FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30032948
Length (bp)1750
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30032948) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30032948) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032948

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032948SMESG000053390.1 dd_Smed_v4_16764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032948SMESG000053390.1 dd_Smed_v4_16764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032948SMESG000053390.1 dd_Smed_v4_16764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-8 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVT2])

HSP 1 Score: 55.0694 bits (131), Expect = 9.212e-8
Identity = 24/70 (34.29%), Postives = 43/70 (61.43%), Query Frame = 1
Query:   82 VRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQP 291
            V G+S+A  S++L +++ W I I + + L  ++ + I+ EY++  T     ++  D+ +FPAITICP  P
Sbjct:   38 VHGLSQALMSKTLRMRIFWWIVIIICISLGAFTTVLIIIEYIQGPTATSTTIRLVDSLEFPAITICPKVP 107          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.185e-14
Identity = 105/541 (19.41%), Postives = 216/541 (39.93%), Query Frame = 1
Query:   79 SVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIK--FFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLN----MRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCA--------------DFHNITEEGFERFVLSTGCI------RKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKL-----QKSWNILIDS----------PDNLTLANKAKTVAMKFLSATGLAELSTGYDNS-LFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLI 1575
            +  G++K   SR    K++W + +          +  ++++Y+++     + ++      +P+++IC  +P   R+I+  +F N+    ++    LR + K   E+ +        F +++R++Y+NL   ++  +    +++ ++C  +   E  L  V        S +   ++FNC+T N    ++         + LI    K   L     +        ++ G ++++H  GS P+     I I P     +  + +       P   C       N +++    Y +TF  CL+    + I+++C C  +  P   +PS    +C               + HN +EE  +R  + T  +      +K LN D+    S   CF+ C E  +   +S  YW    +QL  + +      Q   N  + +          P    LA     +      +  L+E     + S L   + +   + LE LS   Y +    GL+   L + IG +  L++G++    +E++E +I
Sbjct:   51 NAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNES---QNLITWLRFIQKFRFEQDS--------FMNSIRAFYENLG-QDAKKLSHNLEDMLMHC--RFNRE--LCHVSN-----FSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCT------NDMLNGIKQYKYTFFACLQLCKQRLIIQRCGCKSSALPE--VPSYNATFCGVIKDWQEINRNHSNEDHNQSEE--DRAFIPTPYLACEEREQKNLNNDRTYELS-CGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLA--DLFADIGGTLGLWMGISVLTIMELIELVI 557          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A1I8G5D0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.226e-78
Identity = 162/540 (30.00%), Postives = 280/540 (51.85%), Query Frame = 1
Query:   64 FFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFK--NKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLN-MRPEYLKNTEYIQLILRFPKPHNLSQY-MEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKE-YSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSV-IPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKL-----------SSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLF--------NNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKN 1608
