cilia- and flagella-associated protein 46

Overview
Namecilia- and flagella-associated protein 46
Smed IDSMED30032947
Length (bp)8424
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 46 (SMED30032947) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 46 (SMED30032947) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 46 (SMED30032947) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 46 (SMED30032947) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032947

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032947SMESG000014118.1 SMESG000014116.1 SmedASXL_014836SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032947SMESG000014118.1 SmedASXL_005757SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032947SMESG000014118.1 SmedASXL_011693SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032947SMESG000014118.1 SmedASXL_008238SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032947SMESG000014118.1 SmedASXL_007790SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032947SMESG000014118.1 SmedASXL_005229SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032947SMESG000014118.1 SmedASXL_001119SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v6_14103_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30032947SMESG000014116.1 SMESG000014118.1 dd_Smed_v4_14103_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Human
Match: CFAP46 (cilia and flagella associated protein 46 [Source:HGNC Symbol;Acc:HGNC:25247])

HSP 1 Score: 238.424 bits (607), Expect = 8.744e-62
Identity = 192/759 (25.30%), Postives = 345/759 (45.45%), Query Frame = 2
Query:  914 NEQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILD--HDLSMKEGENDKDVHGKFTK--TFSWENVVT--RINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPV------FLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQIT 3154
            +E++  LL ELA+ SL     +    C++ +++M S++   L+ E + +  E   +  ES  +    A ++ +L  I++    L   +R  + R+I + CA+ WN CLP+LQ +L   +   L  VAD LE +  L   L  QVH+E+ +     +++  A ++L+KA  LD    Y + I+    +L++   LY+ P    D+A   +EQ +     +   + K R LL   G  LAPD F ++LD  ++  +  G+N     G+FT     +W + V+  +   +L R GN +DK ++++W +L K++RK  +WD+CR AS F +LYD+ + K   ++++    R+G +  G                        D S+ +   + E        + Q ++   LL +  E  FI AEA +  LR+EG +L      P+DL +HP G++ +    + EW +Y   +E LS   +  +LR+A +  ++Q  W  QNA  Y+ N++ H++       LV +   +   ++   +     ++      LA G+I  ++P+        F+  N F SP     LD  A                         ++ K A+++C++ +++T+   P                          T+   T+ QLI  WV+ KQLLQQ +G  LGT++         + R + +++M + C         + S+   ++    C+W +  V L  L +L    
Sbjct:  286 SEEKMLLLFELARFSLTLKCMEISSACLSDLKKMESKDPGKLI-EMECLECESEALRLESKMKVYNRAAVEAQLDIIQRLDVALQRAVRLGDPRVIHVVCATQWNTCLPLLQHNLRHHLRKPLAGVADVLEKLDSLMTLLRCQVHMEMAQIEEDEDRLEPATEHLRKAARLDSLGLYRDRIQMASTRLRLCTTLYQAPERAEDKAIMAVEQAKKATPKD--SVRKKRALLVNAGLALAPDAFQIVLDSENEAKVSTGKN----RGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQGVWDVCRTASRFCLLYDNVKVK---KLRL----RRGKKKRG-----------------------RDGSVQDTWSQPE-------VVLQRQVCPDLLRKFAEVGFIHAEATVHLLRSEGVELNDRAIPPEDLSQHPAGYVPEPPEVNAEWITYRTWIESLSRCAMNNWLRSAEIGQEIQEAWIVQNAVVYVLNHNHHLILAGRQKELVDALYHLLSIVKATGHSGDPVMLVTLCNTLARGLIISWIPVQAAEKSRKFMRPNAFHSP-----LDAGA------------------------TSEIKTAVEVCEFALNLTNGSAP------------------------EETVPTGTRQQLIATWVKAKQLLQQQIGPRLGTEEQGTNEDVSSVTRVLVALEM-YSCNGLGLMDFTVPSLAQLVKMASECNWSDPLVELQTLTRLTHFA 946          

HSP 2 Score: 129.798 bits (325), Expect = 6.219e-29
Identity = 260/1198 (21.70%), Postives = 469/1198 (39.15%), Query Frame = 2
Query: 4727 LPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSPFVIP-EYCAHVEIIKANLEEYKKQNKSQVLP-MNFETQSTLPLKLSHLN-------------RKLTKFGYIHETWIKIAWILVEIGYNQEA----SEVICVAEELSKMLND--------EKMNTECNLLKAKLMINQGE---------------FDEALLYIDAIGS----CHFTFKQWSEIIDLLIEIGTDQANE----HGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLIVIEKCLEIYQ--IIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESK--EWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEH-SLNQQFLYCAFIDTKHKTANLSKPNNKPAAIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIFEKLGNFFP-----------PGNERNSPSNQKANKETISQPGK---------DSIIILTDEILSVASLESIPKLK----SSISRDFSLQVLHHRLKGMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTK-IIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQ--ITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKER 8074
            LP S EEW+ +   ++ L  +       +     I  P    +    D L++ L +     LT P+L +   IS  D  V +K L+   HLR       +  ++A   HE+ +    V   E  +  + I    E+ K+    + LP +N +T    P ++  L+             R L    + H  W+  A +L+E+   Q A    SE     +EL +   +        +  N E N  +AK MI Q +                 EALL ++  G     CH     + ++I+    +  ++ N        I+ +  R L ++     RVA+     +      L+ +M+ GLL ++R+   +D G   N  +V ++  A + +L       E  K+  YL    + +  + +   +++       L    +   E  L   Q  +   D+  V         N P+ RKL R KL L +  ++M     E+      Q   +  L +++ +Y++    D  S   +W  +   +     + L  +  +     +I A+ L   G  + L AM+  P     +      +   L   KS  + +++    K   +        E+  +  +        K +M+  + YL QA E++ Q + +++     D    A+  +++  G  D   + Q L L Q+   +  MR++LL      S  QLAA +LQ  + +R   R     T  SL   V+++L +   AW+   V+     LL ++    + +++F H S ++  LY A  +   K   ++    K  A+G   K+ R+A SP+                             F   +    +   QT+ Q  + E  ALN   +   L++EE    + + L   LGP+ E L   FP           P    +S  ++  +KE  +  G+         D I+++ D  L    LE +        SS+SR+FSLQ+L +RL        V         K+ +S+ P +    R + KK  K  IP  R +P   + +D++  +F+VDP +++      +  S     +T  +L   Q   T RW G +G    P+  + E  L   +   +   E+F+S    + L+ +N  + Q     D   + ++ +R
Sbjct: 1417 LPMSIEEWASYSCPEEVLSVLKQDRSDSTVNPSSIQKPTYSLYF--LDHLVKALQKMCLHELTVPVLQLGVLIS--DSVVGSKGLSDLYHLRLAHACSELKLREAAARHEEAVGQVCVSELEQASCRKEIALKKEKNKEPLLEESLPALNEQTLPVQPGEIKPLDAKDKILKMNGETGRDLDGTSFPH-LWMLKAEVLLEMNLYQPARLLLSEAYLAFQELDEPCAEAQCLLLLAQLANKEKNYGQAKKMIAQAQHLGGSEEFWYNSTLTLAEALLSMEHSGREATVCHI----FQKLINAFKILKKERPNRLPLLEFMITDLEARCLSLR----VRVAQHSAVTEPTECSLLLKEMDDGLLEIERKF--IDCGCKENCVDV-KLERAKIKRLRAQNEKDEEQKTAYYLEAYGLAQGAVAEEEGRLHSIQGLYGLAQGAMAEEEGRLHSVQGLLSLQDLQNV---------NTPLMRKLARLKLGLVEMALDMLQFIWEEAHG---QQSEQGSLEKLLADYLQNT-SDYTSVGLQWFTLKRTLAHGALAQLGSLQPLSVGCVEIRARLLGLAGRALHLLAMQADPVHPTCYWEAGPSVGAKLSGLKSLELEVEEEGATKSSRDPPASRAAPEEHCRRGED------LKRRMVLAQQYLAQASEVLLQCLQVALGSGLLDVAAAASLEMVECVGTLDPATTCQFLALSQSCSASETMRDVLLAATANTSSSQLAA-LLQLQHQLRCQDR-----TTTSLGARVEQRLAAVSKAWQNLCVTEQHFNLLNEMP--PTFWILFLHLSGDRSRLYGAAYE---KPKFITAAKGKVQAVGGSCKVMRLAISPT----------------------------AFSHLLACAQQFRKQTQAQ-VYSEDMALNIGSEPEGLQVEEKERPV-QRLSSVLGPLEELLQPLFPLLSLSKARVQTPAVVADSGKSKGKDKERKTSTGQHSTVQPEVADKIVLVADRHLLELPLEGLSVFDEGTISSVSREFSLQMLWNRLHKEETEGGVK--------KEGRSRDPKK----RSLAKKGRKGSIP--RTIPPDCIIVDSDNFKFVVDPYEEAQGPEMLTPVS-----ITQDILERFQDTFTSRWAGHLGSKHFPSQAQWEQALGSCSGFFFYGMESFLSHILVERLVAMNLQECQVAVLLDLARSYQSLKR 2519          

