN----------------PQELKMRMFVMKKIR-------SAQLKNTEDPSSPSPSTNGSTP-RVNLNLPAEIPREDLGLREVKHFLDGN---IVSVACGLSHSALITSEGTLYTWG 1041          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Fly
Match: CG3862 (gene:FBgn0031286 transcript:FBtr0078038)

HSP 1 Score: 204.527 bits (519), Expect = 1.209e-59
Identity = 135/441 (30.61%), Postives = 217/441 (49.21%), Query Frame = 2
Query:  188 TEIYDYS--TNPPKNSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQ--PHSSNINGFPILMEPSEIPLPEKVKG-------INFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK------FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFK-PIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIVGAP 1441
            ++I +YS  T       + V+G   TGALG++  +   + +   +      L + N+        I   A GYGFT+++     G  ++G G+N DSQLG Q   + ++     +++ P+ I LP +V+G       +  ++ G  H V++       T N  I+TLGNN +GQCGR II+ E Y  S++IH I        +  + QVECG+  +  LT+ G +Y CG    GQ    +         I G +E + + ++SC  + VLAL E G+ +GWGN+E+  +   E        P  L L ++IGK+  V+AG + C  L+D+G ++TWG  I+G GP      +P  +  P FG   R    N++ VV + CGV +  A+ S G L++WG +      +    +Q FP +         +  G DH+I +  P
Sbjct:   29 SKIKEYSPKTTDSHEHRVYVWGFQETGALGLQTNVKKAKERYTEMVHHPTRLQFSNN------NEITDVAAGYGFTVYAVNRDDGETLFGSGLNTDSQLGFQVKGNPNDPANLDVIIYPTAIKLP-RVQGETDEDMRVKSMSAGRAHLVVL-------TQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDICGKEDEVVQVECGQDHSMFLTKKGRIYTCGWGADGQTGQGNYHTAGQITLIGGDVEKEKIVRLSCSSDCVLALNEAGDAFGWGNSEYGQLDDSELAETQINIPRALKLTKSIGKIKDVAAGGSFCMALNDQGLVYTWGFGILGFGPFVEQTSKPQHLLPPLFG---RNDFSNETTVVSIGCGVFHMGAVNSDGDLFMWGKNRFGHLGLGHKKDQFFPFKAAINGKVTKVAYGVDHTIALCKP 452          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0310555)

HSP 1 Score: 80.4925 bits (197), Expect = 1.755e-15
Identity = 74/259 (28.57%), Postives = 118/259 (45.56%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLAS---SDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKP--IRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LG---PNKIV-CKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRM 1375
            +Y  G+   GQ G   I++E     S I     D  ++QV CG   T  LT  G VY CGSN Y QL     +     S F+ I   +++ V+ QI C     LAL++ G+V  WG+N+   +    D      P  +R  + +T   V+Q++ G+     L   G+L++WG  I G LG   PN +  C  P            RL       +  +ACG  +S  I+  G+++ WG +      ++   N+++P ++
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILTPSQIPWTP-DTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPRMSPFLLIP-ELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKT---VVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPL-----------RLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQL 249          

HSP 2 Score: 77.0258 bits (188), Expect = 1.997e-14
Identity = 86/329 (26.14%), Postives = 151/329 (45.90%), Query Frame = 2
Query:  374 SIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQL---ASSDIGCCSSFIQITG--GIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHT-----WGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAIT-SYGSLYVWG 1327
            ++++ A G+  TLF   +     VY CG N  SQLG    +      P L+ P    L + V  I  I CG  HS+ +++          + + G+N  GQ G    D EI +   V+  +   K + Q+ CG   +  LT  G +Y  GSN YGQL   + +D+  C+  +++T   GI    +  I+C  N    +++ G V+GWG N    +  +++ + ++ P +L    T+G V  V+ G      L ++G + T     +G    G   N+++ +               +++   S + +VACG +++ A+  S G +Y +G
Sbjct:   41 AVQQVACGHRHTLFLTATG---KVYACGSNDYSQLGHDLPTKRPRMSPFLLIPE---LQDYV--IIQICCGSRHSLALSDWGQ-------VLSWGDNDCGQLG-HATDKEIVQLPKVVRQL-VTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIP---LAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSY-PTQLKTLRTLG-VRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRM--------------VMELMGSTITQVACGNRHTLALVPSRGRVYAFG 333          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Fly
Match: HERC2 (gene:FBgn0031107 transcript:FBtr0301344)

HSP 1 Score: 80.1073 bits (196), Expect = 2.495e-15
Identity = 77/258 (29.84%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  554 KVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLA--SSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIG-----KVIQVSAGSTTCAILDDKGQLHTWGMYIVGL--GPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAA 1294
            + K I  +ACG  HS       AI +  ++ YT G  ++G+ G    DN       ++  +   + + QV CG  +  T  LTEDG+V+  G   +G+L    S+       I+   GI    V QI C     LALT  GEVW WG  ++  +    D         +  P+ IG     +VI V+ G+  C  + D GQ++ WG    G     N  V K+P ++           LD     V RVACG  +S A
Sbjct: 3123 RAKKIRDVACGSSHSA------AISSQGEL-YTWGLGEYGRLGHG--DNTTQLKPKLVTALA-GRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIG---VVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQ-------HVRKPQPIGGLRGRRVIHVAVGALHCLAVTDAGQVYAWGDNDHGQQGSGNTFVNKKPALVIG---------LDA--VFVNRVACGSSHSIA 3349          

HSP 2 Score: 67.3958 bits (163), Expect = 2.790e-11
Identity = 83/324 (25.62%), Postives = 138/324 (42.59%), Query Frame = 2
Query:  353 LVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINF--IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNE-HNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSK-VVRVACGVKYSAAITS 1303
            L + Q + ++K A   G       ++ G  VY  G   D +LG   H +        M      L E + G++   IACG  HS       AI  +  ++ T G  ++G+ G    D+E      ++  +   + I  + CG  +  T  +T+D +V+  G   YG+L       C    +I       VVK + C     +ALT+ G V+ WG  + H       DH    +P ++   +   K+I ++ GS  C    D G+++TWG    G LG   +     T I  P      RL+   + K +V+V CG  ++ A+++
Sbjct: 4128 LGSLQHVFVKKVAVNSGGKHCLALTTEG-EVYAWGEGEDGKLG---HGNR-------MSYDRPKLVEHLNGMSVADIACGSAHSA------AITASGHVL-TWGKGRYGRLGHG--DSEDQLRPKLVEALLGYRAI-DIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVK-VECGSQFSVALTKSGAVYTWGKGDFHRLGHGSVDH--VRRPKKVAALQG-KKIISIATGSLHCVACSDSGEVYTWGDNDEGQLGDGTV-----TAIQRP------RLVAALQGKHIVKVTCGSAHTLALST 4415          

HSP 3 Score: 65.4698 bits (158), Expect = 9.461e-11
Identity = 59/202 (29.21%), Postives = 95/202 (47.03%), Query Frame = 2
Query:  746 KPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRC--NTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVK--YSAAITSYGSLYVWGN 1330
            +PI  +  G  + FI+++DG VY CG    G+L            Q+   +   VVK+++        LALT DG+V+ WG  E   +     +  T    RL       K+  V+ GS+  A +  +G+L+TWG+     +G G N    K P ++ A         L G   +VV+VACG +   + A+T  G+++ WG+
Sbjct: 3020 RPI-HIAGGSKSLFIVSQDGKVYACGEGTNGRLGLGVTHNVPLPHQLP-VLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKL--GHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDNTTQLK-PKLVTA---------LAGR--RVVQVACGSRDAQTLALTEDGAVFSWGD 3205          

HSP 4 Score: 51.9878 bits (123), Expect = 1.707e-6
Identity = 39/132 (29.55%), Postives = 67/132 (50.76%), Query Frame = 2
Query:  944 LALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGG-SRLLDGNKSK-VVRVACGVKYSAAITSYGSLYVWGND 1333
            LALT +G V+ WG+ ++  +  + + + + +PI   L E++ +V +V AGS     L  +GQL+TWG         K  C    ++     G    RL+   + K +V VA  V +  A++S G ++ WG +
Sbjct:  735 LALTSEGLVFAWGDGDYGKL-GNGNCNGSLQPI---LVESLPRVQRVFAGSQFSVALSSEGQLYTWG---------KATCLGHQLVERSVQGCSVPRLVSSLQHKRIVDVAVSVAHCLALSSSGEVFGWGRN 853          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072670)

HSP 1 Score: 79.7221 bits (195), Expect = 2.932e-15
Identity = 72/256 (28.12%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKP--IRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LG---PNKIV-CKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRM 1375
            +Y  G+   GQ G   I++E     S I     D  ++QV CG   T  LT  G VY CGSN Y QL   D+        +   +++ V+ QI C     LAL++ G+V  WG+N+   +    D      P  +R  + +T   V+Q++ G+     L   G+L++WG  I G LG   PN +  C  P            RL       +  +ACG  +S  I+  G+++ WG +      ++   N+++P ++
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILTPSQIPWTP-DTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLG-HDLPTKRPL--LIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKT---VVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPL-----------RLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQL 244          

HSP 2 Score: 73.559 bits (179), Expect = 2.503e-13
Identity = 85/329 (25.84%), Postives = 149/329 (45.29%), Query Frame = 2
Query:  374 SIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQL---ASSDIGCCSSFIQITG--GIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHT-----WGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAIT-SYGSLYVWG 1327
            ++++ A G+  TLF   +     VY CG N  SQLG        +  P    P  IP  +    I  I CG  HS+ +++          + + G+N  GQ G    D EI +   V+  +   K + Q+ CG   +  LT  G +Y  GSN YGQL   + +D+  C+  +++T   GI    +  I+C  N    +++ G V+GWG N    +  +++ + ++ P +L    T+G V  V+ G      L ++G + T     +G    G   N+++ +               +++   S + +VACG +++ A+  S G +Y +G
Sbjct:   41 AVQQVACGHRHTLFLTATG---KVYACGSNDYSQLG--------HDLPT-KRPLLIPELQDYVIIQ-ICCGSRHSLALSDWGQ-------VLSWGDNDCGQLG-HATDKEIVQLPKVVRQL-VTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIP---LAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSY-PTQLKTLRTLG-VRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRM--------------VMELMGSTITQVACGNRHTLALVPSRGRVYAFG 328          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072671)

HSP 1 Score: 79.7221 bits (195), Expect = 2.932e-15
Identity = 72/256 (28.12%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKP--IRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LG---PNKIV-CKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRM 1375
            +Y  G+   GQ G   I++E     S I     D  ++QV CG   T  LT  G VY CGSN Y QL   D+        +   +++ V+ QI C     LAL++ G+V  WG+N+   +    D      P  +R  + +T   V+Q++ G+     L   G+L++WG  I G LG   PN +  C  P            RL       +  +ACG  +S  I+  G+++ WG +      ++   N+++P ++
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILTPSQIPWTP-DTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLG-HDLPTKRPL--LIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKT---VVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPL-----------RLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQL 244          

HSP 2 Score: 73.559 bits (179), Expect = 2.503e-13
Identity = 85/329 (25.84%), Postives = 149/329 (45.29%), Query Frame = 2
Query:  374 SIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQL---ASSDIGCCSSFIQITG--GIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHT-----WGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAIT-SYGSLYVWG 1327
            ++++ A G+  TLF   +     VY CG N  SQLG        +  P    P  IP  +    I  I CG  HS+ +++          + + G+N  GQ G    D EI +   V+  +   K + Q+ CG   +  LT  G +Y  GSN YGQL   + +D+  C+  +++T   GI    +  I+C  N    +++ G V+GWG N    +  +++ + ++ P +L    T+G V  V+ G      L ++G + T     +G    G   N+++ +               +++   S + +VACG +++ A+  S G +Y +G
Sbjct:   41 AVQQVACGHRHTLFLTATG---KVYACGSNDYSQLG--------HDLPT-KRPLLIPELQDYVIIQ-ICCGSRHSLALSDWGQ-------VLSWGDNDCGQLG-HATDKEIVQLPKVVRQL-VTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIP---LAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSY-PTQLKTLRTLG-VRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRM--------------VMELMGSTITQVACGNRHTLALVPSRGRVYAFG 328          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Zebrafish
Match: rcc1l (RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370])

HSP 1 Score: 204.142 bits (518), Expect = 1.750e-59
Identity = 136/437 (31.12%), Postives = 224/437 (51.26%), Query Frame = 2
Query:  158 KRATKDYIRNTEIYDY-STNPPKNSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQP---HSSNINGFPILMEPSEIPL--PEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            KR  +D   +  +Y Y   N      + V+G + TGALGI   +  +  +      ++ P      L   QKIS   AA GYGFTL +  +     ++G G+N DSQLG Q      S    + +   P  +PL  P++ + +  ++CG  HS+++       T+++ ++++G+N FGQCGR+I+++E+Y GS V+H I+ FD  + QV CG+  +  LT+ GSV+ CG    GQ         S  + + G +    V+Q++   +  LA++ DG+V+GWGN+E+  + S  + +    P  L L + +G++ Q + G T  A+L++ G +  WG  I+G GP       P  +PA FFG   R       KV  + CG+ + AA+T  G L+VWG ++     +    +Q FP R+    H   +  G DH + +
Sbjct:   31 KREQQD---DVPVYQYVGQNRKPQGKVFVWGFSYTGALGIPSFVVPDSGRKKPRKTQLTPYC----LDTEQKIS--SAACGYGFTLLASNTKDLTKLWGMGLNKDSQLGFQRTQHDKSKSYDYVLEASPVSLPLLNPQETRVLQ-VSCGRAHSLVL-------TDSEGVFSMGSNTFGQCGRKIVEDEVYSGSHVVHKIEGFDSRVIQVACGQDHSLFLTDRGSVFACGWGADGQTGLGHHNKASCPVPVGGDLAGVTVQQVATYGDCSLAVSTDGQVFGWGNSEYLQLASVTESTQISSPRLLPL-KGVGRIRQAACGGTQVAVLNEDGDVFVWGFGILGKGPKLSESAIPERVPATFFG---RSEFNPTVKVASIRCGLSHFAAVTDGGELFVWGKNVRGCLGIGKHDDQYFPWRVTVPGHVTDVACGVDHMVAL 446          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Zebrafish
Match: rcbtb2 (regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 [Source:ZFIN;Acc:ZDB-GENE-071016-3])

HSP 1 Score: 78.5666 bits (192), Expect = 5.531e-15
Identity = 83/298 (27.85%), Postives = 133/298 (44.63%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRV-ACGVKY-SAAITSYGSLYVWG 1327
            V+  G N    LGL    S I       EP  I +    K I+ ++ G G  V++A  D        +Y  G+N + Q G    ++ +    +++      K + +V CG   T  LT DG VY  G N  GQ+ S       +  +++  ++NKVV  I+C     +A+ ++GE +GWG N  N      ++     P R+   + I  +IQV+ G      L D+G +++WG    G LG      K    +P         L++ +K ++V V AC   + SAA T  G + +WG
Sbjct:   43 VFALGTNCSGCLGLGDTQSTI-------EPRRIDILCGKKIIS-LSYGTGPHVVIATADGE------VYAWGHNGYSQLGNGTTNHGL--TPALVSTNLIGKRVTEVSCGSHHTIALTTDGEVYAWGYNNSGQVGSGSTANQPTPRRVSSCLQNKVVVNIACGQLCSMAVLDNGETYGWGYN-CNGQLGLGNNGNQQTPCRIAALQGI-NIIQVACGYAHTLALTDEGFVYSWGANSYGQLGTGN---KSNQAVPT--------LINMDKERMVEVAACHTSHTSAAKTQSGQVLMWG 311          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Zebrafish
Match: herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-070718-6])

HSP 1 Score: 79.337 bits (194), Expect = 6.512e-15
Identity = 80/297 (26.94%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNIN-GFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETI-----GKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPN--KIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            V+  G   D +LG   H S +N   P L+E        K K I  IACG  HS  +       T++  +Y+ G  ++G+ G    DN       ++  +     + QV CG  +  T  LT++G V+  G   +G+L       C+   Q    +  + V QI C     LALT+ G VW WG  ++  +    D       + +  P+ +      K++ V+ G+  C  + + GQ+  WG    G   N    V ++PT++           L+G K  + RVACG  +S A T+
Sbjct: 3062 VFSWGEGDDGKLG---HFSRMNCDKPRLIEAL------KTKRIRDIACGSSHSAAI-------TSSGELYSWGLGEYGRLGHG--DNTTQLRPKLVK-VLLGHRVVQVACGSRDAQTLALTDEGMVFSWGDGDFGKLGRGGSEGCN-IPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGTD-------VHVRKPQMVEGLRGKKIVHVAVGALHCLAVTETGQVFAWGDNDHGQQGNGTTTVNRKPTLVQG---------LEGQK--ITRVACGSSHSVAWTT 3320          

HSP 2 Score: 71.633 bits (174), Expect = 1.541e-12
Identity = 62/255 (24.31%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  560 KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWG-----MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            K +  IACG  +S  +       T +  ++T G   +G+ G     +E      ++  +K  K I  V CG  +  T  +TE+G V+  G   YG+L       C +  ++   +++  + ++ C     +ALT+DG+V+ WG  ++  +    D    +  +  +L     +V+ ++ GST C  L ++G++H+WG      +   L  NK   KQP  +P             N   +V ++CG   S + +S
Sbjct:  541 KQVVHIACGSTYSAAI-------TADGELHTWGRGNYGRLGHG--SSEDQTTPMLVTALKGLKVI-DVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKT-PKLVEKLQDLDIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHVRYPKLLDSLQGK--RVVDIAVGSTHCLALTEEGEVHSWGSNDKLQHFDTLFSNK---KQPKALPGL-----------NSKHIVGISCGPGQSFSWSS 768          

HSP 3 Score: 70.4774 bits (171), Expect = 3.437e-12
Identity = 86/325 (26.46%), Postives = 142/325 (43.69%), Query Frame = 2
Query:  353 LVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIP-LPEKVKGINF--IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKI-VCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            L + Q + IRK A   G       SS G  +Y  G   D +LG   H +          P + P + E ++G+    IA G  HS  +       T +  +YT G  ++G+ G    D+E      ++  ++  + I  V CG  +  T  LT+D  V+  G   YG+L       C   ++I       VVK + C     +ALT+ G V+ WG  +++ +    +DH    +P ++   +   KVI ++ GS  C    + G+++TWG    G LG       ++P ++ A         L G   K+ RVACG  ++ A ++
Sbjct: 4027 LESIQHVFIRKVAVNSGGKHCLALSSEG-ELYSWGEAEDGKLG---HGNR--------SPCDRPRVIESLRGVEVVDIAAGGAHSACI-------TASGELYTWGKGRYGRLGHG--DSEDQLKPKLVEALQGHRVI-DVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVK-VECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDH--VRRPRQVQGLQG-KKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAA---------LQGK--KINRVACGSAHTLAWST 4314          