            F ++ S+RGV K  ++ +  +++LWL+F+  M IL++YS  ++L  Y EY+ ++Q  +   D SDFPAITIC H PF  R+ + ++  +  ++P  F+ +LR++ +  L       A  +LFYD + +YYQNL  N +  +G +  E  ++C+  + + +++G+  + C       S P +FNCYT+   + +  +    + LI+      N  Q+  E +F+  +   A G +LL+HE+   P      +HIEP ++++I +  V WKE   +P D C         I DL+N Y +++Q C E+++ K  + KCQC+++ FPR   +PS + PYC DF        E  +    C+ ++     K+            + D +C K C    ++ ++S   W  S +QL W+     SW  L +  +     +  + + + +L A  L  L   Y             + ++ YA VV+ R S +T  +EEKL ++   L+SR+G  C+LYLGLT AFF+EI+E+L L  + +   K+
Sbjct: 1326 FCSSSSLRGVPKICRADTTFLRILWLVFVLAMFILLVYSSTRVLMNYREYDVSVQTSVIGNDPSDFPAITICSHYPFSPRAARMWQQCDGQLAPATFNRRLRQLTRQLLFSGNLRLANTLLFYDKVNTYYQNLDPNVTVSMGHSVDEFLLHCMIAIGNYVMVGKASE-CQLTFQLVSHPKYFNCYTVKPTQADKSQAMSAVYLIVNLGS--NSRQHPWEQAFVMDVFDQAYGLRLLLHEANLYPGIENAGVHIEPGKMVEIAFDTVLWKETQDSPMDRCHDGWR--PAIEDLQNRYRYSYQACKEAHMNKLFIAKCQCLLSRFPRPAGLPSNQIPYCGDFRTSNISIIESRLR---CLEEIGEHQSKMPQPAAAAAAAAVADDSQCRKRCTRYSYDQELSITRWRASSYQLHWMLHQSDSWKRLREVNNESEKRHLLRNI-LDYLGADNLTRLPVSYQQQERQQQATLTDSAEDTYAYVVVRRKSFDTLKREEKLTVTFEALMSRVGGLCSLYLGLTMAFFVEIVEFLYLACLRQRAKKS 1856          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183TB06 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13654 PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 3.217e-71
Identity = 159/549 (28.96%), Postives = 265/549 (48.27%), Query Frame = 1
Query:   46 ESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKG-MSPKDFSLKLRKVAKAFLEK--QAPDKA-ENI---------------LFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHE-MLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGF----ERFVLSTGCIRKVLNKDQKLS---SSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDN--SLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGK 1605
            + H   F  + S+RG ++  KS +  +++LW +++ +  + +  SI+K++ EYMEY+  +Q  +  +  + FPA+T C HQPF   + + +K K  MSP  F+  LR  A   LEK  + P+    NI               L YD L  YYQ+L + +   +G   K++ V C+ +     ML G    +    I   S P +FNCY++ +     ++   + LIL      N  +    +FL  L   ++G +++IHE G   +  +    + P R+ ++ ++ V    ++ PN  C +      +  DL+  Y + F+ CL SYI   ++++C C+ A+FPR   P+   PYC     +  E      +  +    C R +++    L      +K C + C   ++  Q+S   W P+ WQL W  K       L DS  N +L      +   FL    L   S    N  + F  D+ +A +V++R SN+T  K E L L+ + L SRIG  C+LY+G+T AFF+EI+E++ +    RN GK
Sbjct:   24 KEHAFRFLESTSIRGCNRIVKSENRALRVLWTVYVCLTTLFLHISIMKLVNEYMEYSVNIQTYINMDAPTAFPAVTFCNHQPFSSSAYELWKRKKIMSPTTFNQMLRNRASKILEKAIKIPEGPLANIQLINASLIQEALVQGLIYDTLPIYYQSLNWPDHRRLGHKSKDVLVLCLLRYGSTWMLTGPGCADPMLKIRHQSDPKYFNCYSVEIMKYASEHINELGLILWLGPDKNYGKEDRQAFLFDLFEQSVGLRVVIHEPGQRGSLDRHGFQVAPGRMNEVIFQTVKMIHFNRPNKPCFANSS--QRFNDLDEEYDYQFEMCLSSYIQNLVVQRCGCLYAYFPRIYPPNATLPYCGQL--VAGEDVLLDEDLIMRRRQCARLIISNAAVLRKKIEEEKICLRRCVVTEYETQVSVTMWRPTSWQLYWSQKTSS----LFDSAINGSLTPDEAHLIYHFLKTKNLTNFSADESNEKNTFVFDDRFAYLVVKRKSNDTVVKNENLVLTQNALFSRIGGLCSLYIGMTFAFFVEIVEFIYMT-CKRNFGK 563          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A1I8H6N9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002809g2 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.413e-70
Identity = 154/544 (28.31%), Postives = 266/544 (48.90%), Query Frame = 1
Query:   64 FFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNK-GMSPKDFSLKLRKVAKAFLE-----------KQAPDKAENILF--------------------YDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYV-ISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLS-KKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGF--ERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILID--SPDNLTLANKAKTVAMKFLSA---TGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYL 1572