HSP 3 Score: 122.479 bits (306), Expect = 1.203e-26
Identity = 56/214 (26.17%), Postives = 120/214 (56.07%), Query Frame = 3
Query:  126 ATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDD 767
            + D+ V+  E  LK     ++ +C+++YF +     Q+L RA+L +AQ+  P+  +     +  +   +KAINF+K E R+++L+YN++++Y+++VR +L+P +  +L  SLS I   L +  + + ++R++LML L++C++ AG ++E  +     A F+  H P   + + + ++ + +    +     KN  ++     +  LK   +++D
Sbjct:   45 SPDLFVLCAEQALKMRQPEVSEDCIQMYFKVKAPITQFLGRAHLCRAQMCAPKSAENLEEFENCVTEYMKAINFAKGEPRYYFLVYNASVLYWQMVRPFLKPGYRHHLIPSLSQIINVLSQTEEEDKEWRAELMLELLECYLQAGRKEEAARFCSTAAPFIKSHVPQKYRQIFSVMVRHELMDELQLKEEKKNSISLSVTFYINMLKAKAEQND 258          

HSP 4 Score: 111.309 bits (277), Expect = 3.039e-23
Identity = 51/147 (34.69%), Postives = 86/147 (58.50%), Query Frame = 2
Query: 3743 EQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILL 4183
            E DL +R  ++  +F     Q+ W   LK LDEA+  LPRT H+L +F+H ++ K +L  +  +++QKFK + E+ +A +W  +A+ S S   +L  Y  +I++L+       KV+ +ME  QWL H  +P+E    ++ +A+ ILL
Sbjct: 1104 EDDLALRAALYGLLFHSHADQDDWEGGLKVLDEAVQVLPRTAHRLLIFKHMVIVKAKLGQNFSMEIQKFKAESEDYLARMWHRLALNSPSVSGELACYNNAIQALQKPEMEWQKVEYLMEFGQWLHHRHFPLEDVVFHLRWAVEILL 1250          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Human
Match: CFAP46 (cilia and flagella associated protein 46 [Source:HGNC Symbol;Acc:HGNC:25247])

HSP 1 Score: 120.553 bits (301), Expect = 7.667e-28
Identity = 51/181 (28.18%), Postives = 108/181 (59.67%), Query Frame = 3
Query:  126 ATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSI 668
            + D+ V+  E  LK     ++ +C+++YF +     Q+L RA+L +AQ+  P+  +     +  +   +KAINF+K E R+++L+YN++++Y+++VR +L+P +  +L  SLS I   L +  + + ++R++LML L++C++ AG ++E  +     A F+  H P   + + + ++ + +
Sbjct:   45 SPDLFVLCAEQALKMRQPEVSEDCIQMYFKVKAPITQFLGRAHLCRAQMCAPKSAENLEEFENCVTEYMKAINFAKGEPRYYFLVYNASVLYWQMVRPFLKPGYRHHLIPSLSQIINVLSQTEEEDKEWRAELMLELLECYLQAGRKEEAARFCSTAAPFIKSHVPQKYRQIFSVMVRHEL 225          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Xenopus
Match: ENSXETT00000034331.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:19360502:19399394:1 gene:ENSXETG00000006684.1 transcript:ENSXETT00000034331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 1.344e-38
Identity = 125/476 (26.26%), Postives = 204/476 (42.86%), Query Frame = 2
Query: 1736 VTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKG 3163
            V +   +L R  + +   ++RLW DL K++RK ++WD+CR A  F +LYDDGRW          + +K +  +G    + NA+  A  TN                                  E+ LL  L E  FI AEA I  L++E  +L   P  P+D + HP G+      ++ +W  Y + + +LS      FL+AA L V+L   W T NAA Y+ NY+ H+++             + D L ++ N  ++ +++N    LA G+I +++P           SP  ++    K KK               G+ S +SV+       +C+Y++D+T+   P                           + I  + Q++  WV+ KQLLQQ +G  LGT++ E   GQ  + R + +++M          F  + S++       LC W +  V L LL +LA    K 
Sbjct:  162 VQKTEGHLKRIEDKNAAERVRLWADLAKVARKQEVWDVCRAACRFCLLYDDGRW----------NIQKKDTCLGLEGELSNAK--AAFTN----------------------------------ERALLRTLAEIRFINAEATIHLLKSENCKLNEPPIPPEDTRMHPVGYTAVNPEDNPDWIVYRDWISELSRYATENFLQAAELGVELHEGWITHNAAVYILNYNKHLIS-------TERLSELTDALHKL-NTVLLAMLSN---ALAKGLILRWIP-------GSAASPKDASIHSAKVKK-------------APGKGSEKSVH-------VCEYVLDLTNGRMP------------------------EEMVPISVQQQILATWVKSKQLLQQQIGPKLGTEE-ESNEGQNLMTRVVIAIEMHSCNGLGLMDF-SVPSLSQVFDMTCLCHWADPFVELQLLTRLAHFAYKA 527          

HSP 2 Score: 96.2857 bits (238), Expect = 3.516e-19
Identity = 44/116 (37.93%), Postives = 81/116 (69.83%), Query Frame = 3
Query:  186 ANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLL 533
            + +CL+LYF  +P +NQ+  RAYL +AQL  P+       L+K + + LKAI F K+++R+++L++N+++IY+++V+ +L+      L  SLSS+ K L+E+++ +  +R+QLM+L
Sbjct:    7 SKDCLQLYFRNNPPQNQFFGRAYLCKAQLHIPQ----SDQLEKSVVYYLKAIGFGKQQQRYYFLVFNASVIYWQMVQPFLKSGSRHLLIPSLSSVVKALDEIDERDHTWRAQLMIL 118          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Xenopus
Match: fen1 (flap structure-specific endonuclease 1 [Source:Xenbase;Acc:XB-GENE-955518])

HSP 1 Score: 60.8474 bits (146), Expect = 2.982e-9
Identity = 43/198 (21.72%), Postives = 76/198 (38.38%), Query Frame = 2
Query: 7856 QITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIR----------------NPPIEEVPELIKNLSLTSPSESFIKSNLVLYGLPNIAV 8401
            Q TP W G++G    P+  E E    + ++ ++   E F++       L +N  + Q +   D + T ++  R  +         L  +     A L+S  G++S + NQW   ++ N   +       L  G   G+ +  +R                 P   E   L++      P+      + VLYGLPN+ V
Sbjct:   10 QFTPHWEGIIGSSHIPSHAEWEKLTTDCSAFLFYGMERFLAHILSDKFLALNLKECQLMILLDLVRTSESFARQSKVDVQKRATSLTLERPVETALLLSATGIRSVMLNQWHTTLEKNAKRLDCLAENLLATGKTTGQSVHSLRRLQWNSNLLNDEGDNIKPDDGEEEILMREPVSKPPAWDPSVFSYVLYGLPNMVV 207          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Mouse
Match: Cfap46 (cilia and flagella associated protein 46 [Source:MGI Symbol;Acc:MGI:2444387])