HSP 4 Score: 67.781 bits (164), Expect = 2.960e-11
Identity = 75/324 (23.15%), Postives = 130/324 (40.12%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGI-NFIACGL-----GHSVIVAEIDAIDTNNQIIYTLG---NNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVK--------QISC--RCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGK-----VIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            VY CG   + +LGL             +    IP+P ++  + N++   +     G   +   +D        +++ G   + K G   R   D        +I  +K  K IR + CG   +  +T  G +Y  G  +YG+L   D          T  +  K+VK        Q++C  R    LALT++G V+ WG+ +   +       C       N+P+ I +     V Q+  G+     L   G + TWG    + +G G + +  ++P ++           L G   K+V VA G  +  A+T  G ++ WG++
Sbjct: 3007 VYACGEATNGRLGLG------------LSSGTIPIPRQISALSNYVVKKVAVHSGGRHAMALTVDGK------VFSWGEGDDGKLGHFSRMNCDK-----PRLIEALK-TKRIRDIACGSSHSAAITSSGELYSWGLGEYGRLGHGD---------NTTQLRPKLVKVLLGHRVVQVACGSRDAQTLALTDEGMVFSWGDGDFGKLGRGGSEGC-------NIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGTD-VHVRKPQMVEG---------LRGK--KIVHVAVGALHCLAVTETGQVFAWGDN 3278          

HSP 5 Score: 67.3958 bits (163), Expect = 3.546e-11
Identity = 59/215 (27.44%), Postives = 96/215 (44.65%), Query Frame = 2
Query:  719 SVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIEN--KVVKQISCRCNT----VLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSK-VVRVACGVKYSAAITSYGSLYVWGND 1333
            SV  G    K +  + CG   +  +T DG ++  G   YG+L     G  SS  Q T  +    K +K I   C +     LA+TE+G+VW WG+ ++  +       C    +   L +    +++V  GS     L   GQ++TWG      +G G ++ V + P            +LLD  + K VV +A G  +  A+T  G ++ WG++
Sbjct:  532 SVFSGRPVGKQVVHIACGSTYSAAITADGELHTWGRGNYGRL-----GHGSSEDQTTPMLVTALKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDL--DIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHV-RYP------------KLLDSLQGKRVVDIAVGSTHCLALTEEGEVHSWGSN 726          

HSP 6 Score: 57.7658 bits (138), Expect = 3.201e-8
Identity = 53/191 (27.75%), Postives = 81/191 (42.41%), Query Frame = 2
Query:  803 GSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVK--------------QISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            G++YG G N  GQL               GGIE   VK              Q+     T+ A+T DG+++  G      +      S +   +  ++     + + V++G   C  L  +G+L++WG    G LG  N+  C +P VI +         L G   +VV +A G  +SA IT+ G LY WG
Sbjct: 3948 GTIYGWGHNHRGQL---------------GGIEGAKVKVPTPTEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIRKVAVNSGGKHCLALSSEGELYSWGEAEDGKLGHGNRSPCDRPRVIES---------LRG--VEVVDIAAGGAHSACITASGELYTWG 4112          

HSP 7 Score: 55.0694 bits (131), Expect = 2.253e-7
Identity = 55/189 (29.10%), Postives = 84/189 (44.44%), Query Frame = 2
Query:  791 LTEDGSVYGCGSNQYGQLASSDIGCCSSFIQIT---GGIENKVVKQISCRCNTVLALTEDGEV--WGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAIL--DDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            L+ +G V+  G    G+L   D         I+   G    K V  I+C      A+T DGE+  WG GN       S ED +    P+ +   + + KVI V+ GS     L   + GQ+ +WG      +G G +   CK P ++         +L D +   +V+V CG ++S A+T  G +Y WG
Sbjct:  500 LSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMISVFSGRPVGKQVVHIACGSTYSAAITADGELHTWGRGNYGRLGHGSSEDQT---TPMLVTALKGL-KVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSD-GCKTPKLV--------EKLQDLD---IVKVCCGSQFSVALTKDGQVYTWG 672          

HSP 8 Score: 53.9138 bits (128), Expect = 5.033e-7
Identity = 66/277 (23.83%), Postives = 111/277 (40.07%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRC--NTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIG--KVIQVSAGSTTCAILDDKGQLHTWGMYIVG----------LGPNKIVCKQP-TVIPAPFFGGGSRLL------------DGNKSK----------------------VVRVACGVKYSAAITSYGSLYVWG 1327
            IY  G+N  GQ G   I+    +  +    +   +P+ Q+  GE T F +T DG +Y  G    G+L        S+   +   I++  +++++        LAL+ +GE++ WG  E   +       C     R  + E++   +V+ ++AG    A +   G+L+TWG    G          L P  +   Q   VI      G ++ L            DG+  K                      VV+V CG ++S A+T  G++Y WG
Sbjct: 3950 IYGWGHNHRGQLGG--IEGAKVKVPTPTEALATLRPV-QLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVST-PTLLESIQHVFIRKVAVNSGGKHCLALSSEGELYSWGEAEDGKLGHGNRSPCD----RPRVIESLRGVEVVDIAAGGAHSACITASGELYTWGKGRYGRLGHGDSEDQLKPKLVEALQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWG 4218          

HSP 9 Score: 53.1434 bits (126), Expect = 8.625e-7
Identity = 51/223 (22.87%), Postives = 92/223 (41.26%), Query Frame = 2
Query:  761 VECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCN--TVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND----IVSGAYNQTFPVRMPATFHAKTL 1402
            +  G   +  +T  G +Y  G  +YG+L   D        ++   ++   V  ++C       L LT+D  VW WG+ ++  +       C   P++++    +G V++V  GS     L   G ++TWG    + +G G +  V ++P  +           L G K  V+ +A G  +    T  G +Y WG++    +  G  N     R+ A    K +
Sbjct: 4092 IAAGGAHSACITASGELYTWGKGRYGRLGHGD-SEDQLKPKLVEALQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKV-PMKIDSLTGLG-VVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHV-RRPRQVQG---------LQGKK--VIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKI 4299          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Zebrafish
Match: rpgrb (retinitis pigmentosa GTPase regulator b [Source:ZFIN;Acc:ZDB-GENE-081015-2])

HSP 1 Score: 78.1814 bits (191), Expect = 8.265e-15
Identity = 71/260 (27.31%), Postives = 118/260 (45.38%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGK-VIQVSAGSTTCAILDDKGQLHTWGMY---IVGLGPNKI----VCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            I+CG  H+ +V E       N  ++  G+N +GQ G  +         + +  +K ++ ++   CG   T + T  G++Y CG N  GQL   D    +SF  +    +   +K ++   NT  ALT+DG ++ WG+N    I    E ++ T + +      ++GK V  VS G    A +   G L+T+G      +GL   K+    V +Q T IP                +VV+VACG  ++ A+T    +Y +G
Sbjct:   41 ISCGDEHTALVTE-------NGKLFMFGSNNWGQLG--LGTKTTVNKPTCVKALKSER-VKLTACGRTHTLVFTSRGNLYACGGNNEGQLGLGDCNDRTSFHLVEFFNKQGPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLGKESNALTPQEV------SVGKRVFWVSCGYYHSAFVTVDGALYTFGEKDSGKLGLSTEKLANHKVPQQVTDIP---------------DRVVQVACGGGHTVALTE-NEVYSFG 268          

HSP 2 Score: 62.7734 bits (151), Expect = 5.885e-10
Identity = 58/204 (28.43%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  734 IKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQIT--GGIENKVVKQISCRCNTVLALTEDGEVWG-WGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            +K D P+R + CG+  T ++TE+G ++  GSN +GQL    +G  ++  + T    ++++ VK  +C     L  T  G ++   GNNE      D +   +F  +     +  G +  ++AGS T A L   G+L+ WG      +GLG      K+   +       G R        V  V+CG  +SA +T  G+LY +G
Sbjct:   33 LKNDVPLR-ISCGDEHTALVTENGKLFMFGSNNWGQLG---LGTKTTVNKPTCVKALKSERVKLTACGRTHTLVFTSRGNLYACGGNNEGQLGLGDCNDRTSFHLVEFFNKQ--GPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLG------KESNALTPQEVSVGKR--------VFWVSCGYYHSAFVTVDGALYTFG 216          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Zebrafish
Match: rpgrb (retinitis pigmentosa GTPase regulator b [Source:ZFIN;Acc:ZDB-GENE-081015-2])

HSP 1 Score: 75.485 bits (184), Expect = 9.871e-14
Identity = 71/260 (27.31%), Postives = 118/260 (45.38%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGK-VIQVSAGSTTCAILDDKGQLHTWGMY---IVGLGPNKI----VCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            I+CG  H+ +V E       N  ++  G+N +GQ G  +         + +  +K ++ ++   CG   T + T  G++Y CG N  GQL   D    +SF  +    +   +K ++   NT  ALT+DG ++ WG+N    I    E ++ T + +      ++GK V  VS G    A +   G L+T+G      +GL   K+    V +Q T IP                +VV+VACG  ++ A+T    +Y +G
Sbjct:   41 ISCGDEHTALVTE-------NGKLFMFGSNNWGQLG--LGTKTTVNKPTCVKALKSER-VKLTACGRTHTLVFTSRGNLYACGGNNEGQLGLGDCNDRTSFHLVEFFNKQGPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLGKESNALTPQEV------SVGKRVFWVSCGYYHSAFVTVDGALYTFGEKDSGKLGLSTEKLANHKVPQQVTDIP---------------DRVVQVACGGGHTVALTE-NEVYSFG 268          

HSP 2 Score: 61.2326 bits (147), Expect = 2.757e-9
Identity = 58/204 (28.43%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  734 IKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQIT--GGIENKVVKQISCRCNTVLALTEDGEVWG-WGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            +K D P+R + CG+  T ++TE+G ++  GSN +GQL    +G  ++  + T    ++++ VK  +C     L  T  G ++   GNNE      D +   +F  +     +  G +  ++AGS T A L   G+L+ WG      +GLG      K+   +       G R        V  V+CG  +SA +T  G+LY +G
Sbjct:   33 LKNDVPLR-ISCGDEHTALVTENGKLFMFGSNNWGQLG---LGTKTTVNKPTCVKALKSERVKLTACGRTHTLVFTSRGNLYACGGNNEGQLGLGDCNDRTSFHLVEFFNKQ--GPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLG------KESNALTPQEVSVGKR--------VFWVSCGYYHSAFVTVDGALYTFG 216          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Xenopus
Match: rcc1l (RCC1 like [Source:NCBI gene;Acc:493236])

HSP 1 Score: 201.83 bits (512), Expect = 1.727e-58
Identity = 132/415 (31.81%), Postives = 218/415 (52.53%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP----EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPET-----IGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS-KVVRVACGVKYSAAITSYGSLYVWGNDIV----SGAY-NQTFPVRMPATFHAKTLYMGADHSIIV 1432
            V+G + TGALGI   +  E  +      ++ P     D    +KIS   AA GYGFTL S K++    ++G G+N DSQ+G  +       G+  ++EPS IPLP    ++ K +  ++CG  HS+I+       T+ + +++LGNN +GQC R++I+ EIY  S +IH ++  D  + QV CG+  +   TE G VY CG    GQ        CS+  ++ G +    + Q++   +  LA++E+G+++GWGN+E+  +      +C     +++L +      +GKV  V+ G T C  ++  G +  WG  I+G GPN +  +QP +IP   FG    L D N   +V +V  G+ + AA+ + G L+VWG ++     +G + +Q FP R+        +  G DH + +
Sbjct:   54 VWGFSHTGALGIPSFVIPETGRKKPKKFQLTPYRLDMD----EKIS--SAACGYGFTLLSSKTANITKIWGMGLNKDSQIGFHRSRRDRTKGYEYILEPSPIPLPLDKPQETKVLQ-VSCGRAHSLIL-------TDKEGVFSLGNNSYGQCAREVIEGEIYSESQLIHRVRELDSRVVQVACGQDHSLFRTEKGEVYSCGWGADGQTGLGHFNVCSNPTKLGGDMAGVNIVQVATYGDCCLAVSEEGQLYGWGNSEYLQL------ACVTDSTQVSLGQCTTFQHVGKVKHVACGGTGCIAVNGDGSVFVWGYGILGKGPNFLEAQQPEIIPQSLFG----LSDFNPDIRVTKVFSGLGHFAALNNRGELFVWGKNLRGCLGTGRFEDQYFPWRVTVPGEVVDVSCGVDHMVAL 444          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Xenopus
Match: rcc1l (RCC1 like [Source:NCBI gene;Acc:493236])

HSP 1 Score: 165.236 bits (417), Expect = 4.039e-46
Identity = 100/320 (31.25%), Postives = 171/320 (53.44%), Query Frame = 2
Query:  506 NGFPILMEPSEIPLP----EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS-KVVRVACGVKYSAAITSYGSLYVWGNDIV----SGAY-NQTFPVRMPATFHAKTLYMGADHSIIV 1432
             G+  ++EPS IPLP    ++ K +  ++CG  HS+I+       T+ + +++LGNN +GQC R++I+ EIY  S +IH ++  D  + QV CG+  +   TE G VY CG    GQ        CS+  ++ G +    + Q++   +  LA++E+G+++GWGN+E+  +    D +   +  +    + +GKV  V+ G T C  ++  G +  WG  I+G GPN +  +QP +IP   FG    L D N   +V +V  G+ + AA+ + G L+VWG ++     +G + +Q FP R+        +  G DH + +
Sbjct:   10 KGYEYILEPSPIPLPLDKPQETKVLQ-VSCGRAHSLIL-------TDKEGVFSLGNNSYGQCAREVIEGEIYSESQLIHRVRELDSRVVQVACGQDHSLFRTEKGEVYSCGWGADGQTGLGHFNVCSNPTKLGGDMAGVNIVQVATYGDCCLAVSEEGQLYGWGNSEYLQLACVTDST---QVSQCTTFQHVGKVKHVACGGTGCIAVNGDGSVFVWGYGILGKGPNFLEAQQPEIIPQSLFG----LSDFNPDIRVTKVFSGLGHFAALNNRGELFVWGKNLRGCLGTGRFEDQYFPWRVTVPGEVVDVSCGVDHMVAL 314          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Xenopus
Match: ENSXETT00000039329.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 85.8853 bits (211), Expect = 5.940e-17
Identity = 92/323 (28.48%), Postives = 145/323 (44.89%), Query Frame = 2
Query:  377 IRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDE---DHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAA-ITSYGSLYVWG 1327
            +++ A G   TLF  +      VY CG N + QLG     ++      L E          + I  IACG  H++      A+    Q +Y+ G+   GQ G   +++   R   +I  +   K I+QV CG      L +DG ++  G N +GQL   +     S  Q    +E   + Q++   +   AL+  G V+GWGNN    +  +DE   +  C  KP+R +      KVI +S G    AIL   G L T+G    G LG + +      + P        R+L+   S+V ++ACG +++ A + S G+LY +G
Sbjct:   36 VKEVACGGKHTLFLLEDG---QVYSCGWNGEGQLGHDHEGTDPVQVTTLTE----------EHITHIACGQSHNL------ALSYQGQ-LYSWGSGNDGQLGHATVEHS-SRIPRIIKKLNQQK-IQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTH------KVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSL---NNEINP-------RRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFG 320          

HSP 2 Score: 77.7962 bits (190), Expect = 1.885e-14
Identity = 68/233 (29.18%), Postives = 109/233 (46.78%), Query Frame = 2
Query:  656 GNNKFGQCGRQIIDNEIYRGS---SVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGN-NEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            G++ FGQ G    +   ++GS     +        +++V CG   T  L EDG VY CG N  GQL     G  +  +Q+T   E  +   I+C  +  LAL+  G+++ WG+ N+     +  +HS     I   L +   K+ QVS G+  C  L D GQL TWG  +   +GLG   +    P  + +         L+G    + +V  G  +S A++  G+++ WGN+
Sbjct:    5 GHSTFGQLG----NGHSFQGSVSDPCVCRFSLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEG--TDPVQVTTLTEEHIT-HIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQ--KIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKS---------LEG--IPLAQVTAGGSHSFALSLSGAVFGWGNN 217          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Xenopus
Match: ENSXETT00000027632.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 85.8853 bits (211), Expect = 6.072e-17
Identity = 92/323 (28.48%), Postives = 145/323 (44.89%), Query Frame = 2
Query:  377 IRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDE---DHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAA-ITSYGSLYVWG 1327
            +++ A G   TLF  +      VY CG N + QLG     ++      L E          + I  IACG  H++      A+    Q +Y+ G+   GQ G   +++   R   +I  +   K I+QV CG      L +DG ++  G N +GQL   +     S  Q    +E   + Q++   +   AL+  G V+GWGNN    +  +DE   +  C  KP+R +      KVI +S G    AIL   G L T+G    G LG + +      + P        R+L+   S+V ++ACG +++ A + S G+LY +G
Sbjct:   36 VKEVACGGKHTLFLLEDG---QVYSCGWNGEGQLGHDHEGTDPVQVTTLTE----------EHITHIACGQSHNL------ALSYQGQ-LYSWGSGNDGQLGHATVEHS-SRIPRIIKKLNQQK-IQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTH------KVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSL---NNEINP-------RRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFG 320          

HSP 2 Score: 77.7962 bits (190), Expect = 2.081e-14
Identity = 68/233 (29.18%), Postives = 109/233 (46.78%), Query Frame = 2
Query:  656 GNNKFGQCGRQIIDNEIYRGS---SVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGN-NEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            G++ FGQ G    +   ++GS     +        +++V CG   T  L EDG VY CG N  GQL     G  +  +Q+T   E  +   I+C  +  LAL+  G+++ WG+ N+     +  +HS     I   L +   K+ QVS G+  C  L D GQL TWG  +   +GLG   +    P  + +         L+G    + +V  G  +S A++  G+++ WGN+
Sbjct:    5 GHSTFGQLG----NGHSFQGSVSDPCVCRFSLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEG--TDPVQVTTLTEEHIT-HIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQ--KIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKS---------LEG--IPLAQVTAGGSHSFALSLSGAVFGWGNN 217          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Xenopus
Match: ENSXETT00000039331.1 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:100488790])

HSP 1 Score: 85.8853 bits (211), Expect = 6.477e-17
Identity = 92/323 (28.48%), Postives = 145/323 (44.89%), Query Frame = 2
Query:  377 IRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDE---DHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAA-ITSYGSLYVWG 1327
            +++ A G   TLF  +      VY CG N + QLG     ++      L E          + I  IACG  H++      A+    Q +Y+ G+   GQ G   +++   R   +I  +   K I+QV CG      L +DG ++  G N +GQL   +     S  Q    +E   + Q++   +   AL+  G V+GWGNN    +  +DE   +  C  KP+R +      KVI +S G    AIL   G L T+G    G LG + +      + P        R+L+   S+V ++ACG +++ A + S G+LY +G
Sbjct:   36 VKEVACGGKHTLFLLEDG---QVYSCGWNGEGQLGHDHEGTDPVQVTTLTE----------EHITHIACGQSHNL------ALSYQGQ-LYSWGSGNDGQLGHATVEHS-SRIPRIIKKLNQQK-IQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKVRETPCHVKPLRTH------KVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHDSL---NNEINP-------RRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFG 320          