            F    S+RGV K +K++S ++  +W IF+      + YS+ KI  +Y++Y+  +Q   + +D + FPA++IC +QPF   + + + NK  MSP +F+  LR+ A + +            + A D+ ++  F                    YDNLR YYQN+  +E+  +G T  E  V CI K     +LG    +   V +  +S P+FFNC ++   PEY      I LI+      +       SFL  +   A G ++ +HE  + P   ++ I  EP ++ +I Y+ + ++   TP + C+S       K  DL   Y + F+ CL S + + +L KC C+    PR  +P++  PYC         GF  E+F   + C++ +  +  + S   K CF  C +  F  ++S   W  + W L W+ +L + W+      S  N +   ++ T    +L+    T L  L      + F+ D+ ++ +V++R SN T+ K EK+ L+++ L SR+G  C++Y+GLT  F +E +E++
Sbjct:    9 FLETSSIRGVGKVFKTQSPLLSRMWGIFVLGSTSFLFYSVFKITLDYLQYDVNIQTYQEIDDETPFPAVSICNNQPFSVNAYQRWSNKQSMSPTEFNKYLRQQALSLVSPDLMRDKYRDLQAARDRKDSKAFRQIHQSMFDSSVAAMTYSLIYDNLRMYYQNMLADEAMELGHTRNESIVDCIFKYGSIQVLGTRGCHDDMVKVKTFSDPNFFNCLSVEFTPEYAMTIISITLIVWLGPDDSYDIRHRQSFLNEVYEQAYGLRVDVHEPKTQPRVLEQGIQTEPGKMNEIKYQPIRFERKDTPKNPCISLDAAEKQKFRDLRMEYNYDFELCLNSKVQEVVLNKCGCMYIELPRIAMPNKTHPYC---------GFMDEKFKERSQCVKSLDMRTIRKSFEGKDCFPKCVDLSFEKELSTTKWRETKWMLHWIKELCERWDKQFKQLSGSNASEFEESLTGVTDYLTRDNITDLRSLGNSTSKASFDFDDRFSFIVVKRQSNNTFVKTEKIVLTLNALFSRVGGLCSMYIGLTLTFIMEFIEFI 543          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: H2KTS4 (FMRFamide-activated amiloride-sensitive sodium channel OS=Clonorchis sinensis OX=79923 GN=CLF_106033 PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.138e-70
Identity = 139/537 (25.88%), Postives = 273/537 (50.84%), Query Frame = 1
Query:   64 FFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKG-MSPKDFSLKLRKVAKAFLEKQAPDKAENIL--------FYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLL--GEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLS---SSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYD---------NSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGK 1605
            F  + S+RG ++  +++S+ I+LLW+ F+    + ++ S+ +I+KEY+ Y+  ++   + +  ++FP++T C HQPF +++ + +++   +SP  F+  LR+ A+  ++  + + +E++L         +D ++ YYQNL + +   +G    +    C+ +   E LL  G    +    I   S P  +NCYT+++     +  + + LI+    P N       +FLQ +   A G ++ IHE G      +  I IEP R+ +IN+  +  +   TP   C+   +  N+  DL+  Y + F+ CL+S I + ++E+C C+ A+ PR V+P+   PYC       +   +       C+R V+ +  KL     ++ KC + C+  +++ ++S   W  + WQL W  +   +   ++ S  N T     +T   + +     A LST ++            +   + +  ++++R  N+T  ++E L L++  L+SRIG  C+LY+G+T A FIE++E+  + +M  +  K
Sbjct:   33 FLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNLETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNISEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLGGPGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQAFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPK--NRYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVVPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYWSQETANALEQIMASSPNFT-----QTSVDRLIVYLKTANLSTAFNAPDVAHKGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFAIFIEVIEFFYMVYMKNSHSK 562          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4S2LIB5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007029 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 3.789e-70
Identity = 139/534 (26.03%), Postives = 271/534 (50.75%), Query Frame = 1
Query:   64 FFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKG-MSPKDFSLKLRKVAKAFLEKQAPDKAENIL--------FYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLL--GEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLS---SSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYD------NSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGK 1605