HSP 1 Score: 301.212 bits (770), Expect = 3.859e-81
Identity = 273/1116 (24.46%), Postives = 497/1116 (44.53%), Query Frame = 2
Query:  917 EQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVH-GKFTKTFSWENV--------VTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSS---FQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEF---YKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKVSPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCLHKTGQNTSVL----------MQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRLKLFLEPHTXXXXXXXXXXXXXKLP-HILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLN 4186
            E++  LL EL ++ L          C+  +++M +E+   LL E + +  EL  +   S  +      ++ +L  I++    L   IR  N   I + C + WNICLP+LQ +L   +   L  +A+ LE +  L   L  QVH+E+       +++  AI+++QKA+ LD    Y + I+    +L++   LY+ P  P D+A   +EQ +     +     K R +L   G  LAPD F ++LD        EN+  V  GK    F++           V +   +L R G  +DK ++ +W +L K++ +  +WD+CR AS F +LYD+ + K                    S+ ++      V    MS+   +D ++++                  ++   LL ++ +  FI AEA +  LR+EG QL      P+DL +HP G++ +    + EW +Y   +E LS   +  ++RAA +  +L   W  QNA  Y+ N++ H++       LV S   F ++   +    +  M+ ++ N    LA G+I  ++P                T   +K+KK+      +     G  ++ST  ++  + A+++C++ +++T+   P                           +    +  LI  WV+ KQLLQQ +G+ LGTD+         + R + +++M + C       +  P L+ V   ++    C+W +  V L  L +L        +++     +  ++ A ++  + H+   + +N          AKLA         LC+    Q  S++          +   +  V++  +    N   LV   + ++W     L+   +N  +    ++ II+ ++ T +KK+                  E ++ LP H     D Q   T    +  FL            E DLT+R  ++  +F     +  W   LK LDEA+  LPRT H+L +F+H ++ K +L  +  +++QKFK++KE  +A++W  +A  S +   +L  Y+ +I++L+   NN  KVD IME S+W+++  +P++    ++D+AI ILL+
Sbjct:  287 EEKILLLFELGRLCLTLKNEPIASDCLQYLKKMETEDTGKLL-EMEGLECELDALRLGSKLKMYLRGAVEEQLLIIKRMDNILQRAIRLGNPTTIHVLCTAQWNICLPLLQHNLRHHLRKPLTNIAEILEKVDSLMILLRCQVHMEMAYIEQDDDRVEPAIEHMQKAMRLDSLGIYRDKIKITYRRLQLGTMLYQSPDRPEDKATMAIEQAKKATPKD--SARKKRAILVNAGLALAPDTFQIVLD-------SENESKVSIGKIKGRFTYLCAKARHHILSVDKAAGHLRRLGYENDKDRIVIWAELAKVAWQQDVWDVCRTASRFCLLYDNVKAKR-------------------STKLKRGRKKKVIEGSMSDWAPSDMAMHK------------------QMPPDLLRKIAKVLFISAEATVHLLRSEGVQLNNQAIPPEDLSQHPAGYVPEPPESNSEWITYRTWIENLSQYAMNNWMRAAEIGQELGESWIVQNAVVYVLNHNRHLILAGRQKELVESLFHFLSIIKIVGYTEDSVMLVMLCN---ALARGLIMSWIP----------------TQTPEKSKKN-----VRPTLVHGPLESST--LSDIRAAVEVCEFALNLTNGNVP------------------------EDIVPTNVRQHLIATWVKAKQLLQQQIGQRLGTDEQSTNEDISSVTRVLVALEM-YSCNGLGLMDFTVPPLVQV---VKMASECNWSDHLVELQTLTRLTHFAY---MAHDHEVTMACSQNATQMGLK-HLRSFEPSN----------AKLAAEM------LCMVSCIQGRSIMENLKGRKQLRLAAAKAFVESARFGGLANSNSLVMMAARHYWNTWLPLLSSPANRKKAKASLQRIISIINKTENKKQ------------------ETDKTLPLHQWPSADFQTGGT--GPEIPFLPGA---------EDDLTLRAALYTLLFNSHADRNDWEMGLKVLDEAVQVLPRTAHRLLIFKHMVIVKAKLGQNFTMEIQKFKDEKESYLASMWYRLAQNSKTVCGELSCYQNAIQALQKPENNWQKVDYIMEFSEWMYYKQFPLDDVFDHLDWAIEILLS 1252          

HSP 2 Score: 191.815 bits (486), Expect = 7.512e-48
Identity = 278/1277 (21.77%), Postives = 523/1277 (40.96%), Query Frame = 2
Query: 4715 PADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSP-FVIPEYCAHVEIIKANLEEYKKQNKSQVLPMNFETQSTLP--------------LKLSHLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYIDAIGSCHFTFKQWSEIIDLLIEIGTDQANEHGDISKIRL------RLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLIVI-EKCLEIYQIIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESKEWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYG---HVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTKHKTANLSKPNNKPAAIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPI-----FEKLGNFFPP--GNERNSPSNQKANKETI--SQPGKDSIIILTDEILSVASLESIPKLK--SSISRDFSLQVLHHRLKGMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQ--ITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIR---NPPI--EEVPELIKNLSLTS-----PSESFIKSNLVLYGLPNIAV 8401
            P D +PTS  EW+ +  S+D L          +        P    +    D L + L +     L+ PIL +   +  ++  V +K L    HLR LQ    +    A  HHE+ I    F   E  +  + I    E+ K+      LP   E Q TL               LK++    K  +     + W+    +L+E+  +Q A  ++  A+   + L D     +  LL A+L   +    +A+L ++         + W +    L E      +   +IS   L          +++   NRV+ ++    +L +  +  ++ +   L D                   ++      L E+E        +K  +++ ++  +I     +  +    K+    ++  + +K +   + +F  I  + S  +    N P+ R+L R KL L++  +++  +  ++  +  ++  + + L  + D             +W  +   +   + + L  +  +C    DI AQ L+  G   H++ ++   +YP+    W   L+     + T+K  L +L+  + ++ +E +S  + +    E+    S K    K +M+  R +L Q  E++ Q I  S+++   D V +A+  +++  G  D   + Q L L Q+  T+  MR +LL   +     QLAA +LQ    +R+  +  +     SL+ SV++KL S+F AW+   V+     +L ++  +    L  +HS ++  LY A  +   +   +  P  K   +G   K+ R+ATSP+ I DL    + F           + +T++ EQ +                                  ++ S I+E++++YL PI     F +  N  P   G+   +   +K  K ++   QP  + +I++ D+ L    LE +  L   +S+SRDFSLQ+L +RL        +     +   KK            +   KK+ K I + R +P     ID++ ++F+VDP +++  +           E+T  +L + +   T RW+G +G+   P+  + E  L       +   E F+S    + L+ +N  + Q +   D   +  +++R ++ S   S            A L+SL+GV+S V NQW  L+  N       +   L  G  +G+ ++ I    N P   +E P++ KN  L+      P       N VLYGLP+ A+
Sbjct: 1464 PPDEIPTSIGEWASYSCSEDLLHVFKQDKSDCTINSSSFQKPTYSLYY--IDHLAKALQKMFLHELSIPILQL--GVLIAEAVVESKSLADLYHLRLLQVCSDLRLHYAATHHEEVIGQAYFGDMEQASCRKEIAFKKEKNKEPEMEDYLPTLHE-QLTLSDSVEVKALIAQDKILKINGETGKGLEGTSYPQLWLLKGEVLLELELHQPARLLLSEAQWAFQELGDICSEAQSLLLLAELANKEKNHAQAMLMVERAQQLGGAEEFWYKSTLTLAEAILSSEDRRKEISVCSLFQKLIDTFRALQNERPNRVSLLEFLIMELEARCVKLRIQFACNLTDEEFNEHPF-----------LLRELEDHLLEVEQNLIFGGYYKNYVDLKLDHAKIKRLCAQKEKDEEQKTAYYLEMYSLSQKAVSEEEEVFHRIQALLSLHDLQNINSPVMRRLARLKLSLAETCLDLLQLVCKEALDLQMEQGSFEKL--LADFLQNTTDYTSIGLQWFFLKRTLPHLVLTQLESLQPLCVGCTDIRAQLLILAGKALHLLYVQTDPVYPS--FCWEEELL-----VGTKKDSLRSLETDTEDRSVETSSSAVFKEAPKEQ----SRKAEGLKKRMVLARGFLAQTSEVLLQCIQTSLSNNLLDIVASASIEMVECIGILDPITTCQFLTLSQSCSTSEMMRKVLLTATKNTGSSQLAA-LLQLHQRLRQQDKMST-----SLFASVEQKLASSFRAWQSLCVTEQHFSILNEIPPVFR-ILFLQHSQDRSCLYGAAFE---RPKTMPSPKGKLITVGGYCKVTRVATSPTAISDLLTSIQWF-----------QRQTRVKEQAL--------------------------------CTQSLSSILEHMEDYLKPITPQLTFPESRNQMPTAVGDAGKNKGREKERKISLPSGQPDPEYLILIVDKFLLELPLEGLSMLNEVTSLSRDFSLQMLWNRLHKEEREGSMKKEVKSKDLKK------------KTPGKKALKSI-MTRIIPPECNLIDSDTIKFVVDPYEEARGTELMR-----PIEITQEILEKYRDTFTGRWMGHLGNHNFPSQADWEQLLDSCRGFFFYGMETFLSHLEIERLVAMNLQECQMMILLDLTRSSHSQKRTIESSEGQSASQRSLVKPIQTAILLSLVGVESIVDNQWPTLMQDNMLRATILWDNLLAIGKPLGKTVRLIHKLCNEPGSQDEKPQVSKNEPLSELQPHHPESLTTALNWVLYGLPHQAI 2640          