HSP 2 Score: 77.7962 bits (190), Expect = 1.982e-14
Identity = 68/233 (29.18%), Postives = 109/233 (46.78%), Query Frame = 2
Query:  656 GNNKFGQCGRQIIDNEIYRGS---SVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGN-NEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            G++ FGQ G    +   ++GS     +        +++V CG   T  L EDG VY CG N  GQL     G  +  +Q+T   E  +   I+C  +  LAL+  G+++ WG+ N+     +  +HS     I   L +   K+ QVS G+  C  L D GQL TWG  +   +GLG   +    P  + +         L+G    + +V  G  +S A++  G+++ WGN+
Sbjct:    5 GHSTFGQLG----NGHSFQGSVSDPCVCRFSLAACVKEVACGGKHTLFLLEDGQVYSCGWNGEGQLGHDHEG--TDPVQVTTLTEEHIT-HIACGQSHNLALSYQGQLYSWGSGNDGQLGHATVEHSSRIPRIIKKLNQQ--KIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQSSPQRVKS---------LEG--IPLAQVTAGGSHSFALSLSGAVFGWGNN 217          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Mouse
Match: Rcc1l (reculator of chromosome condensation 1 like [Source:MGI Symbol;Acc:MGI:2137600])

HSP 1 Score: 207.608 bits (527), Expect = 1.157e-60
Identity = 136/442 (30.77%), Postives = 225/442 (50.90%), Query Frame = 2
Query:  158 KRATKDYIRNTEIYDY-STNPPKNSYLGVFGVASTGALGIKRLINNER----IKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP----EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS-KVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            +R   +   +  ++ Y      +   + V+G + +GALG+   +           L   RR+ P+ Y  +L +     I  AA GYGFTL S K+     V+G G+N DSQLG  +       G+  ++EPS +PLP    ++ K +  ++CG  HS+++       T+ + ++++GNN  GQCGR+++++E+Y  S  +H ++ FD  + QV CG+  +  LT+ G VY CG    GQ         S+  ++ G +    V Q++   +  LAL+ DG V+GWGN+E+  + S  D +    P  L     +GKV QV+ G T CA+L+ +G +  WG  I+G GP  +    P +IP   FG    L + N   +V ++ CG+ + AA+T+ G L+VWG +I     +    +Q FP R+        +  G DH + +
Sbjct:   32 RREAAEAEADVPVFQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGLRPRRRIQPVPYRLELDH----KISSAACGYGFTLLSSKTKDVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVPLPLDRPQETKVLQ-VSCGRAHSLVL-------TDREGVFSMGNNSHGQCGRKVVEDEVYSESHKVHRMQDFDGQVVQVVCGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSTPSKLGGDLAGVTVVQVATYGDCCLALSADGGVFGWGNSEYLQLASVTDSTQVNVPRCLPF-SGVGKVKQVACGGTGCAVLNAEGHVFVWGYGILGKGPKLLETAIPEMIPPTLFG----LTEFNPEVQVSQIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTL 456          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 85.8853 bits (211), Expect = 3.884e-17
Identity = 74/246 (30.08%), Postives = 115/246 (46.75%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAIT 1300
            ++CG  H+ IV       T N  +Y  G+N +GQ G  +         + I  +K +K ++   CG   T + T+ G VY  G N  GQL   D     +F QI        +KQ+S   NT  ALTEDG+++ WG+N    I   D+ + C    +      T+GK I  +S G    A +   G+L+T+G    G LG PN+++    +           R+L G   +V++VACG  ++  +T
Sbjct:   78 LSCGDEHTAIV-------TGNNKLYMFGSNNWGQLG--LGSKAAIIKPTCIKALKPEK-VKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCIPHEV------TVGKPISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSP---------QRVL-GIPERVIQVACGGGHTVVLT 297          

HSP 2 Score: 53.9138 bits (128), Expect = 3.755e-7
Identity = 54/193 (27.98%), Postives = 90/193 (46.63%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKV---KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEI---YRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI 1003
            ++  G N + Q+GL+             + S + +P +V   K I++I+CG  HS  V       T +  +YT G  + G+ G   + NE+   +R    + GI   + + QV CG   T +LTE   VY  G  Q+GQL        +S  +I   I+++ +  ISC  N    +TE G ++ +G+  H  +
Sbjct:  199 LFMWGDNSEGQIGLE-------------DKSNVCIPHEVTVGKPISWISCGYYHSAFV-------TMDGELYTFGEPENGKLG---LPNELLMNHRSPQRVLGIP--ERVIQVACGGGHTVVLTEK-VVYAFGLGQFGQLGLGTFLFETSEPKIIERIKDQKICHISCGENHTALMTELGLLYTFGDGRHGKL 365          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 85.5001 bits (210), Expect = 4.173e-17
Identity = 74/246 (30.08%), Postives = 115/246 (46.75%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAIT 1300
            ++CG  H+ IV       T N  +Y  G+N +GQ G  +         + I  +K +K ++   CG   T + T+ G VY  G N  GQL   D     +F QI        +KQ+S   NT  ALTEDG+++ WG+N    I   D+ + C    +      T+GK I  +S G    A +   G+L+T+G    G LG PN+++    +           R+L G   +V++VACG  ++  +T
Sbjct:   78 LSCGDEHTAIV-------TGNNKLYMFGSNNWGQLG--LGSKAAIIKPTCIKALKPEK-VKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCIPHEV------TVGKPISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSP---------QRVL-GIPERVIQVACGGGHTVVLT 297          

HSP 2 Score: 53.9138 bits (128), Expect = 4.545e-7
Identity = 54/193 (27.98%), Postives = 90/193 (46.63%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKV---KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEI---YRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI 1003
            ++  G N + Q+GL+             + S + +P +V   K I++I+CG  HS  V       T +  +YT G  + G+ G   + NE+   +R    + GI   + + QV CG   T +LTE   VY  G  Q+GQL        +S  +I   I+++ +  ISC  N    +TE G ++ +G+  H  +
Sbjct:  199 LFMWGDNSEGQIGLE-------------DKSNVCIPHEVTVGKPISWISCGYYHSAFV-------TMDGELYTFGEPENGKLG---LPNELLMNHRSPQRVLGIP--ERVIQVACGGGHTVVLTEK-VVYAFGLGQFGQLGLGTFLFETSEPKIIERIKDQKICHISCGENHTALMTELGLLYTFGDGRHGKL 365          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 85.8853 bits (211), Expect = 4.229e-17
Identity = 76/255 (29.80%), Postives = 119/255 (46.67%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            ++CG  H+ IV       T N  +Y  G+N +GQ G  +         + I  +K +K ++   CG   T + T+ G VY  G N  GQL   D     +F QI        +KQ+S   NT  ALTEDG+++ WG+N    I   D+ + C    +      T+GK I  +S G    A +   G+L+T+G    G LG PN+++    +           R+L G   +V++VACG  ++  +T    +Y +G
Sbjct:   78 LSCGDEHTAIV-------TGNNKLYMFGSNNWGQLG--LGSKAAIIKPTCIKALKPEK-VKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCIPHEV------TVGKPISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSP---------QRVL-GIPERVIQVACGGGHTVVLTEK-VVYAFG 305          

HSP 2 Score: 53.5286 bits (127), Expect = 5.598e-7
Identity = 54/193 (27.98%), Postives = 90/193 (46.63%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKV---KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEI---YRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI 1003
            ++  G N + Q+GL+             + S + +P +V   K I++I+CG  HS  V       T +  +YT G  + G+ G   + NE+   +R    + GI   + + QV CG   T +LTE   VY  G  Q+GQL        +S  +I   I+++ +  ISC  N    +TE G ++ +G+  H  +
Sbjct:  199 LFMWGDNSEGQIGLE-------------DKSNVCIPHEVTVGKPISWISCGYYHSAFV-------TMDGELYTFGEPENGKLG---LPNELLMNHRSPQRVLGIP--ERVIQVACGGGHTVVLTEK-VVYAFGLGQFGQLGLGTFLFETSEPKIIERIKDQKICHISCGENHTALMTELGLLYTFGDGRHGKL 365          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 84.7297 bits (208), Expect = 1.123e-16
Identity = 76/255 (29.80%), Postives = 119/255 (46.67%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            ++CG  H+ IV       T N  +Y  G+N +GQ G  +         + I  +K +K ++   CG   T + T+ G VY  G N  GQL   D     +F QI        +KQ+S   NT  ALTEDG+++ WG+N    I   D+ + C    +      T+GK I  +S G    A +   G+L+T+G    G LG PN+++    +           R+L G   +V++VACG  ++  +T    +Y +G
Sbjct:   78 LSCGDEHTAIV-------TGNNKLYMFGSNNWGQLG--LGSKAAIIKPTCIKALKPEK-VKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCIPHEV------TVGKPISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSP---------QRVL-GIPERVIQVACGGGHTVVLTE-KVVYAFG 305          

HSP 2 Score: 51.9878 bits (123), Expect = 1.795e-6
Identity = 54/193 (27.98%), Postives = 90/193 (46.63%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKV---KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEI---YRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI 1003
            ++  G N + Q+GL+  S+             + +P +V   K I++I+CG  HS  V       T +  +YT G  + G+ G   + NE+   +R    + GI   + + QV CG   T +LTE   VY  G  Q+GQL        +S  +I   I+++ +  ISC  N    +TE G ++ +G+  H  +
Sbjct:  199 LFMWGDNSEGQIGLEDKSN-------------VCIPHEVTVGKPISWISCGYYHSAFV-------TMDGELYTFGEPENGKLG---LPNELLMNHRSPQRVLGIP--ERVIQVACGGGHTVVLTEK-VVYAFGLGQFGQLGLGTFLFETSEPKIIERIKDQKICHISCGENHTALMTELGLLYTFGDGRHGKL 365          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. UniProt/SwissProt
Match: sp|Q9CYF5|RCC1L_MOUSE (RCC1-like G exchanging factor-like protein OS=Mus musculus OX=10090 GN=Rcc1l PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 8.096e-60
Identity = 136/442 (30.77%), Postives = 225/442 (50.90%), Query Frame = 2
Query:  158 KRATKDYIRNTEIYDY-STNPPKNSYLGVFGVASTGALGIKRLINNER----IKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP----EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS-KVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            +R   +   +  ++ Y      +   + V+G + +GALG+   +           L   RR+ P+ Y  +L +     I  AA GYGFTL S K+     V+G G+N DSQLG  +       G+  ++EPS +PLP    ++ K +  ++CG  HS+++       T+ + ++++GNN  GQCGR+++++E+Y  S  +H ++ FD  + QV CG+  +  LT+ G VY CG    GQ         S+  ++ G +    V Q++   +  LAL+ DG V+GWGN+E+  + S  D +    P  L     +GKV QV+ G T CA+L+ +G +  WG  I+G GP  +    P +IP   FG    L + N   +V ++ CG+ + AA+T+ G L+VWG +I     +    +Q FP R+        +  G DH + +
Sbjct:   32 RREAAEAEADVPVFQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGLRPRRRIQPVPYRLELDH----KISSAACGYGFTLLSSKTKDVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVPLPLDRPQETKVLQ-VSCGRAHSLVL-------TDREGVFSMGNNSHGQCGRKVVEDEVYSESHKVHRMQDFDGQVVQVVCGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSTPSKLGGDLAGVTVVQVATYGDCCLALSADGGVFGWGNSEYLQLASVTDSTQVNVPRCLPF-SGVGKVKQVACGGTGCAVLNAEGHVFVWGYGILGKGPKLLETAIPEMIPPTLFG----LTEFNPEVQVSQIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTL 456          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. UniProt/SwissProt
Match: sp|Q96I51|RCC1L_HUMAN (RCC1-like G exchanging factor-like protein OS=Homo sapiens OX=9606 GN=RCC1L PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 2.070e-58
Identity = 136/413 (32.93%), Postives = 217/413 (52.54%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLI----NNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS-KVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            V+G + +GALG+   +               RR+ P+ Y  +L   QKIS   AA GYGFTL S K++    V+G G+N DSQLG  +       G+  ++EPS + LP    +   +  ++CG  HS+++       T+ + ++++GNN +GQCGR++++NEIY  S  +H ++ FD  + QV CG+  +  LT+ G VY CG    GQ         SS  ++ G +    V Q++   +  LA++ DG ++GWGN+E+  + S  D +    P  L+    +GKV Q + G T CA+L+ +G +  WG  I+G GPN +    P +IP   FG    L + N   +V R+ CG+ + AA+T+ G L+VWG +I     +    +Q FP R+        +  G DH + +
Sbjct:   63 VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELD--QKIS--SAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVL-------TDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHF-SGVGKVRQAACGGTGCAVLNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFG----LTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTL 459          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. UniProt/SwissProt
Match: sp|Q9N1T2|RPGR_CANLF (X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris OX=9615 GN=RPGR PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 8.531e-20
Identity = 79/256 (30.86%), Postives = 122/256 (47.66%), Query Frame = 2
Query:  572 FIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            F++CG  H+ +V       T N  +Y  G+N +GQ G  +         + +  +K +K ++   CG   T + TE G VY  G N  GQL   D    S+F  I+     + +KQ+S   NT  ALTEDGE++ WG+N    I   +  + C  + +      T+GK I  +S G    A +  +GQL+T+G    G LG PN+++       P P   G          KVV+VACG  ++  +T   ++Y +G
Sbjct:   39 FLSCGDEHTAVV-------TGNNKLYMFGSNNWGQLG--LGSKSTVSKPTCVKALKPEK-VKFAACGRNHTLVSTEGGKVYAAGGNNEGQLGLGDTEERSTFHLISFFTSQRKIKQLSAGSNTSAALTEDGELFMWGDNSEGQIGLENVTNVCVPQQV------TVGKPISWISCGYYHSAFVTTEGQLYTFGEPECGKLGLPNQLLVNHRMPQPVPGIPG----------KVVQVACGGGHTVVLTEK-AVYTFG 267          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. UniProt/SwissProt
Match: sp|Q9R0X5|RPGR_MOUSE (X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus OX=10090 GN=Rpgr PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.073e-15
Identity = 76/255 (29.80%), Postives = 119/255 (46.67%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            ++CG  H+ IV       T N  +Y  G+N +GQ G  +         + I  +K +K ++   CG   T + T+ G VY  G N  GQL   D     +F QI        +KQ+S   NT  ALTEDG+++ WG+N    I   D+ + C    +      T+GK I  +S G    A +   G+L+T+G    G LG PN+++    +           R+L G   +V++VACG  ++  +T    +Y +G
Sbjct:   40 LSCGDEHTAIV-------TGNNKLYMFGSNNWGQLG--LGSKAAIIKPTCIKALKPEK-VKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKSNVCIPHEV------TVGKPISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSP---------QRVL-GIPERVIQVACGGGHTVVLTE-KVVYAFG 267          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. UniProt/SwissProt
Match: sp|Q4U2R1|HERC2_MOUSE (E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 2.652e-15
Identity = 82/297 (27.61%), Postives = 129/297 (43.43%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNIN-GFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETI-----GKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPN--KIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            V+  G   D +LG   H S +N   P L+E        K K I  IACG  HS  +       T++  +YT G  ++G+ G    DN       ++  +     + QV CG  +  T  LT++G V+  G   +G+L       C+   Q    +  + V QI C     LALT+ G VW WG  ++  +    D       + +  P+ +      K++ V+ G+  C  + D GQ++ WG    G   N    V ++PT++           L+G K  + RVACG  +S A T+
Sbjct: 3069 VFSWGEGDDGKLG---HFSRMNCDKPRLIEAL------KTKRIRDIACGSSHSAAL-------TSSGELYTWGLGEYGRLGHG--DNTTQLKPKMVK-VLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCN-IPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSD-------VHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQG---------LEGQK--ITRVACGSSHSVAWTT 3327          

HSP 2 Score: 75.8702 bits (185), Expect = 6.786e-13
Identity = 91/367 (24.80%), Postives = 155/367 (42.23%), Query Frame = 2
Query:  245 GVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKIS-------IRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPL---PEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM--YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            G+AS G + +      +R   L    RVY   Y +D++  Q +        ++ AA   G    +  ++   + +GCG     +LG   H   +     L EP  I      +  K +  IACG  +S  +       T    +YT G   +G+ G    ++E      ++ G+K  K I  V CG  +  T  +TE+G V+  G   YG+L       C +  ++   +++  V ++ C     +ALT+DG+V+ WG  ++  +    +    +  +   L     KVI V+AGST C  L +  ++H+WG           ++   +PT +P          LD     +V +ACG   S A +S
Sbjct:  448 GLASLGVMQVA--CAEKRFLILSRNGRVYTQAYNSDMLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCG--DGGRLG---HGDTVP----LEEPKVISAFSGKQAGKHVVHIACGSTYSAAI-------TAEGELYTWGRGNYGRLGHGSSEDEAI--PMLVAGLKGLKVI-DVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKT-PKLIEKLQDLDVIKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGK--KVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPTALPG---------LD--SKHIVGIACGPAQSFAWSS 779          

HSP 3 Score: 72.0182 bits (175), Expect = 9.461e-12
Identity = 87/325 (26.77%), Postives = 142/325 (43.69%), Query Frame = 2
Query:  353 LVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIP-LPEKVKGINFI--ACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKI-VCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            L + Q + I+K A   G       SS G  VY  G   D +LG   H +          P + P + E ++GI  +  A G  HS  V       T    +YT G  ++G+ G    D+E      ++  ++  + I  + CG  +  T  LT+D +V+  G   YG+L       C   ++I       VVK + C     +ALT+ G V+ WG  +++ +    +DH    +P ++   +   KVI ++ GS  C    + G+++TWG    G LG       ++P ++ A         L G   KV RVACG  ++ A ++
Sbjct: 4033 LESIQHVFIKKVAVNSGGKHCLALSSEG-EVYSWGEAEDGKLG---HGNR--------SPCDRPRVIESLRGIEVVDVAAGGAHSACV-------TAAGDLYTWGKGRYGRLGHS--DSEDQLKPKLVEALQGHRVI-DIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVK-VECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDH--VRRPRQVQGLQG-KKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAA---------LQGK--KVNRVACGSAHTLAWST 4320          

HSP 4 Score: 70.0922 bits (170), Expect = 3.891e-11
Identity = 78/325 (24.00%), Postives = 131/325 (40.31%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGIN-------FIACGLGHSVIVAEIDAIDTNNQIIYTLG---NNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVK--------QISC--RCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGK-----VIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            VY CG   + +LGL             M    +P+P ++  ++        +  G  H+  +       T +  +++ G   + K G   R   D        +I  +K  K IR + CG   +  LT  G +Y  G  +YG+L   D          T  ++ K+VK        Q++C  R    LALT++G V+ WG+ +   +       C       N+P+ I +     V Q+  G+     L   G + TWG    + +G G + +  ++P V+           L G   K+V VA G  +  A+T  G +Y WG++
Sbjct: 3014 VYSCGEATNGRLGLG------------MSSGTVPIPRQITALSSYVVKKVAVHSGGRHATAL-------TVDGKVFSWGEGDDGKLGHFSRMNCDK-----PRLIEALK-TKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGD---------NTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGC-------NIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSD-VHVRKPQVVEG---------LRGK--KIVHVAVGALHCLAVTDSGQVYAWGDN 3285          