            F  + S+RG ++  +++S+ I+LLW+ F+    + ++ S+ +I+KEY+ Y+  ++   + +  ++FP++T C HQPF +++ + +++   +SP  F+  LR+ A+  ++  + +  E++L         +D ++ YYQNL + +   +G    +    C+ +   E LL  G    +    I   S P  +NCYT+++     +  + + LI+    P N       +FLQ +   A G ++ IHE G      +  I IEP R+ +IN+  +  +   TP   C+   +  N+  DL+  Y + F+ CL+S I + ++E+C C+ A+ PR VIP+   PYC       +   +       C+R V+ +  KL     ++ KC + C+  +++ ++S   W  + WQL W  +   +   ++ S  N T A+  + +   +L    L+      D         +   + +  ++++R  N+T  ++E L L++  L+SRIG  C+LY+G+T A FIE++E+  + +M  +  K
Sbjct:   34 FLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNIETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNINEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLGGPGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQAFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPK--NRYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVIPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYWSQETANALEQIMASSPNFTKASVDRLIV--YLKTANLSTAFNAPDVAHKGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFAIFIEVIEFFYMVYMKNSNSK 563          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO37452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR0])

HSP 1 Score: 51.9878 bits (123), Expect = 6.865e-7
Identity = 65/248 (26.21%), Postives = 102/248 (41.13%), Query Frame = 1
Query:  577 SRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYM------EISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEP--NRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLEN------NYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKV--LNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKS 1272
            SR+    + NCY  N   ++       + ILR  KP   S         +  ++  LS  A G ++LI   G  P+  ++ I + P  +    I   N+   +    N  CLS  +     ID EN      N +++   C++S +A K L+ C C+   FP   I +       D   I             C+ KV  L +D KL  SD KC   C E+ F L IS+  W    ++  +L +L++ 
Sbjct:  311 SRFWHYRYGNCYVFNSGKDWQGEP---KPILRSNKPGPASGLTLELNAEQHEYVGQLSHEA-GMRVLISTQGEMPSPLEKGISVSPGFSTTTGIRMTNILRADPFN-NKSCLSSDD-----IDPENLYKKRYNVSYSRTTCMDSCLAHKQLDMCGCLEYRFPN--IDNRTVCDILDIDVIR------------CLNKVQSLYQDNKLGCSD-KCRPPCNEEVFKLSISSARWPTDDYEAHFLDELKED 533          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 51.2174 bits (121), Expect = 9.368e-7
Identity = 109/573 (19.02%), Postives = 207/573 (36.13%), Query Frame = 1
Query:   22 MKRHLKNRESHL---GTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICP-------------HQPFFQ----------RSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPD----------KAENILFYDNLRSYYQNLKYNES----TYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSS--PDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYST-PNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQL-EWLYKLQKSWNILIDSPDNLTLANKAKTVAMK-FLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLG---LTCAFFIEILEYLILNWMTRN 1596
            M+R+   +E+ L     F    +  G  +   +     +L W++F      + ++ ++ ++ +Y       +  L+     DFP +TIC                 F Q          R+    +N  + P+D S +  K  +      A D          + E+IL   N      N + ++     TY   T  + F  C        +   V+ + G  +  YSS  P   N  TL +    L+  EY++ I                          G ++ I + G  P   ++ I I P +   I    +  +      N  C S  E  +K +    N T++   C  S +  + +E+C C     P   +     P C   ++   +          C+ K  +  +   S D++C   C E  F+L +S+  W    +++ ++ Y L+            + + NK  + + K F+++  +A++   Y        E+   +V           +E L  +   L+S IG    +++G   LTCA  IE++  ++ N   R+