HSP 3 Score: 113.235 bits (282), Expect = 5.409e-24
Identity = 53/188 (28.19%), Postives = 111/188 (59.04%), Query Frame = 3
Query:   93 SKRNINECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLI 656
            S+ +  E F  + D+ V+  E  LK     I+ +C+++YF +     Q+L RA+L +AQL  P+  +     +  +   +KAINF+K E R+++L++N++++Y+ +VR +L+P ++  +  SLS I   L +  + + ++R++LML L++C++ AG +++  +     A F+    P+  + + +T++
Sbjct:   36 SELDPTESF--SPDLFVLCAEQALKMKEPEISEDCIQMYFKVKAPITQFLGRAHLCRAQLCAPQSEENVEEFENCVTQYMKAINFAKGEPRYYFLVFNASVLYWNMVRPFLKPGYHHLVIPSLSQIITVLNQTEEEDKEWRAELMLELLECYLQAGRKEDATKFCLTAAPFVRTQVPHKYRQMFSTMV 221          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Mouse
Match: Cfap46 (cilia and flagella associated protein 46 [Source:MGI Symbol;Acc:MGI:2444387])

HSP 1 Score: 135.576 bits (340), Expect = 1.244e-33
Identity = 97/362 (26.80%), Postives = 166/362 (45.86%), Query Frame = 2
Query: 1406 LQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVH-GKFTKTFSWENV--------VTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSF 2464
            +QKA+ LD    Y + I+    +L++   LY+ P  P D+A   +EQ +     +     K R +L   G  LAPD F ++LD        EN+  V  GK    F++           V +   +L R G  +DK ++ +W +L K++ +  +WD+CR AS F +LYD+        +K + S++           ++      V    MS+   +D ++++                  ++   LL ++ +  FI AEA +  LR+EG QL      P+DL +HP G++ +    + EW +Y   +E LS   +  ++RAA +  +L   W  QNA  Y+ N++ H++       LV S 
Sbjct:    1 MQKAMRLDSLGIYRDKIKITYRRLQLGTMLYQSPDRPEDKATMAIEQAKKATPKD--SARKKRAILVNAGLALAPDTFQIVLD-------SENESKVSIGKIKGRFTYLCAKARHHILSVDKAAGHLRRLGYENDKDRIVIWAELAKVAWQQDVWDVCRTASRFCLLYDN--------VKAKRSTK-----------LKRGRKKKVIEGSMSDWAPSDMAMHK------------------QMPPDLLRKIAKVLFISAEATVHLLRSEGVQLNNQAIPPEDLSQHPAGYVPEPPESNSEWITYRTWIENLSQYAMNNWMRAAEIGQELGESWIVQNAVVYVLNHNRHLILAGRQKELVESL 316          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Mouse
Match: Cfap46 (cilia and flagella associated protein 46 [Source:MGI Symbol;Acc:MGI:2444387])

HSP 1 Score: 121.709 bits (304), Expect = 3.491e-27
Identity = 98/343 (28.57%), Postives = 167/343 (48.69%), Query Frame = 2
Query:  917 EQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVH-GKFTKTFSWENV--------VTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIK 1918
            E++  LL EL ++ L          C+  +++M +E+   LL E + +  EL  +   S  +      ++ +L  I++    L   IR  N   I + C + WNICLP+LQ +L   +   L  +A+ LE +  L   L  QVH+E+       +++  AI+++QKA+ LD    Y + I+    +L++   LY+ P  P D+A   +EQ +     +     K R +L   G  LAPD F ++LD        EN+  V  GK    F++           V +   +L R G  +DK ++ +W +L K++ +  +WD+CR AS F +LYD+ + K   ++K
Sbjct:  287 EEKILLLFELGRLCLTLKNEPIASDCLQYLKKMETEDTGKLL-EMEGLECELDALRLGSKLKMYLRGAVEEQLLIIKRMDNILQRAIRLGNPTTIHVLCTAQWNICLPLLQHNLRHHLRKPLTNIAEILEKVDSLMILLRCQVHMEMAYIEQDDDRVEPAIEHMQKAMRLDSLGIYRDKIKITYRRLQLGTMLYQSPDRPEDKATMAIEQAKKATPKD--SARKKRAILVNAGLALAPDTFQIVLD-------SENESKVSIGKIKGRFTYLCAKARHHILSVDKAAGHLRRLGYENDKDRIVIWAELAKVAWQQDVWDVCRTASRFCLLYDNVKAKRSTKLK 619          

HSP 2 Score: 112.464 bits (280), Expect = 2.555e-24
Identity = 50/181 (27.62%), Postives = 107/181 (59.12%), Query Frame = 3
Query:  126 ATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSI 668
            + D+ V+  E  LK     I+ +C+++YF +     Q+L RA+L +AQL  P+  +     +  +   +KAINF+K E R+++L++N++++Y+ +VR +L+P ++  +  SLS I   L +  + + ++R++LML L++C++ AG +++  +     A F+    P+  + + +T++   +
Sbjct:   45 SPDLFVLCAEQALKMKEPEISEDCIQMYFKVKAPITQFLGRAHLCRAQLCAPQSEENVEEFENCVTQYMKAINFAKGEPRYYFLVFNASVLYWNMVRPFLKPGYHHLVIPSLSQIITVLNQTEEEDKEWRAELMLELLECYLQAGRKEDATKFCLTAAPFVRTQVPHKYRQMFSTMVRYEV 225          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Mouse
Match: Cfap46 (cilia and flagella associated protein 46 [Source:MGI Symbol;Acc:MGI:2444387])