HSP 5 Score: 63.929 bits (154), Expect = 2.870e-9
Identity = 54/214 (25.23%), Postives = 94/214 (43.93%), Query Frame = 2
Query:  719 SVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQL---ASSDIGCCSSFIQITGGIENKVVKQISCRCN--TVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDG-NKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            S   G +  K +  + CG   +  +T +G +Y  G   YG+L   +S D     +   +  G++   V  ++C       LA+TE+G+VW WG+ ++  +       C    +   L +    VI+V  GS     L   GQ+++WG      +G G  + V + P            +LL+G    KV+ VA G  +  A+T    ++ WG++
Sbjct:  543 SAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSED----EAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDL--DVIKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHV-RYP------------KLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSN 737          

HSP 6 Score: 55.4546 bits (132), Expect = 1.167e-6
Identity = 59/242 (24.38%), Postives = 99/242 (40.91%), Query Frame = 2
Query:  644 IYTLG---NNKFGQCGRQIIDN----EIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCN--TVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            +Y+ G   + K G   R   D     E  RG  V+           V  G   +  +T  G +Y  G  +YG+L  SD        ++   ++   V  I+C       L LT+D  VW WG+ ++  +       C   P++++    +G V++V  GS     L   G ++TWG    + +G G +  V ++P  +           L G K  V+ +A G  +    T  G +Y WG++
Sbjct: 4062 VYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVV----------DVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSD-SEDQLKPKLVEALQGHRVIDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKV-PMKIDSLTGLG-VVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHV-RRPRQVQG---------LQGKK--VIAIATGSLHCVCCTEDGEVYTWGDN 4278          

HSP 7 Score: 54.6842 bits (130), Expect = 2.374e-6
Identity = 69/275 (25.09%), Postives = 109/275 (39.64%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRC--NTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG----------LGPNKIVCKQP-TVIPAPFFGGGSRLL------------DGNKSK----------------------VVRVACGVKYSAAITSYGSLYVWG 1327
            IY  G+N  GQ G   I+    +  +    +   +P+ Q+  GE T F +T DG +Y  G    G+L        S+   +   I++  +K+++        LAL+ +GEV+ WG  E   +       C  +P  +     I +V+ V+AG    A +   G L+TWG    G          L P  +   Q   VI      G ++ L            DG+  K                      VV+V CG ++S A+T  G++Y WG
Sbjct: 3956 IYGWGHNHRGQLGG--IEGAKVKVPTPCEALATLRPV-QLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVST-PTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCD-RPRVIESLRGI-EVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVIDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWG 4224          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. TrEMBL
Match: T1G3K3 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20215651 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 3.807e-73
Identity = 142/408 (34.80%), Postives = 230/408 (56.37%), Query Frame = 2
Query:  242 FGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGK--SSIGWHVYGCGVNHDSQLGLQPHSSNING-FPILMEPSEIPLPEKVKG--INFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVS----GAYN-QTFPVRMPATFHAKTLYMGADHSIIV 1432
            +G ASTGALG+K L+  E+ +     R+V       +++  +K+ ++    GYGFT+F+ +  S+   HVYG G+N DSQ+G   +         +L+EPSEI LP + +   I  +ACG  H+VIV       T+ + ++TLGNN  GQCGR+II++EI+RGS +++ I F + I+QV CG+  T +LT+DG ++ CG +  GQ       C  +F ++ G ++ + + Q+S + +TVLA++E G+++GWGNNE++ +     D +    P  + L   +G V +     +TCAIL+ KG ++TWG  I+G GP       P VIP   FG          + V  + CG+ +  A+T  G LY WG + ++    G  N Q FP++       K ++ G DH++++
Sbjct:   40 WGSASTGALGVKTLVRPEKHQK---TRKVQLTPLKIEIMAKRKLKVKAMGCGYGFTVFACEDGSTGQMHVYGTGLNTDSQIGYHEYPRRSGRVLELLIEPSEIQLPLQNRSTRITHVACGRAHTVIV-------TDGEGVFTLGNNSLGQCGRKIIESEIFRGSQLVNRIDFKEKIKQVVCGQDHTLLLTDDGRLFACGLSTDGQTGQGHYECVENFEEVVGDVKGEKIVQVSSKADTVLAVSEKGDLFGWGNNEYDQLEIVAPDETQLHTPRHVRLRPDVGPVKKTCTAGSTCAILNRKGLVYTWGYGILGRGPTVDRSAVPHVIPPILFGNTD--YKTGDAAVTDLQCGLHFFTALTCSGDLYTWGRNRLACLGLGHVNDQYFPLKTHIPAEVKQVHCGVDHAVVL 435          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. TrEMBL
Match: A0A1W4WGP9 (Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Agrilus planipennis OX=224129 GN=LOC108733084 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.231e-68
Identity = 145/452 (32.08%), Postives = 232/452 (51.33%), Query Frame = 2
Query:  122 KNFFNQIRSFGVKR---ATKDYIRNTEIYDYSTNPPKNSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFS-GKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEI--PLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIVGAP 1441
            K FFNQIR + VKR      +  +   ++ Y  +    + + V+G   TGAL + +    E+        ++ P+ Y   L   +   +   A G+GF++FS   ++    +YG G+N DSQ+G      N     I+  P  I  PL EK   IN IA G  H++++         ++ ++T GNN +GQCGR II +E Y  S  +H I   D  I+ VECG+  + ILTE G VY CG    GQ         S F ++ G I N+ + ++S R + VLA+ + GEV+GWGN E+  + +  D         +   + +GK++ ++AG + C IL++ GQ+ +WG  ++G GP     K+P ++P   FG      D   SKV+++  G+ ++AAI++YG+LY+WG +      +    +Q FP R+  +   K +  G DHSI +  P
Sbjct:    5 KQFFNQIRGYAVKRKYPVNPEDAKKLPVFGYGISKASYNRIFVWGCRETGALAVPQKKEEEKF------HKISPIKYPKRLFFAENHEVTNVACGFGFSIFSVNPNNDNSRLYGTGINSDSQIGYHAIREN-KPLEIIFSPVAIHLPLKEKKTRINKIAAGRAHTLVLT--------SEGLFTFGNNAYGQCGRMIITDEDYSNSHYVHKISNVDDTIKDVECGQDHSLILTESGQVYSCGWGADGQTGLGHFNSESRFTRVLGDIANENIVKVSGRSDFVLAINDKGEVFGWGNTEYAQLDTPNDLQQVCNATFIEKCKGLGKIVDIAAGGSFCLILNEDGQVFSWGYGLLGAGPKVQYSKKPVLLPEILFGKNEFQTD---SKVIKIKAGIGHAAAISNYGNLYMWGRNRSGCLGMGHDKDQPFPFRVSVSGLVKDVSCGFDHSIALCKP 438          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. TrEMBL
Match: A0A0L8GIM0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22033421mg PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.742e-68
Identity = 152/438 (34.70%), Postives = 230/438 (52.51%), Query Frame = 2
Query:  158 KRATKDYIRNTEIYDYSTNPPK--NSYLGVFGVASTGALGIKRLINNERIKNLHIA--RRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGF-PILMEPS--EIPL--PEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSI 1426
            KR  K       +  Y+       N  L  +G ++TGALGIK  +    +K  H++   R   L +F++    Q + +   A GYGFTLF         + G G+N DSQ+G      + + F   ++EP+  EIPL  P K K I  +A G  H++I+       T+ + +++LGNN FGQCGR I++ E YRGSS I  I+     I++V CG+  TF LT+ G VY CG +  GQ         S   Q+ G IE   +KQI+C  + VLAL+++G ++GWGN+E+N +    DH+    P    L  ++GK+ QV++G + C  L+  G++ TWG  I+G GP       PT +P P FG     LD  K+ VV + CG+ + AA+T++G LY WG +      +    +Q FP+R+        ++ G DH +
Sbjct:   35 KRIAKQQAIEETVVQYTAEDVSHLNERLYAWGFSATGALGIKSYLR-PGVKQTHLSFMHRPARLKFFDE----QHLKVGHVACGYGFTLFQSSLQGSSVLLGTGINTDSQIGCYQMQKDSDRFLDYIIEPTNIEIPLLHPTKTKIIG-MAGGRAHAIIL-------TDQEGVFSLGNNSFGQCGRPIVETEKYRGSSTITKIRHLPDNIKEVVCGQDHTFFLTQSGEVYSCGLSSDGQTGLGHYKNVSQATQVKGDIEGVNIKQIACSGDCVLALSDEGNLFGWGNSEYNQLALITDHTQVHTPKHFKLSASLGKITQVASGGSICGFLNASGEVFTWGFGILGRGPKVQSSTVPTKLPTPLFGANE--LDPAKT-VVSLKCGIYHFAALTNHGDLYTWGKNKQGYLGLGDRNDQFFPLRVSMPVEVINVWCGVDHMV 456          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. TrEMBL
Match: B5X3R9 (Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Salmo salar OX=8030 GN=WBS16 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 7.563e-65
Identity = 141/435 (32.41%), Postives = 230/435 (52.87%), Query Frame = 2
Query:  161 RATKDYIRNTEIYDYSTNPPK-NSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQ-PHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            R +++      ++ Y     K N  + V+G + TGALGI   +  +  +      R Y L  +  L   Q+IS   AA GYGFTL S  +     V+G G+N DSQLG Q         +  ++EPS +PLP    +   +  +ACG  HS+++       T+++ +++LGNN +GQCGR+++++E+Y  S +IH ++ FD P+ QV CG+  +  LTE G VY CG    GQ        C+  + + G +    V+Q++   +  +A+++DG+++GWGN+E+  + S  + +    P RL   E +GKV QV+ G T  AIL+++G++  WG  I+G GPN    + P ++P   FG   R        V R+ CG+ + AA+T  G L+VWG ++     +    +Q FP R+    H   +  G DH + +
Sbjct:   28 RRSRELKDEGPVFQYVGKQRKPNHKVFVWGFSYTGALGIPSFVIPDSGRK---KPRKYQLTPYR-LETEQQIS--SAACGYGFTLLSSSTKDLTKVWGMGLNRDSQLGFQRTQQDRHKSYDYVLEPSPVPLPLARPQQTRVVQVACGRAHSLVL-------TDSEGVFSLGNNAYGQCGRKMVEDEVYSASHIIHKMEGFDSPVTQVVCGQDHSLFLTETGKVYACGWGADGQTGLGHHNMCARPVAVGGDLAGVRVQQVTTYGDCSMAVSQDGQLYGWGNSEYLQLSSVTEATQINSP-RLLPFERVGKVTQVACGGTQVAILNERGEVFVWGYGILGKGPNLSESQTPELVPPALFG---RSEFNPAVTVSRIHCGLNHFAAVTDRGELFVWGKNVRGCLGIGKKEDQYFPWRVTVPGHVVDVACGVDHMVAL 445          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. TrEMBL
Match: V5GWG5 (Williams-Beuren syndrome chromosomal region protein (Fragment) OS=Anoplophora glabripennis OX=217634 GN=WBS16 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 7.683e-65
Identity = 140/437 (32.04%), Postives = 229/437 (52.40%), Query Frame = 2
Query:  176 YIRNTEIYDYSTNPPKNSYLGVFGVASTGALGIKRLINNER---IKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLP----EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGI-KFD-KPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVV-RVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIVGAP 1441
            ++    ++ Y+ +      +  +G   TGALG+  + NN+    I+ L   RR+            ++  +  AA G+GFT++   S     +YG G+N DSQ+G            I+  P  IPLP    EK K I  +A G  HSV++ +        + I+TLGNN +GQCGR++I NE Y  S+ IH I K + K I  +ECG+  +  LTEDG+VY CG    GQ   +       F ++ G IEN+ + +++C+ +  LAL + G+V+GWGN E+N I           P  +++ + IGK+  +++  T C +++++G +++WG  ++G+GPN    K P  IP   FG    L D   + +V +V CG+ Y+ A+T+ G L+ WG +      + G  +Q FP+++    H   ++ GADHS+ +  P
Sbjct:   57 HVEKLPVFQYTVSKKNYRRVFAWGNLETGALGVPYVENNKNKDIIRCLSFPRRI---------TFGEQFEVVSAACGFGFTIYGVNSDTNIKIYGTGINTDSQIGYH-EVRQYKPLGIIFRPQPIPLPFLNPEKTK-ILKLAAGRAHSVVLTD--------EGIFTLGNNSYGQCGRKVIPNEDYSMSNYIHHISKLEGKNIVDIECGQDHSLALTEDGNVYSCGWGADGQTGLNHFDNVEQFTRVKGDIENEKIVKLACKADFTLALNDKGDVFGWGNTEYNQITLPGGDQQLSVPSYIDMLKKIGKITSIASSGTLCIVVNEQGHVYSWGYGLLGVGPNIQQSKLPIKIPETLFG----LNDFQPNNIVQKVVCGLNYAVAVTNGGDLFAWGRNKHGCLGLGGDKDQYFPLKVSLGGHVDEIFCGADHSVTICKP 470          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Cavefish
Match: rcc1l (RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370])

HSP 1 Score: 188.734 bits (478), Expect = 8.987e-54
Identity = 135/409 (33.01%), Postives = 213/409 (52.08%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQ-PHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQ-LASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            V+G + TGALG+   +  +  +      R Y L  +  L   QKIS   AA GYGFTL +  +     V+G G+N DSQLG Q         +  ++EPS + LP    +   +  ++CG  HS+++ + +         +++GNN +GQCGR+I++NE+Y GS ++H I+ F+  + QV CG+  +  LTE GSVY CG    GQ L   D       + + G +    ++Q+S   +  LA++ +G+++GWGN+E+  + S  + +    P  L L + +GKV Q + G T  AIL++ G++  WG  I+G GPN    + P  +PA  FG   R       KV  + CG+   AAIT  G L+VWG ++     +    +Q FP R+    H   +  G DH + +
Sbjct:   56 VWGFSCTGALGVPSFVVPDSGRK---KLRKYQLTPYR-LDTEQKIS--SAACGYGFTLLASNTKDLTKVWGMGLNKDSQLGFQRTQHYRDKSYDYVLEPSPVSLPLVNPQETRVLQVSCGRAHSLVLTDSEG--------FSIGNNVYGQCGRKIVENEVY-GSHLVHKIEGFESRVVQVACGQDHSLFLTETGSVYACGWGADGQTLGHHDKTAIP--VLVGGDLAGVKIQQVSTYGDCSLAVSTEGQLFGWGNSEYLQLASVTETTQISSPRLLPL-DGVGKVTQAACGGTQVAILNE-GEMFVWGYGILGKGPNLSESEMPEKVPATLFG---RSEFSPTVKVSHIRCGLTNFAAITR-GELFVWGKNVRGCLGIGKRDDQYFPWRVTVPGHVVDVACGVDHMVAL 441          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Cavefish
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 75.485 bits (184), Expect = 5.852e-14
Identity = 67/257 (26.07%), Postives = 115/257 (44.75%), Query Frame = 2
Query:  572 FIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIV-CKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGN 1330
             I+CG  HS  V E       +  ++  G+N  GQ G  +           +  +K ++ +R   CG   T + T  G ++  G N  GQL        +SF Q+    +   +KQ+S  CNT  ALTEDG ++ WG+N    +    ++   F P  L +  +   V  +S G    A++ D G ++T+G      +GL  +++   +QP  +             G+   V++V+CG  ++ A+T    LY +G+
Sbjct:   67 LISCGHSHSAFVTE-------HGRLFVFGSNSSGQLG--LESKGPITKPVCVKALKHER-VRFTACGTNHTLVSTSRGEIFAAGRNSEGQLGLGHCEERTSFQQLHPFCDGAPLKQLSAGCNTSAALTEDGRLFMWGDNSVGQLGLGSENLVLF-PKLLKVDRS---VTGISCGLNHSALITDIGDVYTFGEAADGRLGLSADQLANHRQPQRV-------------GSLEGVLQVSCGGTHTLALTE-NELYAFGH 295          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Cavefish
Match: rcbtb1 (regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7951])

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-13
Identity = 71/271 (26.20%), Postives = 122/271 (45.02%), Query Frame = 2
Query:  545 LPEKVKGIN-----FIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGP-NKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVAC--GVKYSAAITSYGSLYVWGN 1330
            +P K+ G++      ++ G G  V++A      T    +Y  G+N + Q G    +  +     ++     +K + +V CG   +  LT DG V+  G N  GQ+ S       +  +++  ++NK V  I+C   + +A++++GEV+GWG N  N      ++     P RL   + +  V+Q+++G      L D+G L+ WG    G LG  NK     P  + A             K ++V +A       SAA T  G +Y+WG 
Sbjct:  124 VPRKLDGLSGKKVVSLSYGSGPHVLLA------TEEGDMYAWGHNGYSQLGNGTTNQGVC--PVLVSTNLQNKRVIEVACGSHHSLALTHDGEVFAWGYNNCGQVGSGSTANQPTPRKVSNCLQNKAVVSIACGQTSSMAVSDNGEVYGWGYNG-NGQLGLGNNGNQLTPCRLAALQGLC-VLQIASGYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQLSPVQVMA------------EKERIVEIAACHSTHTSAAKTQSGQVYMWGQ 372          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Cavefish
Match: herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-070718-6])

HSP 1 Score: 74.3294 bits (181), Expect = 1.888e-13
Identity = 80/297 (26.94%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNIN-GFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETI-----GKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPN--KIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            V+  G   D +LG   H S +N   P L+E        K K I  IACG  HS  +       T++  +Y+ G  ++G+ G    DN       ++  +     + QV CG  +  T  LT++G V+  G   +G+L       C+   Q    +  + V QI C     LALT+ G VW WG  ++  +    D       + +  P+ +      K++ V+ G+  C  + + GQ+  WG    G   N    V ++PT++           L+G K  + RVACG  +S A T+
Sbjct: 3061 VFSWGEGDDGKLG---HFSRMNCDKPRLIEAL------KTKRIRDIACGSSHSAAI-------TSSGELYSWGLGEYGRLGHG--DNTTQLRPKLVK-VLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCN-IPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGTD-------VHVRKPQMVEGLRGKKIVHVAVGALHCLAVTETGQVFAWGDNDHGQQGNGTTTVNRKPTLVQG---------LEGQK--ITRVACGSSHSVAWTT 3319          

HSP 2 Score: 69.707 bits (169), Expect = 4.970e-12
Identity = 64/255 (25.10%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  560 KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWG-----MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            K +  IACG  +S  +       T +  ++T G   +G+ G    +++      ++  +K  K I  V CG  +  T  +TE+G V+  G   YG+L       C S  ++   +++  + ++ C     +ALT+DG+V+ WG  ++  +    D    +  +  +L     KV+ ++ GST C  L + G++H+WG      +   L  NK   KQP  +P             N   +V ++CG   S A +S
Sbjct:  550 KHVVHIACGSTYSAAI-------TADGELFTWGRGNYGRLGHGSSEDQTT--PMLVTALKGLKVI-DVACGSGDAQTLSVTENGQVWSWGDGDYGKLGRGGSDGCKS-PKLVEKLQDLDIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHVRYPKLLDSLQGK--KVVDIAVGSTHCLALTEDGEVHSWGSNDKLQHFDTLFSNK---KQPKALPGL-----------NSKHIVGISCGPGQSFAWSS 777          