Sbjct:    1 MRRNTDPKETALEQINQFLQETTAHGFGRLGATAGSKWRLYWVMFCLAAYCVFVWQLVGLVNQYNSKPIKTRTQLKHAQKLDFPVVTICNMNVLRASRLPPKLRTKFDQIINNTNKTSPRNSSNSRNAFVDPQDLSFEETKKFEILHAVTAHDDYRELVSAAHQLEDILLSCNFNGV--NCRNSKDPTIPTYWTQTWNDNFGNC-------YMFNSVKTHNGEKVDLYSSSVPGESNGLTLQLN---LEQNEYLEGITE----------------------VAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCTNYNTPE--MQKRNIPLCNRLNSTIID----------CLNKAYDTFED-GSCDRECPPSCSEVSFDLTVSSARWPARSFEVTKYAYFLR------------VRVLNKIASSSSKYFVNSENIAQVHVYY-------GELDYLLV-----------QETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELVCVILANMSNRS 496          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053390.1 (SMESG000053390.1)

HSP 1 Score: 1155.58 bits (2988), Expect = 0.000e+0
Identity = 560/560 (100.00%), Postives = 560/560 (100.00%), Query Frame = 1
Query:   22 MKRHLKNRESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRDGKETIFEEKYLVDNKIETAESSLKNQ 1701
            MKRHLKNRESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRDGKETIFEEKYLVDNKIETAESSLKNQ
Sbjct:    1 MKRHLKNRESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRDGKETIFEEKYLVDNKIETAESSLKNQ 560          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053382.1 (SMESG000053382.1)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 350/534 (65.54%), Postives = 440/534 (82.40%), Query Frame = 1
Query:   25 KRHLKNRESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRDG 1626
            K+   N  S++  FFTNCS+RGV+KAYK+ SLIIKLLW+IFI +MM L+LYSIIKI+ EY+E+NTT+Q  LQ ED+S FPAITICP+QPF  R+I+FFKNKGMSPKDFS KLR+ AK+FLEK +P KAE+ILFYD+LR YYQNLKYN+STYIGL E EIFVYCI KL+  M +G+V  +CG+ ISRYSSPDFFNCYT+N+RPEY ++TEY+ LIL+F KP NL ++ E S L+TL ++ IGAQ+ IHE+GSSPTSTKEKIH+EPNR+LQINYRN+ WKE +TP DVC+ + + L K+IDL+N Y+F+FQ CL+SY AK +LE+C C+MAF PRS+IPSE+FPYCADF NI+EEGFE F+    CI KVLN+DQ+L+SSDKKC+K CEEQKF+LQISNI WEP+LWQLEWL  L +SWN+LI+ P N T+   AK  A+KFL+A  L +L+  ++NS F+ +E YACV++ERLSNET+Y EE+LGLSM+GL+SRIG SCTLYLGLTCAFFIEI+EYLI+ W  +   K ++  +G
Sbjct:    3 KKTRGNSVSNMEIFFTNCSIRGVAKAYKTSSLIIKLLWIIFIMIMMTLLLYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIRFFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDKKCYKKCEEQKFSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCAFFIEIIEYLIILW--KRQCKEKISSNG 534          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053391.1 (SMESG000053391.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 321/489 (65.64%), Postives = 398/489 (81.39%), Query Frame = 1
Query:  157 MMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRD 1623
            MM L+LYSI+KIL+EY+EYNTT+Q  LQ EDAS FPAITICP+QPF +R++++F+NKGMSPK+FS KLRK AK +LEK  P  AE+ILFYD+LR YYQNLKY ESTYIGL +KE+FV+CITKL   M  GEV +NCGY I+R+SSPDFFNCYT+N++PEY  NTEYI LILRFPKP NL  + +IS L++LS N IGAQLL+HE GSSP ST+EKIHIEPNR+LQINY N YWKEYSTPND+CLS+ +   KI DL+N Y+FTFQGCL+S  AK++LEKCQC+MAF PR VIPSE++PYCA+F N+++E F+ F     CI + L KD++L +  K C+K C  QKFNLQISNI W P+LWQLEWL+KLQ+SWN+LID P N ++  KAK  A++FL+A  + EL +  +NS+F  DE YACVVLERLSNET+YKEEKLGLS++GL+SRIG SCTLYLGLTCAFFIEILE++I+ W T  + K E+ ++
Sbjct:    1 MMTLLLYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQKISLLKSLSLNIIGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAFFIEILEFIIVLW-TEQSHKREIRKE 488          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000062815.1 (SMESG000062815.1)

HSP 1 Score: 256.144 bits (653), Expect = 9.518e-77
Identity = 158/532 (29.70%), Postives = 267/532 (50.19%), Query Frame = 1
Query:   64 FFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFF-KNKGMSPKDF-----SLKLRKVAKAFLEKQAPDKAE--NILFY----DNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSS---SDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSW---------NILIDS-----PDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYL 1572