HSP 1 Score: 108.227 bits (269), Expect = 1.908e-25
Identity = 46/162 (28.40%), Postives = 100/162 (61.73%), Query Frame = 3
Query:  183 IANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSI 668
            I+ +C+++YF +     Q+L RA+L +AQL  P+  +E    +  +   +KAINF+K E R+++L++N++++Y+ +VR +L+P ++  +  SLS I   L +  + + ++R++LML L++C++ AG +++  +     A F+    P+  + + +T++   +
Sbjct:    6 ISEDCIQMYFKVKAPITQFLGRAHLCRAQLCAPQS-EENEEFENCVTQYMKAINFAKGEPRYYFLVFNASVLYWNMVRPFLKPGYHHLVIPSLSQIITVLNQTEEEDKEWRAELMLELLECYLQAGRKEDATKFCLTAAPFVRTQVPHKYRQMFSTMVRYEV 166          
BLAST of cilia- and flagella-associated protein 46 vs. UniProt/SwissProt
Match: sp|Q8IYW2|CFA46_HUMAN (Cilia- and flagella-associated protein 46 OS=Homo sapiens OX=9606 GN=CFAP46 PE=2 SV=3)

HSP 1 Score: 238.424 bits (607), Expect = 4.199e-61
Identity = 192/759 (25.30%), Postives = 345/759 (45.45%), Query Frame = 2
Query:  914 NEQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILD--HDLSMKEGENDKDVHGKFTK--TFSWENVVT--RINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPV------FLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQIT 3154
            +E++  LL ELA+ SL     +    C++ +++M S++   L+ E + +  E   +  ES  +    A ++ +L  I++    L   +R  + R+I + CA+ WN CLP+LQ +L   +   L  VAD LE +  L   L  QVH+E+ +     +++  A ++L+KA  LD    Y + I+    +L++   LY+ P    D+A   +EQ +     +   + K R LL   G  LAPD F ++LD  ++  +  G+N     G+FT     +W + V+  +   +L R GN +DK ++++W +L K++RK  +WD+CR AS F +LYD+ + K   ++++    R+G +  G                        D S+ +   + E        + Q ++   LL +  E  FI AEA +  LR+EG +L      P+DL +HP G++ +    + EW +Y   +E LS   +  +LR+A +  ++Q  W  QNA  Y+ N++ H++       LV +   +   ++   +     ++      LA G+I  ++P+        F+  N F SP     LD  A                         ++ K A+++C++ +++T+   P                          T+   T+ QLI  WV+ KQLLQQ +G  LGT++         + R + +++M + C         + S+   ++    C+W +  V L  L +L    
Sbjct:  286 SEEKMLLLFELARFSLTLKCMEISSACLSDLKKMESKDPGKLI-EMECLECESEALRLESKMKVYNRAAVEAQLDIIQRLDVALQRAVRLGDPRVIHVVCATQWNTCLPLLQHNLRHHLRKPLAGVADVLEKLDSLMTLLRCQVHMEMAQIEEDEDRLEPATEHLRKAARLDSLGLYRDRIQMASTRLRLCTTLYQAPERAEDKAIMAVEQAKKATPKD--SVRKKRALLVNAGLALAPDAFQIVLDSENEAKVSTGKN----RGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQGVWDVCRTASRFCLLYDNVKVK---KLRL----RRGKKKRG-----------------------RDGSVQDTWSQPE-------VVLQRQVCPDLLRKFAEVGFIHAEATVHLLRSEGVELNDRAIPPEDLSQHPAGYVPEPPEVNAEWITYRTWIESLSRCAMNNWLRSAEIGQEIQEAWIVQNAVVYVLNHNHHLILAGRQKELVDALYHLLSIVKATGHSGDPVMLVTLCNTLARGLIISWIPVQAAEKSRKFMRPNAFHSP-----LDAGA------------------------TSEIKTAVEVCEFALNLTNGSAP------------------------EETVPTGTRQQLIATWVKAKQLLQQQIGPRLGTEEQGTNEDVSSVTRVLVALEM-YSCNGLGLMDFTVPSLAQLVKMASECNWSDPLVELQTLTRLTHFA 946          

HSP 2 Score: 129.798 bits (325), Expect = 2.987e-28
Identity = 260/1198 (21.70%), Postives = 469/1198 (39.15%), Query Frame = 2
Query: 4727 LPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSPFVIP-EYCAHVEIIKANLEEYKKQNKSQVLP-MNFETQSTLPLKLSHLN-------------RKLTKFGYIHETWIKIAWILVEIGYNQEA----SEVICVAEELSKMLND--------EKMNTECNLLKAKLMINQGE---------------FDEALLYIDAIGS----CHFTFKQWSEIIDLLIEIGTDQANE----HGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLIVIEKCLEIYQ--IIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESK--EWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEH-SLNQQFLYCAFIDTKHKTANLSKPNNKPAAIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIFEKLGNFFP-----------PGNERNSPSNQKANKETISQPGK---------DSIIILTDEILSVASLESIPKLK----SSISRDFSLQVLHHRLKGMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTK-IIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQ--ITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKER 8074
            LP S EEW+ +   ++ L  +       +     I  P    +    D L++ L +     LT P+L +   IS  D  V +K L+   HLR       +  ++A   HE+ +    V   E  +  + I    E+ K+    + LP +N +T    P ++  L+             R L    + H  W+  A +L+E+   Q A    SE     +EL +   +        +  N E N  +AK MI Q +                 EALL ++  G     CH     + ++I+    +  ++ N        I+ +  R L ++     RVA+     +      L+ +M+ GLL ++R+   +D G   N  +V ++  A + +L       E  K+  YL    + +  + +   +++       L    +   E  L   Q  +   D+  V         N P+ RKL R KL L +  ++M     E+      Q   +  L +++ +Y++    D  S   +W  +   +     + L  +  +     +I A+ L   G  + L AM+  P     +      +   L   KS  + +++    K   +        E+  +  +        K +M+  + YL QA E++ Q + +++     D    A+  +++  G  D   + Q L L Q+   +  MR++LL      S  QLAA +LQ  + +R   R     T  SL   V+++L +   AW+   V+     LL ++    + +++F H S ++  LY A  +   K   ++    K  A+G   K+ R+A SP+                             F   +    +   QT+ Q  + E  ALN   +   L++EE    + + L   LGP+ E L   FP           P    +S  ++  +KE  +  G+         D I+++ D  L    LE +        SS+SR+FSLQ+L +RL        V         K+ +S+ P +    R + KK  K  IP  R +P   + +D++  +F+VDP +++      +  S     +T  +L   Q   T RW G +G    P+  + E  L   +   +   E+F+S    + L+ +N  + Q     D   + ++ +R
Sbjct: 1417 LPMSIEEWASYSCPEEVLSVLKQDRSDSTVNPSSIQKPTYSLYF--LDHLVKALQKMCLHELTVPVLQLGVLIS--DSVVGSKGLSDLYHLRLAHACSELKLREAAARHEEAVGQVCVSELEQASCRKEIALKKEKNKEPLLEESLPALNEQTLPVQPGEIKPLDAKDKILKMNGETGRDLDGTSFPH-LWMLKAEVLLEMNLYQPARLLLSEAYLAFQELDEPCAEAQCLLLLAQLANKEKNYGQAKKMIAQAQHLGGSEEFWYNSTLTLAEALLSMEHSGREATVCHI----FQKLINAFKILKKERPNRLPLLEFMITDLEARCLSLR----VRVAQHSAVTEPTECSLLLKEMDDGLLEIERKF--IDCGCKENCVDV-KLERAKIKRLRAQNEKDEEQKTAYYLEAYGLAQGAVAEEEGRLHSIQGLYGLAQGAMAEEEGRLHSVQGLLSLQDLQNV---------NTPLMRKLARLKLGLVEMALDMLQFIWEEAHG---QQSEQGSLEKLLADYLQNT-SDYTSVGLQWFTLKRTLAHGALAQLGSLQPLSVGCVEIRARLLGLAGRALHLLAMQADPVHPTCYWEAGPSVGAKLSGLKSLELEVEEEGATKSSRDPPASRAAPEEHCRRGED------LKRRMVLAQQYLAQASEVLLQCLQVALGSGLLDVAAAASLEMVECVGTLDPATTCQFLALSQSCSASETMRDVLLAATANTSSSQLAA-LLQLQHQLRCQDR-----TTTSLGARVEQRLAAVSKAWQNLCVTEQHFNLLNEMP--PTFWILFLHLSGDRSRLYGAAYE---KPKFITAAKGKVQAVGGSCKVMRLAISPT----------------------------AFSHLLACAQQFRKQTQAQ-VYSEDMALNIGSEPEGLQVEEKERPV-QRLSSVLGPLEELLQPLFPLLSLSKARVQTPAVVADSGKSKGKDKERKTSTGQHSTVQPEVADKIVLVADRHLLELPLEGLSVFDEGTISSVSREFSLQMLWNRLHKEETEGGVK--------KEGRSRDPKK----RSLAKKGRKGSIP--RTIPPDCIIVDSDNFKFVVDPYEEAQGPEMLTPVS-----ITQDILERFQDTFTSRWAGHLGSKHFPSQAQWEQALGSCSGFFFYGMESFLSHILVERLVAMNLQECQVAVLLDLARSYQSLKR 2519          