HSP 3 Score: 67.781 bits (164), Expect = 2.508e-11
Identity = 87/325 (26.77%), Postives = 142/325 (43.69%), Query Frame = 2
Query:  353 LVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIP-LPEKVKGINF--IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKI-VCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            L + Q + IRK A   G       SS G  VY  G   D +LG   H +          P + P + E ++G+    IA G  HS  +       T +  +YT G  ++G+ G    D+E      ++  ++  + I  V CG  +  T  LT+D  V+  G   YG+L       C   ++I       VVK + C     +ALT+ G V+ WG  +++ +    +DH    +P ++   +   KVI ++ GS  C    + G+++TWG    G LG       ++P ++ A         L G   K+ RVACG  ++ A ++
Sbjct: 4026 LESIQHVFIRKVAVNSGGKHCLALSSEG-EVYSWGEAEDGKLG---HGNR--------SPCDRPRVIESLRGVEVVDIAAGGAHSACI-------TASGELYTWGKGRYGRLGHG--DSEDQLKPKLVDALQGHRVI-DVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVK-VECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDH--VRRPRQVQGLQG-KKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAA---------LQGK--KINRVACGSAHTLAWST 4313          

HSP 4 Score: 62.7734 bits (151), Expect = 8.721e-10
Identity = 77/324 (23.77%), Postives = 130/324 (40.12%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGI-NFIACGL-----GHSVIVAEIDAIDTNNQIIYTLG---NNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVK--------QISC--RCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGK-----VIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            VY CG   + +LGL   S  I            P+P +V  + N++   +     G   +   +D        +++ G   + K G   R   D        +I  +K  K IR + CG   +  +T  G +Y  G  +YG+L   D          T  +  K+VK        Q++C  R    LALT++G V+ WG+ +   +       C       N+P+ I +     V Q+  G+     L   G + TWG    + +G G + +  ++P ++           L G   K+V VA G  +  A+T  G ++ WG++
Sbjct: 3006 VYACGEATNGRLGLGLSSGTI------------PIPRQVSALSNYVVKKVAVHSGGRHAMALTVDGK------VFSWGEGDDGKLGHFSRMNCDK-----PRLIEALK-TKRIRDIACGSSHSAAITSSGELYSWGLGEYGRLGHGD---------NTTQLRPKLVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGC-------NIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGTD-VHVRKPQMVEG---------LRGK--KIVHVAVGALHCLAVTETGQVFAWGDN 3277          

HSP 5 Score: 59.6918 bits (143), Expect = 8.038e-9
Identity = 56/215 (26.05%), Postives = 96/215 (44.65%), Query Frame = 2
Query:  719 SVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIEN--KVVKQISCRCNT----VLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNK-SKVVRVACGVKYSAAITSYGSLYVWGND 1333
            +   G +  K +  + CG   +  +T DG ++  G   YG+L     G  SS  Q T  +    K +K I   C +     L++TE+G+VW WG+ ++  +       C    +   L +    +++V  GS     L   GQ++TWG      +G G ++ V + P            +LLD  +  KVV +A G  +  A+T  G ++ WG++
Sbjct:  541 AAFSGKQVGKHVVHIACGSTYSAAITADGELFTWGRGNYGRL-----GHGSSEDQTTPMLVTALKGLKVIDVACGSGDAQTLSVTENGQVWSWGDGDYGKLGRGGSDGCKSPKLVEKLQDL--DIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHV-RYP------------KLLDSLQGKKVVDIAVGSTHCLALTEDGEVHSWGSN 735          

HSP 6 Score: 53.9138 bits (128), Expect = 4.726e-7
Identity = 58/213 (27.23%), Postives = 95/213 (44.60%), Query Frame = 2
Query:  722 VIHGIKFDKPIRQVECGEVTTFI-LTEDGSVYGCGSNQYGQLASSDIGCCSSFIQI---TGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIF--SDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILD--DKGQLHTWGMYIVG-LGPN-KIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGN 1330
            ++HG+   K ++     E   ++ L+ +G V+  G    G+L   D         I   +G    K V  I+C      A+T DGE++ WG   +  +   S ED +    P+ +   + + KVI V+ GS     L   + GQ+ +WG    G LG      CK P ++         +L D +   +V+V CG ++S A+T  G +Y WG 
Sbjct:  485 LVHGLSSRKIVKLAAHPEGQHYLALSANGEVFSWGCGDGGRLGHGDTTYLEEPTMIAAFSGKQVGKHVVHIACGSTYSAAITADGELFTWGRGNYGRLGHGSSEDQTT---PMLVTALKGL-KVIDVACGSGDAQTLSVTENGQVWSWGDGDYGKLGRGGSDGCKSPKLV--------EKLQDLD---IVKVCCGSQFSVALTKDGQVYTWGK 682          

HSP 7 Score: 51.9878 bits (123), Expect = 1.524e-6
Identity = 52/192 (27.08%), Postives = 81/192 (42.19%), Query Frame = 2
Query:  803 GSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVK--------------QISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGP-NKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGN 1330
            G++YG G N  GQL               GGIE   VK              Q+     T+ A+T DG+++  G      +      S +   +  ++     + + V++G   C  L  +G++++WG    G LG  N+  C +P VI +         L G   +VV +A G  +SA IT+ G LY WG 
Sbjct: 3947 GTIYGWGHNHRGQL---------------GGIEGAKVKVPTPTEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIRKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIES---------LRG--VEVVDIAAGGAHSACITASGELYTWGK 4112          

HSP 8 Score: 51.9878 bits (123), Expect = 1.646e-6
Identity = 67/278 (24.10%), Postives = 111/278 (39.93%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRC--NTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIG--KVIQVSAGSTTCAILDDKGQLHTWGMYIVG----------LGPNKIVCKQ-PTVIPAPFFGGGSRLL------------DGNKSK----------------------VVRVACGVKYSAAITSYGSLYVWGN 1330
            IY  G+N  GQ G   I+    +  +    +   +P+ Q+  GE T F +T DG +Y  G    G+L        S+   +   I++  +++++        LAL+ +GEV+ WG  E   +       C     R  + E++   +V+ ++AG    A +   G+L+TWG    G          L P  +   Q   VI      G ++ L            DG+  K                      VV+V CG ++S A+T  G++Y WG 
Sbjct: 3949 IYGWGHNHRGQLGG--IEGAKVKVPTPTEALATLRPV-QLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPT-LLESIQHVFIRKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCD----RPRVIESLRGVEVVDIAAGGAHSACITASGELYTWGKGRYGRLGHGDSEDQLKPKLVDALQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGK 4218          

HSP 9 Score: 51.2174 bits (121), Expect = 3.098e-6
Identity = 48/164 (29.27%), Postives = 80/164 (48.78%), Query Frame = 2
Query:  557 VKGINFI--ACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVY--GCGSNQ-YGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEH----NAIFSDEDH 1021
            +KG+  I  ACG G     A+  ++  N Q+ ++ G+  +G+ GR   D    +   ++  ++ D  I +V CG   +  LT+DG VY  G G NQ  G      +     + ++   ++ K V  I+      LALTEDGEV  WG+N+     + +FS++  
Sbjct:  599 LKGLKVIDVACGSGD----AQTLSVTENGQV-WSWGDGDYGKLGRGGSDG--CKSPKLVEKLQ-DLDIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHV----RYPKLLDSLQGKKVVDIAVGSTHCLALTEDGEVHSWGSNDKLQHFDTLFSNKKQ 750          

HSP 10 Score: 49.6766 bits (117), Expect = 8.485e-6
Identity = 61/269 (22.68%), Postives = 106/269 (39.41%), Query Frame = 2
Query:  644 IYTLG---NNKFGQCGRQIIDN----EIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCN--TVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND----IVSGAYNQTFPVRMPATFHAKTL 1402
            +Y+ G   + K G   R   D     E  RG  V+           +  G   +  +T  G +Y  G  +YG+L   D        ++   ++   V  ++C       L LT+D  VW WG+ ++  +       C   P++++    +G V++V  GS     L   G ++TWG    + +G G +  V ++P  +           L G K  V+ +A G  +    T  G +Y WG++    +  G  N     R+ A    K +
Sbjct: 4055 VYSWGEAEDGKLGHGNRSPCDRPRVIESLRGVEVV----------DIAAGGAHSACITASGELYTWGKGRYGRLGHGD-SEDQLKPKLVDALQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKV-PMKIDSLTGLG-VVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHV-RRPRQVQG---------LQGKK--VIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKI 4298          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Cavefish
Match: NEK9 (NIMA related kinase 9 [Source:NCBI gene;Acc:103037873])

HSP 1 Score: 72.4034 bits (176), Expect = 5.884e-13
Identity = 75/288 (26.04%), Postives = 123/288 (42.71%), Query Frame = 2
Query:  548 PEKV-----KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFD----KPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLA--SSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI------------FSDEDHSCTFKPIRLNLPETIG--KVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVV-RVACGVKYSAAITSYGSLYVWGN 1330
            P KV     K I  +ACG       A+  A  T+   +Y  G++ +G  G   ++NE+  G  V+  +  +    +P+RQV CG+    +LT  G +Y  G  ++G+L     D       +++  G     +  + C  +    LTE G+V   GNN+ N +            F +      +    L L + +   K+  ++ G T  A +D++G+L T+G    G LG       Q   I    FGG          KVV +V+CG  ++ A T    ++ WGN
Sbjct:  404 PRKVERLQGKAIRQVACG-------ADFTACVTDEDQMYMFGSDYYGCIG---VENEM--GMEVLEPVLLEFFEERPVRQVSCGDNHVVVLTHSGDIYSWGCGEHGRLGLDCEDDFASPMLVEVPKGAS---IDSVYCGSDGTFFLTESGKVLACGNNDLNKLGLNQGITGIKNHFREGSQEIPYTTT-LTLVKQLARFKIQIIAPGKTHTAAIDERGRLMTFGCNKYGQLGVKDFKRHQGVQILLGPFGG----------KVVSKVSCGDGFTIAATEDNQIFAWGN 665          

HSP 2 Score: 53.9138 bits (128), Expect = 3.847e-7
Identity = 66/253 (26.09%), Postives = 109/253 (43.08%), Query Frame = 2
Query:  620 AIDTNNQIIYTL-----GNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQL-ASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSD-EDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKS----------KVVRVACGVKYSAAITSYGSLYVWG 1327
            A+ T  + +YT      G    GQ G    D   YR    +  ++  K IRQV CG   T  +T++  +Y  GS+ YG +   +++G       +    E + V+Q+SC  N V+ LT  G+++ WG  EH  +  D ED   +  P+ + +P+    +  V  GS     L + G++   G   +    NK+   Q        F  GS+ +    +          K+  +A G  ++AAI   G L  +G
Sbjct:  369 AVVTVEKELYTWASVQGGAKMVGQLGHG--DQASYRQPRKVERLQ-GKAIRQVACGADFTACVTDEDQMYMFGSDYYGCIGVENEMGMEVLEPVLLEFFEERPVRQVSCGDNHVVVLTHSGDIYSWGCGEHGRLGLDCEDDFAS--PMLVEVPKG-ASIDSVYCGSDGTFFLTESGKVLACGNNDL----NKLGLNQGITGIKNHFREGSQEIPYTTTLTLVKQLARFKIQIIAPGKTHTAAIDERGRLMTFG 611          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Sea Lamprey
Match: rcc1l (RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370])

HSP 1 Score: 203.756 bits (517), Expect = 2.706e-60
Identity = 128/413 (30.99%), Postives = 215/413 (52.06%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETI-----GKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            V+G   TGALGI   ++   +   H  R++   +  + L    KI    AA GYGFTL + K+     ++G G+N DSQ+G  +  S     +  ++EPS +PLP    +   +  +ACG  HS+++ +      N   ++++GNN +GQCGR II++E+Y+GS +IH I+  +  + +V CG+  +   TE G +Y CG    GQ        CS+  ++ G +  + V Q++   +  LA++E GE++GWGN+E+  + +  D       +++N+P+ I     GKV   +AG T C IL+++G++  WG  I+G GP     + P  IP   FG   R       +V  + CG+ + AA+ + G L+ WG ++     +    +Q FP R+        +  G DHS+ +
Sbjct:   31 VWGFTFTGALGIPNFVSP--VSKRHKPRKIQ--FTPHRLETDDKII--SAACGYGFTLLASKTKDLTKLWGAGLNIDSQIGFHRSRSDRTKSYDYILEPSPVPLPLVEHQQTRVLQVACGRAHSLVLTD------NEGAVFSMGNNAYGQCGRVIIEDEVYKGSRLIHKIEGIEGKVVEVVCGQDHSLFRTEKGELYACGWGADGQTGLGSYEMCSTPKRLGGDLSGEPVAQVASYGDFCLAVSESGELFGWGNSEYRQLAAITD------AVQINVPKHIPLKNVGKVKMAAAGGTICGILNEEGEVFVWGYGILGKGPRLSETETPEQIPPSLFG---RTEFDPDIRVKTLRCGLHHFAAVNTRGELFSWGKNMRGCLGIGRPDDQYFPWRVTVAGEVVDVACGVDHSVAL 422          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001275.1 (pep scaffold:Pmarinus_7.0:GL476529:184068:212443:-1 gene:ENSPMAG00000001140.1 transcript:ENSPMAT00000001275.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 1.992e-12
Identity = 82/344 (23.84%), Postives = 142/344 (41.28%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGE-VWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM-YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVS--GAYNQTFPVRMPAT------FHAKTLYMGADHSIIVGAPP 1444
            V  CG     +LGL   ++      +  EP        VK I+      GH++ V       T    +++ G+  +G+ G      + Y    +I G    K +  V  G   +  +TEDG +Y  G   +G+L   D     +   +   I N  V Q++C  +  +A+++DG  VW +G  + N      D +  +KP  +   + +  + +V AGS +   L   GQL+ WG    +G G ++    +P +I            D   +++V ++CG  +  A+T    +Y WGN+ +   G  + T PV  P           + +  G  HS+   A P
Sbjct:  431 VRACGKGSYGRLGLGDSNNQSTLKKLTFEPQR-----AVKKISSSRGSDGHTLAV-------TMEGEVFSWGDGDYGKLGHGNSSTQKY--PKLIQGPLQGKVVVCVSAGYRHSASVTEDGELYTWGEGDFGRLGHGDSNS-RNIPTLVKDISN--VGQVACGSSHTIAVSQDGRIVWSFGGGD-NGKLGHGDTNRVYKPKVIEALQGM-FIRKVCAGSQSSLALTSTGQLYAWGCGACLGCGSSEATALRPKLIE-----------DLACTRIVDISCGDSHCLALTHDNEVYAWGNNSMGQCGQGHSTSPVTKPKKVMGMDGISVQQISAGTSHSLAWTALP 744          

HSP 2 Score: 64.6994 bits (156), Expect = 3.758e-11
Identity = 70/236 (29.66%), Postives = 104/236 (44.07%), Query Frame = 2
Query:  755 RQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNT--VLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQ-VSAGSTTCAILDDKGQLHTWGMYIVG-LG---------PN---------KIVCKQPTVIPAP-------FFGGGS--RLLDGNKSKV-------------VRVAC-GVKYSAAITSYGSLYVWG 1327
            + +E G+  TF++  DGSV  CG   YG+L   D    S+  ++T   +  V K  S R +    LA+T +GEV+ WG+ ++  +     +S T K  +L      GKV+  VSAG    A + + G+L+TWG    G LG         P          ++ C     I           FGGG   +L  G+ ++V             +R  C G + S A+TS G LY WG
Sbjct:  413 QTIEAGQYCTFVIAVDGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPQRAVKKISSSRGSDGHTLAVTMEGEVFSWGDGDYGKL--GHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSASVTEDGELYTWGEGDFGRLGHGDSNSRNIPTLVKDISNVGQVACGSSHTIAVSQDGRIVWSFGGGDNGKLGHGDTNRVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQLYAWG 646          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Sea Lamprey
Match: rcc2 (regulator of chromosome condensation 2 [Source:NCBI gene;Acc:406455])

HSP 1 Score: 52.7582 bits (125), Expect = 1.260e-7
Identity = 64/273 (23.44%), Postives = 103/273 (37.73%), Query Frame = 2
Query:  578 ACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIG-----------CC-------SSFIQITGG-----IENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            ACG  H++ +       T+   +Y  G N+ GQ G   + N+     S    +   + + +V CG   +  +  DG+++  G  +YGQL  +  G            C       + FI+ T       +   VV+ ++C  N  +AL   G V+ WG   +  +   E        +   L      V  V AG +    ++  G L+ WG        +    + PT+ P           D   + V  +ACG K S  ITS  S   WG
Sbjct:  112 ACGRSHTLCL-------TDTGTVYAFGENRLGQLG---LGNQTDAVPSPTQIVYSGRQVVKVACGAEFSVFIDCDGNLFSFGCPEYGQLGHNTDGRYIVRAQRIEFVCELAPRRLARFIEKTRDGQVLTVRGVVVRDVACGANHTIALDTRGRVFTWGFGGYGRLGHAEQKDELLPRLVKLLDRPAPAVNSVRAGYSCTFAINVVGTLYFWG--------STNTSRDPTMYPKAVH-------DLCGTHVRSLACG-KSSILITSDESTMSWG 358          

HSP 2 Score: 48.1358 bits (113), Expect = 2.937e-6
Identity = 50/211 (23.70%), Postives = 84/211 (39.81%), Query Frame = 2
Query:  767 CGEVTTFILTEDGSVYGCGSNQYGQLA-SSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNL-----PETIGKVIQ-----------------VSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGN 1330
            CG   T  LT+ G+VY  G N+ GQL   +      S  QI      + V +++C     + +  DG ++ +G  E+  +  + D     +  R+       P  + + I+                 V+ G+     LD +G++ TWG    G G      ++  ++P        +LLD     V  V  G   + AI   G+LY WG+
Sbjct:  113 CGRSHTLCLTDTGTVYAFGENRLGQLGLGNQTDAVPSPTQIV--YSGRQVVKVACGAEFSVFIDCDGNLFSFGCPEYGQLGHNTDGRYIVRAQRIEFVCELAPRRLARFIEKTRDGQVLTVRGVVVRDVACGANHTIALDTRGRVFTWGFG--GYGRLGHAEQKDELLPRLV-----KLLDRPAPAVNSVRAGYSCTFAINVVGTLYFWGS 314          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 52.7582 bits (125), Expect = 1.389e-7
Identity = 48/165 (29.09%), Postives = 74/165 (44.85%), Query Frame = 2
Query:  656 GNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSF-IQITGGIENKV-----VKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQL 1132
            G    GQ G +  D   YR    +  +     +RQV CG+  T  LTE G V+  GS+ YG +     GC     +++   +  +      V QISC    V+ALT  G V+ WG  E+  +  + D +  F P R+ L     K+ +V  G+     L  +G++
Sbjct:  380 GTKMVGQLGHK--DKASYRQPKRVDKL-LGLAVRQVACGDEFTVCLTEQGEVFSFGSDYYGCM-----GCNGELGVEVLEPMPVQFFNINPVTQISCGDCHVMALTRSGAVYAWGCGEYGRLGLETD-ATEFYPKRVPLSNRW-KITEVCCGTDGTFFLTAQGKV 534          