            FF N S+RG S+  KS +  ++ LW++F+   +  ++ SI K++ +Y +Y+  +Q  +Q ++A+ FPA+T C HQPF +R+ + + ++K MSP  F     S  L++       K  P  ++  + LF     D L  YYQNL    S+ +G     I   C+      M      ++   ++   S P +FNC+T+   P+Y      + LI+        +      FL  +   A G +++IHE  S P    E + IEP R+ ++NY+     +  T    C+++ + + +  DL+N + +    C    + ++I+ +C+CI  ++PR + PS++ PYC     +  E +   +    CI K+ N+   + S   +DKKC   C   ++    S   W P+ WQL WL ++  +W         NI I S      D + L N    +   F +   L+E     +  LFN  E Y  VV++R +N T+ KEE+L LS + L+SR+G  C+LY+GLT AFFIE++++L
Sbjct:   20 FFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELG-HNISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYR--DLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCG---YLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIET-FFTRKNLSEFIPESEKLLFN--ERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFL 542          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000039581.1 (SMESG000039581.1)

HSP 1 Score: 249.98 bits (637), Expect = 2.721e-74
Identity = 172/555 (30.99%), Postives = 290/555 (52.25%), Query Frame = 1
Query:   64 FFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFK-NKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCG----YVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLS--KKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGC---IRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPD-NLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRDGKETIFEEKYLVDNKIETAESSLK 1695
            F +  S++G++K  +     ++ LWL F+  M  +++ S   +++++M Y+  +   ++    + FP+ITIC H PF   + K+++ NK +SP  F+ K+R +  + L      +AE I  YD +  YYQN+ YN+S  IG  +K+IF+ C+  L++ M+    E+NC     Y +  +S  + FNCYT   + + +     + +I+    P + S   E +F+    R A G ++++HE G  P      +H+EP ++ +I+YR V WK  +TP   C +  KKE  N   DLE  Y +T   CL S   K+I+++C CI  + PR  IP++K PYC +F  + +           C   I++ +N  +KL S  +KCF+ C    +   IS   W  + W L W+     ++  L ++P  N T +   K   +K+ +AT L  +          ND  +A +VL R S+ +  K E+L +S + L+SRIG  C+  +G+T +FF+EILE+L L + +  T K E   D    I+E+      ++   +SSLK
Sbjct:   82 FCSTTSMKGMNKITRGPK-PLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSMEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIG-HQKDIFLSCML-LRNNMI--SYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITT---LGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYN---DLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLQIPTKKLPYCGNF--LEDSDLSELNHRIECLTNIQEDVNFKKKLES--EKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATESTYFKQ-WLKYWNATNLTVIDEDRKERFLANDN-FAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDN---IYEKTQFSPKRV-LKKSSLK 614          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
del-89.212e-834.29DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:A0A3B... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP3.185e-1419.41FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G5D02.226e-7830.00G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183TB063.217e-7128.96Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A1I8H6N91.413e-7028.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
H2KTS42.138e-7025.88FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A4S2LIB53.789e-7026.03Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO374526.865e-726.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421379.368e-719.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053390.10.000e+0100.00SMESG000053390.1[more]