HSP 3 Score: 122.479 bits (306), Expect = 5.779e-26
Identity = 56/214 (26.17%), Postives = 120/214 (56.07%), Query Frame = 3
Query:  126 ATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDD 767
            + D+ V+  E  LK     ++ +C+++YF +     Q+L RA+L +AQ+  P+  +     +  +   +KAINF+K E R+++L+YN++++Y+++VR +L+P +  +L  SLS I   L +  + + ++R++LML L++C++ AG ++E  +     A F+  H P   + + + ++ + +    +     KN  ++     +  LK   +++D
Sbjct:   45 SPDLFVLCAEQALKMRQPEVSEDCIQMYFKVKAPITQFLGRAHLCRAQMCAPKSAENLEEFENCVTEYMKAINFAKGEPRYYFLVYNASVLYWQMVRPFLKPGYRHHLIPSLSQIINVLSQTEEEDKEWRAELMLELLECYLQAGRKEEAARFCSTAAPFIKSHVPQKYRQIFSVMVRHELMDELQLKEEKKNSISLSVTFYINMLKAKAEQND 258          

HSP 4 Score: 111.309 bits (277), Expect = 1.459e-22
Identity = 51/147 (34.69%), Postives = 86/147 (58.50%), Query Frame = 2
Query: 3743 EQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILL 4183
            E DL +R  ++  +F     Q+ W   LK LDEA+  LPRT H+L +F+H ++ K +L  +  +++QKFK + E+ +A +W  +A+ S S   +L  Y  +I++L+       KV+ +ME  QWL H  +P+E    ++ +A+ ILL
Sbjct: 1104 EDDLALRAALYGLLFHSHADQDDWEGGLKVLDEAVQVLPRTAHRLLIFKHMVIVKAKLGQNFSMEIQKFKAESEDYLARMWHRLALNSPSVSGELACYNNAIQALQKPEMEWQKVEYLMEFGQWLHHRHFPLEDVVFHLRWAVEILL 1250          
BLAST of cilia- and flagella-associated protein 46 vs. TrEMBL
Match: V4CMX4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237561 PE=4 SV=1)