HSP 2 Score: 47.3654 bits (111), Expect = 7.500e-6
Identity = 71/312 (22.76%), Postives = 131/312 (41.99%), Query Frame = 2
Query:  371 ISIRKAATGYGFTLFSGKS----SIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSS---------FIQITGGIENKVVKQISC-RCNTV-------LALTEDGEVWGWGNNEHNAIFSDEDHSCTFKP---IRLNLPETIGKVI-QVSAGS-TTCAILDDKGQLHTWGMY---IVGLGPNKIVCKQPTVIPAPFFG 1219
            +++R+ A G  FT+   +     S G   YGC +  + +LG++           ++EP  +     +  +  I+CG  H + +       T +  +Y  G  ++G+ G +    E Y     +        I +V CG   TF LT  G V  CG+N++ +L    +  C+S         F ++   +   +VKQ+S  +  ++         +   G +  +G+N+H  + + +     FK    I L+    +GK+I  VS G   T A  +    ++ WG      +G+ P++     P  +P P FG
Sbjct:  407 LAVRQVACGDEFTVCLTEQGEVFSFGSDYYGC-MGCNGELGVE-----------VLEPMPVQFF-NINPVTQISCGDCHVMAL-------TRSGAVYAWGCGEYGRLGLETDATEFYPKRVPLSN---RWKITEVCCGTDGTFFLTAQGKVLACGNNEFNKLG---LNQCTSGLRNRETSVFHEVIMKLMPTLVKQLSIYKIRSISGGKTHSAVIDVCGRLLTFGHNKHGQLGTGD-----FKKHLGIVLHKGPLVGKLITMVSCGDGFTIAATEADNHIYAWGNTDNGRLGVMPSEKPGNSPLALPRPIFG 687          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Sea Lamprey
Match: rcc1 (regulator of chromosome condensation 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2216])

HSP 1 Score: 48.9062 bits (115), Expect = 1.884e-6
Identity = 69/294 (23.47%), Postives = 106/294 (36.05%), Query Frame = 2
Query:  506 NGFPILMEPS-EIPLPEKVK---GINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGR--QIIDNEIYRGSSVIHGIKFDKPIR-----------QVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMY---IVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            NG   L+EP  + PLP K+     I  +A G  H V+++E       ++ IYTLG  + GQ GR  ++  N   R   +   +     ++            V CG   TF L+ DGS+YG G + Y QL ++                    K  S     +L   E+ E W                                  +++  G      LD  G++++ G      +GLG        PT++P P             S +  +ACG   S A+T  G  + WG
Sbjct:  150 NGIIGLLEPMMKCPLPTKLTLDTRIVKVASGNDHLVLLSE-------SRQIYTLGCGEQGQLGRVAEMFANRGGRRGLLRLLVPEQVRVKARRGHSHVEFLDVFCGSYFTFALSTDGSLYGFGLSNYHQLGTA--------------------KPDSAFVPNLLTSFENSETW----------------------------------LELCGGQHHSLCLDSGGKVYSLGRADYGRLGLGKGACDVALPTLVPTP-------------SHINSIACGASVSYAVTKDGRAFSWG 369          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Yeast
Match: SRM1 (Nucleotide exchange factor for Gsp1p; localizes to the nucleus, required for nucleocytoplasmic trafficking of macromolecules; suppressor of the pheromone response pathway; potentially phosphorylated by Cdc28p; human homolog of the RAN GEF, RCC1, can complement a temperature sensitive point mutant [Source:SGD;Acc:S000003065])

HSP 1 Score: 55.4546 bits (132), Expect = 1.097e-8
Identity = 73/283 (25.80%), Postives = 114/283 (40.28%), Query Frame = 2
Query:  548 PEKVKGINFIACGLGHSVI-VAEIDAIDT---NNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKP------IRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHN--AIFSD-EDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPN-------KIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            P K+   +F     GH V+ +A  D +     +N  +Y  G  +   C   I+    Y+    I    +  P      I Q+  G+     L E+G V+  G+ Q  QL    +               + VK I+   N   ALT+D ++  WG N+     +  D ED +   KP RL LP+ +  +  ++AG     IL   G L++ G   M+ VG+  +       K V  +   +P P     ++L   N  K   VA G  +S A+   G  Y WG
Sbjct:  150 PAKIPRESFPPLAEGHKVVQLAATDNMSCALFSNGEVYAWGTFR---CNEGILG--FYQDKIKIQKTPWKVPTFSKYNIVQLAPGKDHILFLDEEGMVFAWGNGQQNQLGRKVMERFRLKTLDPRPFGLRHVKYIASGENHCFALTKDNKLVSWGLNQFGQCGVSEDVEDGALVTKPKRLALPDNV-VIRSIAAGEHHSLILSQDGDLYSCGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLP-----TKL--NNVPKFKSVAAGSHHSVAVAQNGIAYSWG 419          

HSP 2 Score: 51.2174 bits (121), Expect = 2.092e-7
Identity = 52/233 (22.32%), Postives = 98/233 (42.06%), Query Frame = 2
Query:  362 FQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEI----PLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKP----IRQVECGEVTTFILTEDGSVYGCG----------SNQYGQLASSDIGCCSSFIQITGGIEN-KVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI 1003
            F K +I + A G    LF  +  +   V+  G    +QLG +           +ME   +    P P  ++ + +IA G  H        A+  +N+++ + G N+FGQCG   +  ++  G+ V    +   P    IR +  GE  + IL++DG +Y CG           +   +    D+   +  + +   + N    K ++   +  +A+ ++G  + WG  E  A+
Sbjct:  218 FSKYNIVQLAPGKDHILFLDEEGM---VFAWGNGQQNQLGRK-----------VMERFRLKTLDPRPFGLRHVKYIASGENHCF------ALTKDNKLV-SWGLNQFGQCG---VSEDVEDGALVTKPKRLALPDNVVIRSIAAGEHHSLILSQDGDLYSCGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLPTKLNNVPKFKSVAAGSHHSVAVAQNGIAYSWGFGETYAV 426          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Nematostella
Match: EDO46355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQF3])

HSP 1 Score: 84.7297 bits (208), Expect = 1.002e-17
Identity = 71/272 (26.10%), Postives = 116/272 (42.65%), Query Frame = 2
Query:  530 PSEIPLP---EKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDK--PIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI--FSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVW 1324
            P  I LP   EK + I  IACG  H++++       T+++ ++ +G N  GQCG   + +++    S  H    D    I +V CG   + +L+ DG V+ CG    GQ             Q+ G +    +K IS   +  LA++EDG+V+ WGN+E+  I   SDE                                    G +++WG  ++G G +    K+P  I A         +D    ++  + CG+ ++A  T  G L+VW
Sbjct:   93 PRSIDLPVFCEKTR-ITQIACGRSHALVL-------TDSEGVFVIGGNSQGQCGFGGVTDKV---KSFQHLPLPDATGAIVKVVCGMDHSLLLSCDGKVFSCGWGADGQTGLGFFDDAVKVSQLEGELSGVKIKDISSAVDCCLAVSEDGDVFSWGNSEYAQIGLMSDEKQ---------------------------------DGSMYSWGYGVLGHGSDVTFSKEPIRIQA---------VDDVSERITELYCGLDHAAFTTESGKLFVW 311          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Nematostella
Match: EDO44704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV05])

HSP 1 Score: 83.1889 bits (204), Expect = 2.374e-17
Identity = 83/295 (28.14%), Postives = 132/295 (44.75%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGN------DIVSGAYNQTFPVRMP--ATFHAKTLYMGADHSIIV 1432
            ++CG  HS +V       T N  +YT G N +GQ G    + + Y   SV+  +K +K +  V CG   T   TE G +Y  G    GQL   D    S   +I  G++ +  K ++C  +   A+TE+GE++ WG+         ED   T  P RL+L    GKV  VS G    A++ + G L+  G    G LG +       + +         + +   + +VV  ACG +++A +T  GS+Y +G        + S      FP R+P      A+T+  G   + ++
Sbjct:   40 LSCGDEHSAVV-------TANGKLYTFGCNDWGQLGHG--NTKSYTKPSVVKKLKPEK-VYMVACGRNHTIAATESGHLYSFGCGGDGQLGHGDAE-DSHVPKIIEGLDVQKYKHLACGSDFSAAITENGELYTWGSCGEGQNGLGED---TEIPTRLHLH---GKVRMVSCGYYHMAVVTEDGSLYMCGEKEGGKLGLDHEQLDNTSQL---------QKIKSIEDQVVVAACGAEFTAVVTKNGSVYTFGQGNQGQLGLGSSMMETEFPERIPLFEKVKARTVSCGESFTAVI 308          

HSP 2 Score: 56.6102 bits (135), Expect = 9.582e-9
Identity = 85/346 (24.57%), Postives = 144/346 (41.62%), Query Frame = 2
Query:  131 FNQIRSFGVKRATKDYIRNTEIY------DYSTNPPKNSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGL-QPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLA-SSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWG 1144
            F + R F    A K +IR+  +       ++S     N  L  FG    G LG     N +      + +++ P          +K+ +   A G   T+ + +S    H+Y  G   D QLG      S++   P ++E  ++   +K K    +ACG       ++  A  T N  +YT G+   GQ       N +   + +   +     +R V CG     ++TEDGS+Y CG  + G+L    +    +S +Q    IE++VV   +C       +T++G V+ +G      +        T  P R+ L E + K   VS G +  A++   G L+T+G
Sbjct:   17 FGKTR-FADNLANKFWIRDDAVVNLSCGDEHSAVVTANGKLYTFGCNDWGQLGHG---NTKSYTKPSVVKKLKP----------EKVYM--VACGRNHTIAATESG---HLYSFGCGGDGQLGHGDAEDSHV---PKIIEGLDV---QKYK---HLACG-------SDFSAAITENGELYTWGSCGEGQ-------NGLGEDTEIPTRLHLHGKVRMVSCGYYHMAVVTEDGSLYMCGEKEGGKLGLDHEQLDNTSQLQKIKSIEDQVV-VAACGAEFTAVVTKNGSVYTFGQGNQGQLGLGSSMMETEFPERIPLFEKV-KARTVSCGESFTAVITKHGNLYTFG 318          

HSP 3 Score: 55.8398 bits (133), Expect = 1.722e-8
Identity = 54/199 (27.14%), Postives = 91/199 (45.73%), Query Frame = 2
Query:  743 DKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQ--ITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRL-LDGNKSKVVRVACGVKYSAAITSYGSLYVWGN 1330
            D  +  + CG+  + ++T +G +Y  G N +GQL     G   S+ +  +   ++ + V  ++C  N  +A TE G ++ +G      +   +        I   L   + K   ++ GS   A + + G+L+TWG    G G N +   + T IP       +RL L G   KV  V+CG  + A +T  GSLY+ G 
Sbjct:   34 DDAVVNLSCGDEHSAVVTANGKLYTFGCNDWGQLGH---GNTKSYTKPSVVKKLKPEKVYMVACGRNHTIAATESGHLYSFGCGGDGQLGHGDAEDSHVPKIIEGLD--VQKYKHLACGSDFSAAITENGELYTWGS--CGEGQNGL--GEDTEIP-------TRLHLHG---KVRMVSCGYYHMAVVTEDGSLYMCGE 213          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Nematostella
Match: EDO37196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGI6])

HSP 1 Score: 77.411 bits (189), Expect = 8.942e-15
Identity = 88/324 (27.16%), Postives = 142/324 (43.83%), Query Frame = 2
Query:  353 LVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSS-NINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS 1303
            L + Q + +RK A   G       S+ G  VY  G   D +LG   H + N    P ++E        + KG+  I+CG  HS  +       T N  +YT G  ++G+ G    D+E      V+  ++ ++ I  V CG  +  T  LT+D  V+  G   YG+L       C   +++   I   V K + C     +ALT  G V+ WG  ++  +    +DH    +P R+   +   KVI ++ GS  C    D G+++TWG      +G G    + + P ++ A         L G   K+ RVACG  ++ A ++
Sbjct: 3433 LESLQHVVVRKVAVHSGGKHAMALSADG-DVYSWGEGDDGKLG---HGNRNSCDRPRVIEAL------RGKGVIDISCGGSHSACI-------TQNHELYTWGKGRYGRLGHG--DSEDQLLPKVVEALRGNRVI-DVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSDGCKIPMKVESLIGLGVSK-VECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDDH--VRRPKRVAALQG-KKVITIATGSLHCVASTDTGEVYTWGDNDEGQLGDGTTNAIAR-PRLVTA---------LQGK--KISRVACGSAHTIAWST 3720          

HSP 2 Score: 71.2478 bits (173), Expect = 7.215e-13
Identity = 78/256 (30.47%), Postives = 113/256 (44.14%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI-FSDEDHSCTFKPIRLNLPETI-GK-VIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSK-VVRVACGVKYSAAITSYGSLYV 1321
            I+CG  HS  V       T+   +YT G   +G+ G    ++++     ++ G++    I  V CG  +  T    +DG+V+  G   YG+L       C +   I   ++   V ++ C     LALT DG VW WG  E   +    EDH    K     L E + GK V+ VS GS  C  L D G+++ WG    G LG   I C+   + P P       L+ G  SK +V +ACG   S A +  G   V
Sbjct:   74 ISCGSTHSAAV-------TSEGELYTWGRGNYGRLGHGSSEDQLV--PVLVSGLR-GHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDGCKNPKSIER-LQGLGVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHVRHPK-----LVEALDGKHVVDVSVGSIHCLALTDAGEVYCWGRNDQGQLG--DIDCQ---IRPEP------TLVSGLASKGIVGIACGPAQSFAWSCAGQWSV 302          

HSP 3 Score: 67.781 bits (164), Expect = 7.200e-12
Identity = 81/331 (24.47%), Postives = 135/331 (40.79%), Query Frame = 2
Query:  443 VYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLG---NNKFGQCGRQIIDN----EIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISC--RCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGK-----VIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNK-SKVVRVACGVKYSAAITSYGSLYVWG-NDIVSGAYNQTFPVRMP 1378
            V+ CG + + +LGL P S+N+   P  +E     +  KV     +  G  H++ +       T    +++ G   + K G   R   D+    + ++ S V          R + CG   +  +   G +Y  G  +YG+L   D        ++     ++V+  I+C  R    LALT+DG VW WG+ +   +       C+       +P  + K     V +V+ G+     L   G + TWG    Y +G G N    ++P ++            DG +  K+V VA G  +  A+T  G ++ WG ND      N T   R P
Sbjct: 2475 VFACGESTNGRLGLGPLSANVT-VPRQIENLSSFMVRKVS----VHSGGRHAMAL-------TIEGKLFSWGEGEDGKLGHGNRMNCDHPKLIDTFKSSCV----------RDMSCGSSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLKPKKVQSFTSHRVI-DIACGSRDAQTLALTDDGTVWSWGDGDFGKLGRGGSEGCS-------VPNPVEKLQGQGVCKVACGAQFSLALSTSGLVWTWGKGDYYRLGHG-NDTHVRKPQIV------------DGLRGKKIVDVAVGALHCLAVTDSGQVFAWGDNDHGQQGNNTTTVNRRP 2762          

HSP 4 Score: 66.6254 bits (161), Expect = 1.953e-11
Identity = 62/249 (24.90%), Postives = 108/249 (43.37%), Query Frame = 2
Query:  575 IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECG--EVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIG-----KVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKI--VCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAA 1294
            ++CG  HS       AI ++ ++ YT G  ++G+ G    DN  +     +      + I  + CG  +  T  LT+DG+V+  G   +G+L       CS    +   ++ + V +++C     LAL+  G VW WG  ++  +    D         +  P+ +      K++ V+ G+  C  + D GQ+  WG    G   N    V ++P ++           L+G K  + RVACG  +S A
Sbjct: 2566 MSCGSSHSA------AILSSGEL-YTWGLGEYGRLGHG--DNYTHLKPKKVQSFTSHRVI-DIACGSRDAQTLALTDDGTVWSWGDGDFGKLGRGGSEGCSVPNPVEK-LQGQGVCKVACGAQFSLALSTSGLVWTWGKGDYYRLGHGND-------THVRKPQIVDGLRGKKIVDVAVGALHCLAVTDSGQVFAWGDNDHGQQGNNTTTVNRRPQLVNG---------LEGQK--ITRVACGSSHSIA 2785          

HSP 5 Score: 60.4622 bits (145), Expect = 1.430e-9
Identity = 60/239 (25.10%), Postives = 101/239 (42.26%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQ----ITGGIENKVVKQISCRCNT--VLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            +Y+ G+   G+ G    D       +++ G+   + IR + CG   +  +T +G +Y  G   YG+L     G  SS  Q    +  G+    +  ++C       LA  +DG VW WG+ ++  +       C   P  +   + +G V +V  G+     L   G + TWG    + +G G    V + P ++ A         LDG    VV V+ G  +  A+T  G +Y WG +
Sbjct:   38 VYSWGSGDGGKLGHG--DTSPREEPTLVTGLAGKQVIR-ISCGSTHSAAVTSEGELYTWGRGNYGRL-----GHGSSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDGCK-NPKSIERLQGLG-VCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHV-RHPKLVEA---------LDGK--HVVDVSVGSIHCLALTDAGEVYCWGRN 254          

HSP 6 Score: 59.3066 bits (142), Expect = 3.257e-9
Identity = 61/243 (25.10%), Postives = 98/243 (40.33%), Query Frame = 2
Query:  644 IYTLG---NNKFGQCGRQIIDN----EIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCN--TVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIG-KVIQVSAGSTTCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            +Y+ G   + K G   R   D     E  RG  VI           + CG   +  +T++  +Y  G  +YG+L   D        ++   +    V  ++C       L LT+D  VW WG+ ++  +       C    I + +   IG  V +V  GS     L   G ++TWG    Y +G G +  V ++P  + A         L G K  V+ +A G  +  A T  G +Y WG++
Sbjct: 3462 VYSWGEGDDGKLGHGNRNSCDRPRVIEALRGKGVI----------DISCGGSHSACITQNHELYTWGKGRYGRLGHGD-SEDQLLPKVVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSDGCK---IPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDDHV-RRPKRVAA---------LQGKK--VITIATGSLHCVASTDTGEVYTWGDN 3678          