SMESG000053382.10.000e+065.54SMESG000053382.1[more]
SMESG000053391.10.000e+065.64SMESG000053391.1[more]
SMESG000062815.19.518e-7729.70SMESG000062815.1[more]
SMESG000039581.12.721e-7430.99SMESG000039581.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032948 ID=SMED30032948|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1750bp
TTTTCATAATAATTTATTCACATGAAACGTCATTTAAAGAACAGAGAATC
TCATTTGGGTACGTTTTTTACGAACTGTTCTGTTAGAGGAGTTTCCAAGG
CCTACAAATCGAGATCTTTAATAATCAAGTTGTTATGGCTAATCTTTATT
ACAGTTATGATGATACTTATGCTTTATTCAATCATCAAAATCCTAAAAGA
GTACATGGAGTACAATACCACTATGCAAAATGTGCTACAATTTGAAGATG
CTTCAGATTTTCCTGCCATAACGATCTGTCCACACCAACCATTCTTTCAA
AGGTCTATAAAATTTTTCAAAAATAAAGGAATGTCACCAAAGGATTTTAG
TTTAAAGCTCAGGAAAGTGGCAAAAGCGTTTCTTGAAAAACAAGCACCAG
ACAAAGCAGAAAATATTCTTTTCTATGACAATCTCAGATCTTATTATCAA
AACCTAAAATACAACGAGTCGACATATATCGGACTGACGGAGAAAGAAAT
ATTTGTTTATTGCATAACTAAGCTAAAACATGAAATGCTTTTGGGAGAGG
TGGAAAAGAATTGTGGCTACGTAATTTCCCGATATAGCAGTCCGGACTTT
TTCAATTGCTATACGTTAAATATGCGACCGGAATATTTAAAAAATACCGA
ATATATTCAATTAATCCTACGATTTCCTAAACCTCATAACTTGAGCCAAT
ACATGGAAATTTCTTTTCTACAAACATTGTCAAGAAATGCAATTGGAGCT
CAACTGTTGATTCATGAAAGCGGAAGCTCGCCAACCAGTACAAAAGAGAA
AATACATATCGAACCAAACCGGATTTTGCAAATTAACTACAGAAATGTCT
ATTGGAAGGAATATAGCACCCCGAACGACGTCTGTTTATCGAAAAAGGAA
AATTTAAACAAAATAATCGACTTAGAAAATAACTATACCTTCACATTCCA
AGGATGTCTTGAATCTTATATAGCGAAAAAGATTTTAGAAAAATGTCAAT
GCATAATGGCATTCTTTCCCCGATCGGTCATTCCTTCGGAAAAATTCCCA
TACTGTGCAGATTTTCACAATATTACTGAAGAAGGCTTTGAAAGGTTTGT
CCTTAGTACTGGATGCATTCGGAAGGTTTTAAATAAAGATCAAAAGCTCA
GTAGTTCAGATAAGAAATGTTTCAAAGTTTGTGAGGAGCAAAAATTTAAT
TTGCAGATATCAAACATTTATTGGGAACCGAGTTTATGGCAATTGGAATG
GCTGTACAAGCTGCAAAAGTCTTGGAATATCTTAATAGATTCTCCTGATA
ATTTAACTCTTGCTAATAAAGCAAAAACGGTTGCTATGAAGTTTTTAAGT
GCAACCGGTCTAGCTGAATTATCAACTGGGTACGATAATTCCCTATTCAA
CAACGACGAAATGTATGCTTGTGTAGTTTTGGAAAGGCTATCTAACGAGA
CTTATTACAAAGAAGAGAAATTGGGATTGAGTATGCACGGTTTGATTAGT
AGAATTGGAGCCTCTTGCACCCTGTACCTTGGTCTAACGTGCGCATTTTT
CATTGAGATTTTAGAATATTTAATTCTCAATTGGATGACAAGAAACACTG
GTAAAAACGAGGTCGGCAGAGATGGAAAAGAAACCATTTTTGAAGAGAAA
TATTTGGTTGATAATAAAATTGAAACCGCAGAATCATCGTTAAAAAATCA
AGATTTATGAAAAAAAGATTGACTATTAGGAACTGGCTGACTGATATGCC
back to top

protein sequence of SMED30032948-orf-1

>SMED30032948-orf-1 ID=SMED30032948-orf-1|Name=SMED30032948-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MKRHLKNRESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILM
LYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFK
NKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNES
TYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLN
MRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHES
GSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIID
LENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHN
ITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIY
WEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAEL
STGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCT
LYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRDGKETIFEEKYLVDNKI
ETAESSLKNQDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 242..260
score: 24.0
coord: 76..92
score: 40.71
coord: 184..200
score: 32.47
coord: 383..403
score: 23.62
coord: 318..335
score: 25.11
coord: 36..53
score: 16.89
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 15..516
e-value: 2.2E-49
score: 168.6
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 13..528
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 497..519