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 659/2653 (24.84%), Postives = 1195/2653 (45.04%), Query Frame = 2
Query: 1046 EADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVHGKFTK----TFSWENVVTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKN------------------HFQ-IKIEN-----------SSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNST-----ESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLV-KITEKAVKVSPETHIGVVKRANKTNTNTGTVDAK-LALSFIYFCHGLCLHKTGQNTSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRLKLFLEPHTXXXXXXXXXXXXXKLPHILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLNTE----------ATKEKSLSHPNSSVKNRSRNNFRKPGSG--LKP-----NVKNENIQETPEMXXXXXXXXXXXXXXXPTWFFLQEF------------RPR----TLEDICDIRMLSKFVICLTTQAKLLGNSGGKSRDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTXXXXXXXXXXXXXXPNSEPVQSKTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMK-STGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSPFVIPEYCA------------HVEI------IKANLEEYKKQNKSQVLPMNFETQSTLPLK------LSHLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYIDAI-----GSCHFTFKQWSEIIDLLIEIGTDQANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLD---LGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIE---ISMEKLEIFDFLMKVNEKTNFK-SLLIKKLIVIEKCLEIYQIIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKE-SKEWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEHSLNQQFLYCAFID-TKHKTA--NLSKPNNKPAAIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIFEKLGNFFPPGNERNSPSNQKAN-----KETISQPGKDSIIILTDEILSVASLESIPKLK----SSISRDFSLQVLHHRL--KGMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGS-----------------------FFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNP---------------------PI---------------------------EEVPELIKNLSLTSPSESFIKS---NLVLYGLPNIAVS 8404
            E +F++ E+++       E     ++  RL ++++C+  ++N  R  +  ++++GC + WN+ LP+ QP+L   I  HL ++A++LE I  L  +L  Q+H E+       EQI  A+++++KA+ LD  + Y E +E  +H+L+++ +LY++P    D A  ++EQ R   N +   I   R LL + G  L+PD FL++LD +   ++  + K      TK       +   V ++  ++ R GN +D+ + RLW DL K +RK ++WD+CRVA+ F +LYDD RWK+                  HFQ + + N           S  K +R  GA+S ++   TS + +   +     D S+           L N         K LL  L E  FI  EA+I  LR+E  +L   P  P+D +K PKG++     ED +W  YC+ ++ LS      FLR   L V L   W   +AA Y+WNY+ H+L  + H  ++ +   + D LRQ+ +     ++ N    LA+ +I  ++P P          P  S + D+K K  +  P   TVG   +    T     E+    KKA+++C+Y + +T+                      + T  I   + I  +  L++ WV  KQ+  Q + + LGTDD     GQR + +A+ + +M  + +N   +F D +++ +  Q ++ C W E  + L L  KL  +    S     ++LV K +EKA++ +    +G   +  K + +   V+ + L+ +       L ++  G+N S+  Q ++  + +  YAR+  +Y LV   + ++W     L+ +      I + + +++ C++ T D  +                + E   +   I+ I  D K    +  K+  L           ++ DL++R  ++  +FQ +  + +W E++ ++D+AI D+PRT H+L +F+HR++ K RL   +++D+QKFK++ E+ VA +WR +A+ S     QL +Y+ +IE+L +  +N LK+D ++E SQWL+ + +PIE     +++A++ILLN +          +    +LS  N   K + R + +KP +    KP     ++K+E  +   E+  +       +     T FF+ +              PR    T+ED+ DI+ L          A++ G      +D L+ A   + R+WQV++++    +KE+ K  V     T++        KS     +  +   + PKRKGP D LP S EEW+ +++ D+ LEA   +   K     H ++ P +       + L E L   GY  L+ P+L+  D ++R       K ++   H++ L+    ++ +     HEK + +  +  E  A             V++      +K +L     + K +   +  +T ++ P K      + HL + L     + E W   A +L+  GYNQ A E +  A   ++   D+K+ +    +  +L  N+ ++ +      +      G   F FK    II+  ++   D  N++      ++ L  MK+   N++ E +         N +  + + L   + ++AT+    L        V ++M+  L   E+ E+  E      Y  E      +  ++   + +   +   K + L++ L V+++ + I + +F D   + +  +S + N P+ R+L   ++   + LI++  +  ++   + L    K  +  +V++Y+ E        K+W  +   + ++    L + H++   I  +  Q LL  G  + L    L+PN  +QW    M+    +    S+L   QD  + K I          E+T++  + S ++ + +     +R YL QA E + Q++ +S+ H  +    +A+  ++++ GQFD   + Q L LHQ+  T+  + ++L +        +L+A + QR+ ++      ++NL+  ++  SV   L   + AWK  +V  N LELLK+       F++ +HS ++ FLY A +D  KH +         +  +++  R KI  + TSP  +E+L   +R  K  +++L    E +      R  +   I+N  +      E +   A  Q+    + E + +++  ++ YL P+   L N        +SP+   AN     K+ +  P  + II+L D +L    LE++  L+    SS+SRDFSLQ+  HR   + +   DP         K   +  +  R+   R+  +K  K++PL+R +      +DT   R ++     +  +     G+                        F + +T     EQQ TPRW+GL GDD  P+  E E+YLKE++S I+   E  +S   P  L  +N  D   L C D  +T K+  R  +     S  DL  +    +A L SL G++  + NQW   +  N  ++   F   L+ G   G+ ++ + +P                     P                            E+VPE      +   SES IKS   NLV YGLPN+ ++
Sbjct:  391 ELEFLDCEMMVKVLGEKQESYQKVSVDTRLLSMKRCEEAIMNSKRQGDPNIVQVGCVTQWNLSLPLQQPNLRHHIRKHLTVIAEALEEINSLLVQLRCQIHTELSHCEEDSEQIQVAMQHIKKALSLDDGEVYRERLEVALHRLELRSELYQQPERAEDLAAMIIEQAR---NCDSGTIRMKRSLLVKAGEALSPDAFLLVLDSESETRDIASGKGPQTMITKLACKAQQFNKCVKKVEGHIKRLGNENDRERARLWADLAKTARKHEVWDVCRVAARFTLLYDDDRWKSVSEDRLSLIIEAQYLTKQHFQRVHMANTYYLVFSPVTVSREKESREDGATSEIEKKSTSRIGSRPTT----PDQSL----------PLYN---------KDLLRILAEVNFILGEAYIHLLRSEKVELNNVPIPPEDTRKRPKGYVAKKPEEDPDWLEYCDWIKMLSEMSTKSFLRGLELGVVLDEAWLVCSAAAYIWNYNNHVLAGNRHREILDTLSAVLDGLRQVGHAGETVMLVNICNALAYSLILPWIPAPA---PKEVQEPPTSPSPDEKGKDKK--PVRATVGTAKSKGGVTVTICSEAQPDLKKAIEVCEYGIQVTNG---------------------DNTRDI---VPISIRLPLLQTWVCVKQMALQQIPKTLGTDDETNMEGQRGMTKAIVATEMSALSKNGIMEFKDGINLTEITQLVENCRWTEKFIELQLWSKLTFL----SFDQKQHSLVLKCSEKALRFAV---VGTQPKNRKMDPHRAMVEQEMLSYTSCILGQSLMVNMAGKN-SIRRQAMEAFLNSARYARNAKNYGLVMSAARHYWNACVPLLNQPIERELIKEPVRVLLQCITATADSPK-------------KEDKEEKTGQGEGIVNIKGDNK----EEEKSSRLVG--------GIDDDLSLRAALYGLLFQAYADRGEWEESMVAMDQAITDMPRTKHRLLIFKHRVMVKARLGQDVQMDIQKFKDESEDYVAHMWRRVALSSKVTAEQLSSYQNAIEALTSVESNWLKIDYLLEFSQWLYVNQFPIEDSIDQVEWAVDILLNMKFESPLKKDALSDSTNNLSKDNKKEKKKGRMSAKKPKTPELEKPVIETVDIKSEKAESEKEIKAEDYVPVVKQADIGHTLFFVLDICVGPVFLCILGVLPRDMNLTIEDLTDIQQLDYLFRAHVILAQIHGRGSPCYKDTLLTAYSYLQRIWQVSITASGPTLKELAKVPV-----TETAMSGKNSAKSKGKKDKEKEVVKEKPKRKGPLDVLPVSTEEWANYDVPDEVLEAFKHEAMNKHGVNTHTLTKPLLTSHY--LEELTEELRALGYNHLSLPVLAFQDLMARG--IFNNKAMSNLYHIKSLEVCYELDIKTGCLFHEKAVGNMEISEEEQARSRDEIAIWKEKQVQVAREELRVKESLVRLATEGKIEKRSLTSKTMNS-PNKEEKLETVQHLGKVLGAVS-MREIWTLTAEVLIRQGYNQHAREYLHEANLAAQAFGDKKLESGILYILGQLAFNEAQYGQCFNLCRSAQNLQCGDEMFWFKSTMLIIEATLK---DYENKNNKRVARKIVLHAMKEF--NQIYEER--------PNRLSSICFILSSFEAKLATIQSTILMEGGRKSTVPKVMKGLLSACEKFENSIEKLLGLGYRREALPFIKQHADVLKHIAREAIEPEIKHTYLLQSLAVLKEGVAITEDLFADSLSLATLQDSRSMNSPLQRELVEIQIKCGELLIDILKLQSQEVRVQQLNDERKGSVLLLVEDYIRETPKYTHMEKDWVEIKQSVGEEAMLLLINSHSLAGNIIPLRTQSLLSIGKCLHLLGQSLHPNPPSQWLNKHME----MLKGSSELGENQDVESEKLI----------EETKQTIKYSYQIKQKQKLYESSRSYLLQACECLLQALNLSLNHHLFKLASSASLEMVELMGQFDPMAASQFLALHQSCETSVNLGSLLQRAQLDPVTSKLSALLHQRNNILDSDI--QTNLSSSTIMSSVNSALEKDWQAWKRLDVVSNHLELLKEFPP-NFNFIVLQHSPDRSFLYGAILDKPKHSSTGAGGKGGKHHSSSVPSRAKIFGVETSPKILEELVERFRFHKQSVQQLQLKQEYQRTQAALRNKMLKNIDNSIK-----QEAKVQTAEDQLEEQRLAEEFQQLVIAMETYLKPVINPLHNAL---RSTSSPTGSMANLAKEPKDHVVSP--ECIILLADPVLLEMPLEALECLQSESVSSLSRDFSLQMFSHRFHQEALAGEDPNTDKHKKKAKDAGQPMS--RIPGAREAKQKQAKLVPLDRPIQPWQFPVDTMNFRCILYHIDKALVNMRVLGGACMSCLFDHCYDDCAETEENKPVTLFNHLLT---EYEQQFTPRWLGLTGDDHSPSVGEWEVYLKESSSFIFYGMERLLSYIPPSKLAALNIPDCVMLFCLDMTQTNKSFLRQSKIDILKSHNDLSLEKPVESAMLSSLSGIRCLLANQWPCTLAENSHKLTLAFKDLLEKGKTTGQSVRLMMSPQKRANETRAEEEAKELEAASSPAGKGKDADKHDDKHPKGTTGTPDVGLESEKVPE------VPPESESQIKSSWFNLVCYGLPNVVIT 2893          