HSP 7 Score: 59.3066 bits (142), Expect = 3.519e-9
Identity = 49/203 (24.14%), Postives = 93/203 (45.81%), Query Frame = 2
Query:  752 IRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENK---VVKQISCRCNT--VLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGM---YIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVK--YSAAITSYGSLYVWGN 1330
            ++Q+  G  T F ++ DG V+ CG +  G+L    +G  S+ + +   IEN    +V+++S        +ALT +G+++ WG  E   +      +C    +      +   V  +S GS+  A +   G+L+TWG+     +G G N    K              ++      +V+ +ACG +   + A+T  G+++ WG+
Sbjct: 2456 VQQIAGGSKTLFAVSHDGKVFACGESTNGRLG---LGPLSANVTVPRQIENLSSFMVRKVSVHSGGRHAMALTIEGKLFSWGEGEDGKLGHGNRMNCDHPKLIDTFKSSC--VRDMSCGSSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLKP------------KKVQSFTSHRVIDIACGSRDAQTLALTDDGTVWSWGD 2641          

HSP 8 Score: 55.8398 bits (133), Expect = 4.005e-8
Identity = 70/277 (25.27%), Postives = 116/277 (41.88%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRC--NTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETI-GK-VIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPN--------KIV--CKQPTVIPAPFFGGGSRLL------------DGNKSK----------------------VVRVACGVKYSAAITSYGSLYVWG 1327
            IY  G+N  GQ G   ++    +    I  +   +P+ Q+  GE T F +T +G VY  G    G+L        +S I++   +++ VV++++        +AL+ DG+V+ WG  +   +     +SC     R  + E + GK VI +S G +  A +    +L+TWG    G LG          K+V   +   VI      G ++ L            DG+  K                      V +V CG ++S A+T  G++Y WG
Sbjct: 3356 IYGWGHNHRGQLGS--LEGAKVKLPQTIEALASIRPV-QIVGGEQTLFAVTAEGKVYATGYGHGGRLGLGGTDTVTS-IKMLESLQHVVVRKVAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRNSCD----RPRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHGDSEDQLLPKVVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSDGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWG 3624          

HSP 9 Score: 54.6842 bits (130), Expect = 8.876e-8
Identity = 57/187 (30.48%), Postives = 83/187 (44.39%), Query Frame = 2
Query:  791 LTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIF--SDEDHSCTFKPIRLNLPETIGKVIQVSAGST---TCAILDDKGQLHTWG---MYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            LT +G VY  GS   G+L   D         +TG +  K V +ISC      A+T +GE++ WG   +  +   S ED      P+ ++       +I V+ GS    T A  DD G + +WG      +G G +   CK P  I         RL       V +V CG ++S A+T  GS++ WG
Sbjct:   32 LTREGEVYSWGSGDGGKLGHGDTSPREEPTLVTG-LAGKQVIRISCGSTHSAAVTSEGELYTWGRGNYGRLGHGSSEDQ---LVPVLVSGLRG-HHIIDVACGSGDAHTLAAADD-GTVWSWGDGDYGKLGRGGSD-GCKNPKSI--------ERL---QGLGVCKVYCGAQFSLALTRDGSVWTWG 200          

HSP 10 Score: 51.2174 bits (121), Expect = 1.115e-6
Identity = 49/177 (27.68%), Postives = 76/177 (42.94%), Query Frame = 2
Query:  803 GSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LG-PNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWG 1327
            G++YG G N  GQL S + G      Q    + +    QI     T+ A+T +G+V+  G      +      + T   +  +L   + + + V +G      L   G +++WG    G LG  N+  C +P VI A   G G          V+ ++CG  +SA IT    LY WG
Sbjct: 3354 GTIYGWGHNHRGQLGSLE-GAKVKLPQTIEALASIRPVQIVGGEQTLFAVTAEGKVYATGYGHGGRLGLGGTDTVTSIKMLESLQHVVVRKVAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRNSCDRPRVIEA-LRGKG----------VIDISCGGSHSACITQNHELYTWG 3518          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Nematostella
Match: EDO49099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI68])

HSP 1 Score: 73.559 bits (179), Expect = 8.303e-14
Identity = 82/299 (27.42%), Postives = 128/299 (42.81%), Query Frame = 2
Query:  587 LGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISC---RCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVS--GA-----------YNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            LG + +  + DA D     IYT G    G  G      E +    V+  +   K IR+V CG   T  L++DG V+  GS   G+L    +    + I+I G +E+  + Q++C       V A ++ G ++ +G N++  +   ED   T   I+     +  K+ +V+ GS   A L + G L  WG    G LG         T +P+    G     D     V+ VACG ++SA IT  G ++  G++     GA           YN    VR+P  F    +  G  H+ +V
Sbjct:  195 LGQATVHVKEDACD-----IYTWGEGTNGMLGHGEDTQEAH--PHVVEAL-LGKDIRKVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDRFTPIRICG-LESLNLTQVACNEFHSAAVCACSKQGALFSFGENDYGQLGIPEDKLLT-SYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQLGNGNYT---STSLPSLLEAGN----DLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDFRCVHVACGDSHTAVV 476          

HSP 2 Score: 60.8474 bits (146), Expect = 7.553e-10
Identity = 58/262 (22.14%), Postives = 114/262 (43.51%), Query Frame = 2
Query:  560 KGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFIL---TEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETI--GKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGN 1330
            K I  +ACG  H++ +++       +  +++ G+   G+ G+  + +        I G++    + QV C E  +  +   ++ G+++  G N YGQL   +    +S+IQ    +    + +++C      AL E G +W WG NE   +  + +++ T  P  L     +    V++V+ G    A +  KG++   G    G     +   Q   +    +    R+      + V VACG  ++A +T  G ++ WG 
Sbjct:  240 KDIRKVACGATHTLALSK-------DGEVFSWGSGYGGRLGQGHLRDRFT--PIRICGLE-SLNLTQVACNEFHSAAVCACSKQGALFSFGENDYGQLGIPEDKLLTSYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQL-GNGNYTSTSLPSLLEAGNDLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVT---YNVAVRVRVPTDFRCVHVACGDSHTAVVTDGGEIFTWGR 487          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Nematostella
Match: EDO34592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX9])

HSP 1 Score: 73.559 bits (179), Expect = 9.100e-14
Identity = 60/236 (25.42%), Postives = 101/236 (42.80%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIG-----KVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            ++  G    GQ G    + E      ++  ++F   +R+V CG   T  L +DG+VY CGSN++GQL           +     IE   + +++C     +A+++ G V+ WG+N +  I          K     +P+ +       V+Q++ G      L   G L  WG    G LG  K         PAP       +L  N    + ++ G  +S A++S G+L+ WG +
Sbjct:    1 MFCWGKCSEGQLGVGETEQEFISTPRLLENLEFSSNVREVSCGWNHTAFLCKDGTVYTCGSNEFGQLGQEKSHTNPESVH---AIETFTITKVTCGKAHTVAVSDQGLVFAWGDNSYGQI----GLGSKVKEKVQTIPKMLKGLAKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKTHSSMSE--PAP-------VLSLNGVPFMLISAGGAHSFALSSSGALFGWGKN 220          

HSP 2 Score: 62.7734 bits (151), Expect = 2.572e-10
Identity = 79/327 (24.16%), Postives = 128/327 (39.14%), Query Frame = 2
Query:  374 SIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINF-----IACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGR-QIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGK-VIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAIT-SYGSLYVWG 1327
            ++R+ + G+  T F  K      VY CG N   QLG +   +N               PE V  I       + CG  H+V V       ++  +++  G+N +GQ G    +  ++     ++ G+     + Q+ CG   +  LT  G ++  G N  GQL         S       +       IS       AL+  G ++GWG NE+  +     H  T +P+   L     + V  VS G    A+L   G + T+G    G LG N          P        ++ +   S V ++ACG  ++ A+  S G +Y +G
Sbjct:   36 NVREVSCGWNHTAFLCKDGT---VYTCGSNEFGQLGQEKSHTN---------------PESVHAIETFTITKVTCGKAHTVAV-------SDQGLVFAWGDNSYGQIGLGSKVKEKVQTIPKMLKGLA-KMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKTHSSMSEPAPVLSLNGVPFMLISAGGAHSFALSSSGALFGWGKNEYGQLGV---HDTTDRPLPTLLKSLRSQGVCYVSCGEKHTAVLTSDGGVFTFGCGTSGQLGHNS---NHHEYTP-------RKVFELMGSVVTQIACGRAHTLALVPSSGRVYTFG 323          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Medaka
Match: rcc1l (RCC1 like [Source:NCBI gene;Acc:101155627])

HSP 1 Score: 209.149 bits (531), Expect = 2.256e-61
Identity = 136/410 (33.17%), Postives = 212/410 (51.71%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLI--NNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQ-PHSSNINGFPILMEPSEIPLPEK---VKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            V+G + TGALGI   +  ++ R K        Y L            +I  AA GYGFTL +  +     V+G G+N DSQLG Q    S  + +  ++EPS + LP K      +  +ACG  HS+I+       T+ + +++LGNN FGQCGR+I+ +E+Y  S VIH ++ F   + QV CG+  + +LTE G V+ CG    GQ         S+ +++ G +    V+Q+S   +  LA++ DG+++GWGN+E+  + S  + +    P  L L +  G V+Q + G T  A+L++KG++  WG  I+G GPN      P +IP   FG   R      + V R+ CG+ + AA+T  G L+VWG +I     +    +Q FP R+        +  G DH + +
Sbjct:   56 VWGFSFTGALGIPSFVVPDSGRKKPRKCQLTPYRLETAE--------TISSAACGYGFTLLASSTKDVSKVWGMGLNKDSQLGFQRTQRSRHHSYHYVLEPSPVALPLKEPLQTRVVQVACGRAHSLIL-------TDREGVFSLGNNAFGQCGRRIVRDEVYSDSHVIHKMEGFGDKVVQVSCGQDHSLLLTESGRVFACGWGADGQTGLGHHNISSTPVEVGGDLSGVEVQQVSTYGDCSLAVSRDGQLFGWGNSEYRQLSSVTESTQMNSPRHLPL-KGCGTVVQAACGGTQVAVLNEKGEVFVWGYGILGKGPNLSESSTPELIPPTLFG---RSEFSPSAAVSRIRCGLGHFAAVTEGGELFVWGKNIRGCLGIGKRDDQFFPWRVTVPGRVVDVACGVDHMVAL 446          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Medaka
Match: rcc1l (RCC1 like [Source:NCBI gene;Acc:101155627])

HSP 1 Score: 205.297 bits (521), Expect = 1.108e-59
Identity = 133/391 (34.02%), Postives = 206/391 (52.69%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLI--NNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQ-PHSSNINGFPILMEPSEIPLPEK---VKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRM 1375
            V+G + TGALGI   +  ++ R K        Y L            +I  AA GYGFTL +  +     V+G G+N DSQLG Q    S  + +  ++EPS + LP K      +  +ACG  HS+I+       T+ + +++LGNN FGQCGR+I+ +E+Y  S VIH ++ F   + QV CG+  + +LTE G V+ CG    GQ         S+ +++ G +    V+Q+S   +  LA++ DG+++GWGN+E+  + S  + +    P  L L +  G V+Q + G T  A+L++KG++  WG  I+G GPN      P +IP   FG   R      + V R+ CG+ + AA+T  G L+VWG +I     +    +Q FP R+
Sbjct:   56 VWGFSFTGALGIPSFVVPDSGRKKPRKCQLTPYRLETAE--------TISSAACGYGFTLLASSTKDVSKVWGMGLNKDSQLGFQRTQRSRHHSYHYVLEPSPVALPLKEPLQTRVVQVACGRAHSLIL-------TDREGVFSLGNNAFGQCGRRIVRDEVYSDSHVIHKMEGFGDKVVQVSCGQDHSLLLTESGRVFACGWGADGQTGLGHHNISSTPVEVGGDLSGVEVQQVSTYGDCSLAVSRDGQLFGWGNSEYRQLSSVTESTQMNSPRHLPL-KGCGTVVQAACGGTQVAVLNEKGEVFVWGYGILGKGPNLSESSTPELIPPTLFG---RSEFSPSAAVSRIRCGLGHFAAVTEGGELFVWGKNIRGCLGIGKRDDQFFPWRV 427          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Medaka
Match: rcc1l (RCC1 like [Source:NCBI gene;Acc:101155627])

HSP 1 Score: 177.178 bits (448), Expect = 6.495e-50
Identity = 123/406 (30.30%), Postives = 188/406 (46.31%), Query Frame = 2
Query:  239 VFGVASTGALGIKRLI--NNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIK-FDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIV 1432
            V+G + TGALGI   +  ++ R K        Y L            +I  AA GYGFTL +  +     V+G G+N DSQLG Q                                               T    +++LGNN FGQCGR+I+ +E+Y  S VIH ++ F   + QV CG+  + +LTE G V+ CG    GQ         S+ +++ G +    V+Q+S   +  LA++ DG+++GWGN+E+  + S  + +    P  L L +  G V+Q + G T  A+L++KG++  WG  I+G GPN      P +IP   FG   R      + V R+ CG+ + AA+T  G L+VWG +I     +    +Q FP R+        +  G DH + +
Sbjct:   56 VWGFSFTGALGIPSFVVPDSGRKKPRKCQLTPYRLETAE--------TISSAACGYGFTLLASSTKDVSKVWGMGLNKDSQLGFQ----------------------------------------------RTQRSRLFSLGNNAFGQCGRRIVRDEVYSDSHVIHKMEGFGDKVVQVSCGQDHSLLLTESGRVFACGWGADGQTGLGHHNISSTPVEVGGDLSGVEVQQVSTYGDCSLAVSRDGQLFGWGNSEYRQLSSVTESTQMNSPRHLPL-KGCGTVVQAACGGTQVAVLNEKGEVFVWGYGILGKGPNLSESSTPELIPPTLFG---RSEFSPSAAVSRIRCGLGHFAAVTEGGELFVWGKNIRGCLGIGKRDDQFFPWRVTVPGRVVDVACGVDHMVAL 403          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Medaka
Match: rcbtb1 (RCC1 and BTB domain-containing protein 1 [Source:NCBI gene;Acc:101165789])

HSP 1 Score: 85.8853 bits (211), Expect = 2.243e-17
Identity = 95/338 (28.11%), Postives = 147/338 (43.49%), Query Frame = 2
Query:  329 YPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGP-NKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVAC--GVKYSAAITSYGSLYVWGN 1330
            +PL  F+ L +  + S+R+A         +   S G  V+  G+N +  LG   + S I        P ++   +  K ++ ++ G G  V++A        N  ++  G+N + Q G    + E+     +I G   DK + +V CG   +  L EDG V+  G N  GQ+ S          +ITGG++ K+   I+C   + +AL   GEV+ WG N  N      ++     P RL   + +  V ++ AG   C  L D+G L+ WG    G LG  NK     P  I A            +K +VV VA       SAA T  G +Y+WG 
Sbjct:    7 WPL--FSLLSSEDRASVRQACVFGTSANEAVYVSHGNEVFAFGLNSNGCLGTGDYCSTI-------VPKKLNFLQGKKVVS-LSYGSGPHVLLA------AENGQLFAWGHNGYSQLGNGTTNQEL--SPVLISGHLQDKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVGSGSTANQPYPRRITGGLQGKLAVDITCGQTSSMALVNSGEVYAWGYNG-NGQLGIGNNGNQPSPSRLAAFQGLC-VQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKSNHLSPVRIMA------------DKERVVEVAACHSTHISAAKTRTGEVYMWGQ 312          

HSP 2 Score: 68.1662 bits (165), Expect = 1.023e-11
Identity = 59/226 (26.11%), Postives = 100/226 (44.25%), Query Frame = 2
Query:  785 FILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMY---IVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIVGA 1438
             +  E+G ++  G N Y QL +       S + I+G +++K V +++C  +  +AL EDGEV+ WG N    + S    +  + P R+         + ++ G T+   L + G+++ WG      +G+G N     QP+          SRL       V R+  G  +  A+T  G+LY WG +           N   PVR+ A    + + + A HS  + A
Sbjct:   88 LLAAENGQLFAWGHNGYSQLGNGTTNQELSPVLISGHLQDKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVGSGSTANQPY-PRRITGGLQGKLAVDITCGQTSSMALVNSGEVYAWGYNGNGQLGIGNNG---NQPSP---------SRLAAFQGLCVQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKSNHLSPVRIMAD-KERVVEVAACHSTHISA 299          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Medaka
Match: rcbtb1 (RCC1 and BTB domain-containing protein 1 [Source:NCBI gene;Acc:101165789])

HSP 1 Score: 85.8853 bits (211), Expect = 2.454e-17
Identity = 95/338 (28.11%), Postives = 147/338 (43.49%), Query Frame = 2
Query:  329 YPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGP-NKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVAC--GVKYSAAITSYGSLYVWGN 1330
            +PL  F+ L +  + S+R+A         +   S G  V+  G+N +  LG   + S I        P ++   +  K ++ ++ G G  V++A        N  ++  G+N + Q G    + E+     +I G   DK + +V CG   +  L EDG V+  G N  GQ+ S          +ITGG++ K+   I+C   + +AL   GEV+ WG N  N      ++     P RL   + +  V ++ AG   C  L D+G L+ WG    G LG  NK     P  I A            +K +VV VA       SAA T  G +Y+WG 
Sbjct:   65 WPL--FSLLSSEDRASVRQACVFGTSANEAVYVSHGNEVFAFGLNSNGCLGTGDYCSTI-------VPKKLNFLQGKKVVS-LSYGSGPHVLLA------AENGQLFAWGHNGYSQLGNGTTNQEL--SPVLISGHLQDKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVGSGSTANQPYPRRITGGLQGKLAVDITCGQTSSMALVNSGEVYAWGYNG-NGQLGIGNNGNQPSPSRLAAFQGLC-VQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKSNHLSPVRIMA------------DKERVVEVAACHSTHISAAKTRTGEVYMWGQ 370          

HSP 2 Score: 68.1662 bits (165), Expect = 1.053e-11
Identity = 59/226 (26.11%), Postives = 100/226 (44.25%), Query Frame = 2
Query:  785 FILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMY---IVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDI-----VSGAYNQTFPVRMPATFHAKTLYMGADHSIIVGA 1438
             +  E+G ++  G N Y QL +       S + I+G +++K V +++C  +  +AL EDGEV+ WG N    + S    +  + P R+         + ++ G T+   L + G+++ WG      +G+G N     QP+          SRL       V R+  G  +  A+T  G+LY WG +           N   PVR+ A    + + + A HS  + A
Sbjct:  146 LLAAENGQLFAWGHNGYSQLGNGTTNQELSPVLISGHLQDKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVGSGSTANQPY-PRRITGGLQGKLAVDITCGQTSSMALVNSGEVYAWGYNGNGQLGIGNNG---NQPSP---------SRLAAFQGLCVQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKSNHLSPVRIMAD-KERVVEVAACHSTHISA 357          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Planmine SMEST
Match: SMESG000016759.1 (SMESG000016759.1)

HSP 1 Score: 915.99 bits (2366), Expect = 0.000e+0
Identity = 445/448 (99.33%), Postives = 445/448 (99.33%), Query Frame = 2
Query:  104 MKRLFSKNFFNQIRSFGVKRATKDYIRNTEIYDYSTNPPKNSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVSGAYNQTFPVRMPATFHAKTLYMGADHSIIVGAPPA 1447
            MKRLFSKNFFNQIRSFGVKRAT DYIRNTEIYDYSTNPPKNSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETI KVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVSGAYNQTFPV MPATFHAKTLYMGADHSIIVGAPPA
Sbjct:    1 MKRLFSKNFFNQIRSFGVKRATNDYIRNTEIYDYSTNPPKNSYLGVFGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETICKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVSGAYNQTFPVLMPATFHAKTLYMGADHSIIVGAPPA 448          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Planmine SMEST
Match: SMESG000033544.1 (SMESG000033544.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.075e-22
Identity = 83/343 (24.20%), Postives = 158/343 (46.06%), Query Frame = 2
Query:  332 PLYYFNDLVNFQKISIRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVSGAYNQT 1360
            P+  F +  +F++  I      Y    F  ++ +G+ V    +  +  +     ++ I   PI  + +  PL    K ++ ++CG  HS+I   I     ++ I  ++GNN FGQC     DN I    +++   KF   I Q++CG   + +LT +G VY CG +  GQ         + F +I+       +K++S + +T LALTE+  ++ WGNNE+  +F +       KP+ L    +  ++  + A  + C +L    ++  WG+      P   +  +PT I     G   +++D    ++++++  V Y+   T  G ++  GN  +   + Q+
Sbjct:   36 PISKFGENYDFRQYGIFDDQKDYKILNF--EAGVGYLVTALEIQKEICIFKHLFNNAIENKPISNKLTHFPL----KNVHKLSCGRDHSLIYVSIKDFSLSSLI--SMGNNTFGQCSSP--DNAIILLDNIV---KFPLVINQIQCGLDHSLVLTSNGKVYSCGLSTDGQTGLETYENVNQFTEISFEDPTIKIKKVSSQADTNLALTENNRIFCWGNNEYGQVFVNSCEIQMNKPVELTFNGST-EIKDMLALGSFCLVLTKANKVMVWGLCKNQGDPVSYI--RPTEI--QLLGVDGKIVD---EEIIQLSGSVHYAVLQTVTGRMFFIGNCPIDKCHAQS 357          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Planmine SMEST
Match: SMESG000033544.1 (SMESG000033544.1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.138e-18
Identity = 62/236 (26.27%), Postives = 113/236 (47.88%), Query Frame = 2
Query:  653 LGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGNDIVSGAYNQT 1360
            +GNN FGQC     DN I    +++   KF   I Q++CG   + +LT +G VY CG +  GQ         + F +I+       +K++S + +T LALTE+  ++ WGNNE+  +F +       KP+ L    +  ++  + A  + C +L    ++  WG+      P   +  +PT I     G   +++D    ++++++  V Y+   T  G ++  GN  +   + Q+
Sbjct:    1 MGNNTFGQCSSP--DNAIILLDNIV---KFPLVINQIQCGLDHSLVLTSNGKVYSCGLSTDGQTGLETYENVNQFTEISFEDPTIKIKKVSSQADTNLALTENNRIFCWGNNEYGQVFVNSCEIQMNKPVELTFNGST-EIKDMLALGSFCLVLTKANKVMVWGLCKNQGDPVSYI--RPTEI--QLLGVDGKIVD---EEIIQLSGSVHYAVLQTVTGRMFFIGNCPIDKCHAQS 223          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Planmine SMEST
Match: SMESG000033113.1 (SMESG000033113.1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.477e-17
Identity = 98/367 (26.70%), Postives = 154/367 (41.96%), Query Frame = 2
Query:  242 FGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKIS---IRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAA-ITSYGSLYVWG 1327
            FG AS G LGI     + R K+           Y++      KIS   I K + G+  TLF  K+     +Y CG N   +LG      + N F    +P++I + +  K I+  + G  H+ +V ++        +++T G N FG+ GR  + +   +    + G      I QV CG   T  LT++  ++  G+N  GQL   D     S  Q    + N  +K I+        LT  G ++ WG+N +  +  D   S    P+ +        ++ VS G    A L   G + TWG    G LG N    K    I     G          SKV ++ CG+ ++ A + S G++Y +G
Sbjct:  139 FGAASYGQLGI-----DPRNKD-----------YYSYPQKIDKISSSDIEKISCGFDHTLFLLKNG---KLYSCGNNEFKKLG-----HDCNKF----KPNQIQMLDAHKLID-ASAGYDHNAVVTDLG-------LVFTWGKNSFGELGRDKLSDFSIKLVQSLTG----HFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMVKHLRK-QPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLG----------SKVSQIECGMNHTLAYMVSTGTVYAFG 454          

HSP 2 Score: 56.225 bits (134), Expect = 5.907e-8
Identity = 55/235 (23.40%), Postives = 98/235 (41.70%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFI--QITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            I++ G   +GQ G    + + Y     I  I     I ++ CG   T  L ++G +Y CG+N++ +L       C+ F   QI     +K++   S   +    +T+ G V+ WG N    +  D+    + K ++     T   ++QV+ G      L    ++ +WG      +GLG N  +   P  I            + +   +  +  G K+S  +T  G LY WG++
Sbjct:  136 IFSFGAASYGQLGIDPRNKDYYSYPQKIDKIS-SSDIEKISCGFDHTLFLLKNGKLYSCGNNEFKKLGHD----CNKFKPNQIQMLDAHKLIDA-SAGYDHNAVVTDLGLVFTWGKNSFGELGRDKLSDFSIKLVQ---SLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIK-----------NLSNLPIKSITAGDKFSFVLTPSGFLYSWGSN 350          
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Planmine SMEST
Match: SMESG000033113.1 (SMESG000033113.1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.973e-17
Identity = 98/367 (26.70%), Postives = 153/367 (41.69%), Query Frame = 2
Query:  242 FGVASTGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKIS---IRKAATGYGFTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPEKVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYIVG-LGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAA-ITSYGSLYVWG 1327
            FG AS G LGI     + R K+           Y++      KIS   I K + G+  TLF  K+     +Y CG N   +LG   H  N        +P++I + +  K I+  + G  H+ +V ++        +++T G N FG+ GR  + +   +    + G      I QV CG   T  LT++  ++  G+N  GQL   D     S  Q    + N  +K I+        LT  G ++ WG+N +  +  D   S    P+ +        ++ VS G    A L   G + TWG    G LG N    K    I     G          SKV ++ CG+ ++ A + S G++Y +G
Sbjct:    7 FGAASYGQLGI-----DPRNKD-----------YYSYPQKIDKISSSDIEKISCGFDHTLFLLKNG---KLYSCGNNEFKKLG---HDCN------KFKPNQIQMLDAHKLID-ASAGYDHNAVVTDLG-------LVFTWGKNSFGELGRDKLSDFSIKLVQSLTG----HFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMVKHLRK-QPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLG----------SKVSQIECGMNHTLAYMVSTGTVYAFG 322          

HSP 2 Score: 56.225 bits (134), Expect = 4.918e-8
Identity = 55/235 (23.40%), Postives = 98/235 (41.70%), Query Frame = 2
Query:  644 IYTLGNNKFGQCGRQIIDNEIYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASSDIGCCSSFI--QITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAIFSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI---VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITSYGSLYVWGND 1333
            I++ G   +GQ G    + + Y     I  I     I ++ CG   T  L ++G +Y CG+N++ +L       C+ F   QI     +K++   S   +    +T+ G V+ WG N    +  D+    + K ++     T   ++QV+ G      L    ++ +WG      +GLG N  +   P  I            + +   +  +  G K+S  +T  G LY WG++
Sbjct:    4 IFSFGAASYGQLGIDPRNKDYYSYPQKIDKIS-SSDIEKISCGFDHTLFLLKNGKLYSCGNNEFKKLGHD----CNKFKPNQIQMLDAHKLIDA-SAGYDHNAVVTDLGLVFTWGKNSFGELGRDKLSDFSIKLVQ---SLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIK-----------NLSNLPIKSITAGDKFSFVLTPSGFLYSWGSN 218          
The following BLAST results are available for this feature:
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RCC1L1.945e-5934.24RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948][more]
RCC1L3.648e-5932.93RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948][more]
RCC1L2.075e-4133.66RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948][more]
RCC1L4.142e-2135.38RCC1 like [Source:HGNC Symbol;Acc:HGNC:14948][more]
RPGR1.219e-1628.63retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W09G3.77.623e-3827.18pep chromosome:WBcel235:I:13797345:13802259:-1 gen... [more]
W09G3.77.623e-3827.18pep chromosome:WBcel235:I:13797345:13802221:-1 gen... [more]
herc-15.067e-1628.35HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
herc-15.067e-1628.35HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
glo-44.352e-1226.71X-linked retinitis pigmentosa GTPase regulator hom... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG38621.209e-5930.61gene:FBgn0031286 transcript:FBtr0078038[more]
Herc41.755e-1528.57gene:FBgn0035207 transcript:FBtr0310555[more]
HERC22.495e-1529.84gene:FBgn0031107 transcript:FBtr0301344[more]
Herc42.932e-1528.13gene:FBgn0035207 transcript:FBtr0072670[more]
Herc42.932e-1528.13gene:FBgn0035207 transcript:FBtr0072671[more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc1l1.750e-5931.12RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370][more]
rcbtb25.531e-1527.85regulator of chromosome condensation (RCC1) and BT... [more]
herc26.512e-1526.94HECT and RLD domain containing E3 ubiquitin protei... [more]
rpgrb8.265e-1527.31retinitis pigmentosa GTPase regulator b [Source:ZF... [more]
rpgrb9.871e-1427.31retinitis pigmentosa GTPase regulator b [Source:ZF... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc1l1.727e-5831.81RCC1 like [Source:NCBI gene;Acc:493236][more]
rcc1l4.039e-4631.25RCC1 like [Source:NCBI gene;Acc:493236][more]
ENSXETT00000039329.15.940e-1728.48HECT and RLD domain containing E3 ubiquitin protei... [more]
ENSXETT00000027632.16.072e-1728.48HECT and RLD domain containing E3 ubiquitin protei... [more]
ENSXETT00000039331.16.477e-1728.48HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rcc1l1.157e-6030.77reculator of chromosome condensation 1 like [Sourc... [more]
Rpgr3.884e-1730.08retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
Rpgr4.173e-1730.08retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
Rpgr4.229e-1729.80retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
Rpgr1.123e-1629.80retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CYF5|RCC1L_MOUSE8.096e-6030.77RCC1-like G exchanging factor-like protein OS=Mus ... [more]
sp|Q96I51|RCC1L_HUMAN2.070e-5832.93RCC1-like G exchanging factor-like protein OS=Homo... [more]
sp|Q9N1T2|RPGR_CANLF8.531e-2030.86X-linked retinitis pigmentosa GTPase regulator OS=... [more]
sp|Q9R0X5|RPGR_MOUSE1.073e-1529.80X-linked retinitis pigmentosa GTPase regulator OS=... [more]
sp|Q4U2R1|HERC2_MOUSE2.652e-1527.61E3 ubiquitin-protein ligase HERC2 OS=Mus musculus ... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1G3K33.807e-7334.80Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A1W4WGP91.231e-6832.08Williams-Beuren syndrome chromosomal region 16 pro... [more]
A0A0L8GIM01.742e-6834.70Uncharacterized protein OS=Octopus bimaculoides OX... [more]
B5X3R97.563e-6532.41Williams-Beuren syndrome chromosomal region 16 pro... [more]
V5GWG57.683e-6532.04Williams-Beuren syndrome chromosomal region protei... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc1l8.987e-5433.01RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370][more]
RPGR5.852e-1426.07retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
rcbtb11.052e-1326.20regulator of chromosome condensation (RCC1) and BT... [more]
herc21.888e-1326.94HECT and RLD domain containing E3 ubiquitin protei... [more]
NEK95.884e-1326.04NIMA related kinase 9 [Source:NCBI gene;Acc:103037... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc1l2.706e-6030.99RCC1 like [Source:ZFIN;Acc:ZDB-GENE-060526-370][more]
ENSPMAT00000001275.11.992e-1223.84pep scaffold:Pmarinus_7.0:GL476529:184068:212443:-... [more]
rcc21.260e-723.44regulator of chromosome condensation 2 [Source:NCB... [more]
NEK91.389e-729.09NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
rcc11.884e-623.47regulator of chromosome condensation 1 [Source:ZFI... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SRM11.097e-825.80Nucleotide exchange factor for Gsp1p; localizes to... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO463551.002e-1726.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447042.374e-1728.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371968.942e-1527.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490998.303e-1427.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345929.100e-1425.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc1l2.256e-6133.17RCC1 like [Source:NCBI gene;Acc:101155627][more]
rcc1l1.108e-5934.02RCC1 like [Source:NCBI gene;Acc:101155627][more]
rcc1l6.495e-5030.30RCC1 like [Source:NCBI gene;Acc:101155627][more]
rcbtb12.243e-1728.11RCC1 and BTB domain-containing protein 1 [Source:N... [more]
rcbtb12.454e-1728.11RCC1 and BTB domain-containing protein 1 [Source:N... [more]
back to top
BLAST of Williams-Beuren syndrome chromosomal region 16 protein isoform X1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016759.10.000e+099.33SMESG000016759.1[more]
SMESG000033544.11.075e-2224.20SMESG000033544.1[more]
SMESG000033544.12.138e-1826.27SMESG000033544.1[more]
SMESG000033113.16.477e-1726.70SMESG000033113.1[more]
SMESG000033113.16.973e-1726.70SMESG000033113.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032953 ID=SMED30032953|Name=Williams-Beuren syndrome chromosomal region 16 protein isoform X1|organism=Schmidtea mediterranea sexual|type=transcript|length=1565bp
GTTCATTTCAAAGGTTTAAAATTCTTTATGACATAATAGTATGATGGATT
TTTGAATTGCGTAATTTTAGCCTAGATTTAGATTAATATTTTTATATGTT
AAGATGAAAAGATTATTTTCAAAAAATTTTTTTAATCAAATTCGATCCTT
TGGTGTCAAAAGAGCAACCAAGGATTATATTCGAAATACCGAAATTTATG
ATTACTCGACTAATCCACCGAAAAATAGCTACTTGGGAGTTTTTGGTGTA
GCTTCTACAGGGGCTTTAGGCATTAAAAGATTGATTAATAATGAACGTAT
AAAAAATCTACATATTGCTCGCCGTGTTTATCCACTCTACTATTTTAATG
ATTTAGTTAATTTTCAAAAAATCTCCATCAGAAAAGCCGCAACTGGATAT
GGATTTACTTTGTTTAGCGGTAAAAGTTCAATTGGTTGGCATGTTTATGG
TTGCGGCGTTAATCATGATTCACAACTGGGATTGCAGCCTCACTCATCTA
ATATAAATGGATTTCCAATTCTTATGGAACCTAGTGAAATCCCGCTTCCA
GAAAAAGTAAAGGGAATAAATTTCATAGCATGTGGTCTTGGGCATTCAGT
AATTGTAGCGGAAATTGATGCGATAGATACAAATAATCAAATTATTTACA
CATTAGGCAATAATAAATTTGGCCAATGTGGCCGACAAATTATTGACAAT
GAAATATATAGAGGCAGTTCTGTTATTCACGGAATAAAATTCGATAAACC
AATAAGACAAGTAGAATGCGGGGAGGTAACAACTTTCATATTAACTGAAG
ATGGATCAGTTTATGGATGTGGTTCTAATCAATATGGTCAGTTAGCAAGT
TCTGATATAGGATGTTGTTCATCTTTTATTCAAATAACTGGTGGAATTGA
AAATAAGGTAGTAAAACAAATAAGTTGTCGTTGTAATACAGTGCTAGCAT
TGACAGAAGACGGGGAAGTTTGGGGATGGGGAAACAATGAGCACAATGCA
ATCTTTAGTGATGAGGATCACTCATGCACATTTAAACCGATTCGTTTGAA
TTTGCCTGAAACCATTGGTAAAGTAATTCAGGTTTCAGCAGGAAGTACAA
CATGTGCCATTTTGGACGATAAAGGTCAGCTGCACACCTGGGGCATGTAC
ATTGTTGGGCTTGGGCCCAATAAAATAGTTTGCAAGCAACCAACAGTTAT
CCCAGCTCCTTTCTTTGGCGGCGGATCGAGACTTTTAGATGGCAACAAAT
CTAAAGTTGTTCGCGTGGCTTGCGGAGTGAAATATAGTGCAGCGATAACA
TCATACGGGAGCCTCTACGTCTGGGGCAATGATATCGTCTCAGGTGCATA
CAATCAGACGTTTCCAGTACGCATGCCAGCAACATTCCATGCCAAAACGC
TCTATATGGGCGCAGATCATTCTATCATTGTCGGAGCCCCGCCAGCATAA
ATAAAATTGATCGTATCTTGCATTTATTTTTTATTAAATCAATAATGTTA
ATAAATTTGTGATTTCGTCGATTTATTACTTTTATATATAATTCCGGTCG
ATTTTTTTGTTCGAG
back to top

protein sequence of SMED30032953-orf-1

>SMED30032953-orf-1 ID=SMED30032953-orf-1|Name=SMED30032953-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MKRLFSKNFFNQIRSFGVKRATKDYIRNTEIYDYSTNPPKNSYLGVFGVA
STGALGIKRLINNERIKNLHIARRVYPLYYFNDLVNFQKISIRKAATGYG
FTLFSGKSSIGWHVYGCGVNHDSQLGLQPHSSNINGFPILMEPSEIPLPE
KVKGINFIACGLGHSVIVAEIDAIDTNNQIIYTLGNNKFGQCGRQIIDNE
IYRGSSVIHGIKFDKPIRQVECGEVTTFILTEDGSVYGCGSNQYGQLASS
DIGCCSSFIQITGGIENKVVKQISCRCNTVLALTEDGEVWGWGNNEHNAI
FSDEDHSCTFKPIRLNLPETIGKVIQVSAGSTTCAILDDKGQLHTWGMYI
VGLGPNKIVCKQPTVIPAPFFGGGSRLLDGNKSKVVRVACGVKYSAAITS
YGSLYVWGNDIVSGAYNQTFPVRMPATFHAKTLYMGADHSIIVGAPPA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR009091RCC1/BLIP-II
IPR000408Reg_chr_condens
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13540RCC1_2coord: 217..246
e-value: 1.3E-5
score: 24.8
NoneNo IPR availablePANTHERPTHR46337FAMILY NOT NAMEDcoord: 31..442
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IIGENE3DG3DSA:2.130.10.30coord: 365..446
e-value: 2.4E-7
score: 31.7
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IIGENE3DG3DSA:2.130.10.30coord: 44..364
e-value: 4.3E-45
score: 156.1
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IISUPERFAMILYSSF50985RCC1/BLIP-IIcoord: 40..443
IPR000408Regulator of chromosome condensation, RCC1PFAMPF00415RCC1coord: 114..167
e-value: 2.5E-6
score: 28.0
coord: 286..335
e-value: 1.6E-5
score: 25.4
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 112..171
score: 10.042
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 287..340
score: 9.901