HSP 2 Score: 163.31 bits (412), Expect = 6.215e-36
Identity = 76/224 (33.93%), Postives = 135/224 (60.27%), Query Frame = 3
Query:  105 INECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKI---MKDKDD 767
            I+E     +D+ V+  E   +  +  +   CL+++F   P  NQ+L RAYL QAQLI P   +    L+K + +I+KAI  +K  +R+H+++YN+++IY++  R +L+P + QYL  SL  I K L++++D + ++R+QLM+ LI+CH+DAG R +   I    ATF+ ++ P + K +   +++N +    K     KN P +  + ++CK+K+   MK++ D
Sbjct:   41 IDETEAFNSDLYVLCAETAYQYGLTDMTRECLKMFFMKPPPANQFLCRAYLCQAQLIAPHDANNWAQLEKAVVYIVKAITIAKTNQRYHFIVYNASVIYWQFCRPFLKPGYRQYLATSLHQIVKALDDIDDQDFEWRAQLMIGLIECHLDAGRRSDASHIATAAATFIKQNVPAMFKQVFGLMVHNQLVETSKLHKDIKNSPELSVYYKICKIKLSLEMKEQKD 264          
BLAST of cilia- and flagella-associated protein 46 vs. TrEMBL
Match: A0A2T7P8L8 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09022 PE=4 SV=1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 615/2469 (24.91%), Postives = 1132/2469 (45.85%), Query Frame = 2
Query:  932 LLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVHG------KFTKTFS-----WENVVTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNS---------TESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKV-SPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCL-HKTGQNTSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKK--------RLKLFLEPHTXXXXXXXXXXXXXKLPHILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLNTEATK----EKSLSHPNSSV-------KNRSRNNFRKP-----GSGLKPNVKNENIQETPEMXXXXXXXXX----XXXXXXPTWFFLQEFRPRTLE---------------DICDIRMLSKFVICLTTQAKLLGNSGGKSRDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTXXXXXXXXXXXXXXPNSEPVQSKTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINS-------PFVIPEYCAHVEIIKANLEEYKKQNKSQVLPMNFETQSTL----PLKLSHLNRKLTKFGYI--HETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYIDAIGSCHFTFKQ-WSEIIDLLIE-IGTDQANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATL----------DLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFK-SLLIKKLIVIEKCLEIYQIIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEV-IPDKESKEWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSSNNKEIENNSYGLLENEDT-------EKNYQSSIKMSKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTKHKTANL---SKPNNKPAAIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVE-NKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIFEKLGNFFPPGNERNSPSNQKANKETISQPGKDSIIILTDEILSVASLESIPKLKSSISRDFSLQVLHHRL--KGMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINK---KSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLRE-QQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMIN 8011
            LL+ELA + L   +      C+ +++    ++    +Q  +F+   L++       E    + +  RL+ I++C+  ++N IR  +  +I+ GC + WN+CLP+LQP+L   IH  L L+A++LE I  L  KL  Q+H E+ K   + EQI  A+++L+KA+ LD    Y E +E  + +L+++ +LY +P  P D+A  ++EQ +   +  ++     R +L + G  LAPD FL++LD        END   +G       F+K  S     + + V++   +L R G  +D+ + RLW DL K +RK  +WD+CRVA+ F +LYDDGRWK      +   S K  R  G                     D  + + +E  ++     L+ N   +   ++ L+  L E  FI  EA +  LR+EG QL   P  P+   K PKG        D +W  YC  + +LS    + FLR   L VDL  PW   NAA Y+WNY+ HILT   H  ++     + D L+++ +     ++ N    LA  +IQ ++P          ++P        K +KD++   SK   +    Q            E+    KKA+++C+Y +++TS                               + I  +  +++ WV  KQ+ QQ +G+  GTDD     GQ+ + RA+ + +M+ +  N   +F D+ S+ D  Q ++ C W ++ + L +L +L  +      S+  N +++ ++ A+++ S  +H+       K + +   V  ++ L++     G  L    G   S+    ++  +    +AR+  +Y LV   + ++W     L+ +      + + I+ I++C++ T +KK        ++ L  EP        +  + E+K P       +  + T+DN                    DLT+R  M+  +FQ +  Q +   +LK++D+A+AD+PRT H+L +F+HR++TK +L  ++++D QKF+ + E+ VA +WR++A+ SN    QL +Y+ +IESL + SN   KVD ++E SQWL+++ +P++     +++AI+ILLN +  +    +K  + PN++        K   R   +K      G     +++  ++ E   MT+            E     T     +F P+  E               D+ +++ L   V      A+L G  G    D L+ A G ++R+WQV +      +K + +   E ++P K K  A +K  + +  SE  QS  K  +R+GP D +P   EEW+V+   D+ +EA   +  MK +GL+  + P     M   D L   L   GY  L  P+L+  D +SRS   +    LN  IH R L+  L ++ +     HE  + +        F   E  A  +  KA +   + + K  +     E+ S          SHL + L   G +   E W  +A +L+ +GY Q+A E +  A   ++  +D  +      L  KL   + +F +A  +  A    H   +  W E + LL+E +  D  N++      R   L++  H  N    +K++N++    N    +N+ +   + + A++          D+      ++V  + E     +E++  L    K+    + ++ E       L +   +   +    ++ L V+++   + + +F D   + S  ES   + P+ R+L        + L+E+ ++ V++     L  + K  + ++V+EY  +  +     K W      + ++  + L + H++   I ++  + L   G V+++ A    P+    W   + +IE   +   ++    + +   K  +   + L  ++D         KN Q  + M+K   Q   ++ Y   A E + Q ++++IA +           L+  FGQFD  L+ Q L L+Q+ +T+ ++  +L K  R  +  +LAA + Q   +IR +    +NL + ++  SV + L     AWK   +  N L++LK+       F+I +HS ++ FLY A ++    +      S P       G R KI  + T P  ++ +   +R  K  ++ L+   E  +TQ  +++  L +  ++    Q+  +E       I      +EE++  ++ +++ YL P+   +       + +++     +N+  I  P  D ++ L  E LS    + I     S++RDFSLQ+ +HR+    + E+  VD        KK K + P  L+  +  N+   K +K   + R +    +A++ N ++++VDP ++ S ++    G  F++     +L + +Q+T +W+G+ G+D  P+  E ELY+KE+++ ++   E  ++  SP  L  +N
Sbjct:  309 LLMELAHLCLDLDLGKVASVCVEEMKTCPVKDQSFCIQ-MEFLECLLMVKSLGENQESYQKSVVDLRLQAIKRCEEAIMNAIRHGDPSVIQAGCVAEWNLCLPLLQPNLRHYIHKTLSLIAEALENIQSLLIKLRCQLHTELAKCEESKEQIQVAMEHLKKALALDDGNVYQERLEVMLRRLQLRSQLYRQPERPEDQAAMIIEQAQKADSGSVL---MKRSMLVKAGEALAPDAFLLVLD-------SENDSRDNGTIKSPLTFSKKLSAKARFFNHYVSKAEGHLKRLGKENDRERARLWADLAKTARKQGVWDVCRVAARFCLLYDDGRWKGSLPRPM---SSKQERTKG---------------------DTKEKTEDETDKKAGSRPLTPNKPVE-LYDRDLVRMLAEVNFINGEAIVLLLRSEGVQLNDKPIFPESHSKLPKGKTVAKPENDPDWLEYCNWIRELSEASTSSFLRGLELGVDLMEPWLVCNAAAYIWNYNNHILTQMRHREILLPLTAVLDGLKRVGHAGETSMLVNICNTLAFALIQPWIP----------EAP--------KEEKDQDDLNSKNKLKVSVSQGKIKGSAVSLVPEATVDIKKAVEVCEYAINMTSR---------------------------EHIVPIAARKLILQTWVMSKQMAQQQIGKTFGTDDESSTEGQKEMTRAIVATEMLSLNSNGIMEFKDVPSIADVAQMVENCQWTDSLIKLQMLTRLTSLAYH---SHQHNLVMRCSKAALELASINSHM-----EKKGDIHQYMVKQEM-LAYASILQGQSLVDNMGGKHSLRRDAMEAFLGGASFARNAGNYDLVMTAARHYWNACIDLVSQPMERQLLKEPIKTILDCITATWNKKSKIEERVEQVALTEEPKI----DDINKKDEKKTP-----STETSISTIDNQS-----------------DDLTLRAAMYGVLFQSYADQGELEMSLKAMDQAVADMPRTKHRLLIFKHRVITKAKLGQNVQMDFQKFQGESEDYVAHMWRKVALCSNDLREQLSSYQNAIESLISPSNGFQKVDYLLEFSQWLYYNHFPLQDVLDQVEWAIDILLNMQDEEAMQLKKEGTKPNATTLDSKKLSKAAKRTEKKKSKELPLGKASVTSLQKISVTEGSGMTSTGREDKALDGRLEVSDQETEISAGDFVPQAKEVVIGVLPSNPGLKISDLTNVQQLDALVRSHILLAELTGQDGTCYADILLQAQGYLVRLWQVLIKEAGPVMKIVQQGHPE-QAPPKGKGSAKEKKSTKEQKSEVTQSSVK-ERRRGPLDVVPELIEEWAVYNAPDELIEAFQQE-SMKKSGLNVDTFPKPMLTMHYLDILTRQLRVLGYNHLALPVLAFQDLLSRS--MLINHSLNILIHARALEVCLELDLKAGCEFHELSMGNISISEKEQFQSREEIALWKEKKAQVAREEMRVKDSLARTTAESSSRAKDGRKTTASHLGKVL---GAVCQREVWADLAEVLIRLGYLQKAREYLNEANIAAEAFSDTTLQGHIMYLFGKLAFEEAQFGQATNFCKAAQEIHQGDEMFWFETMLLLVESVICDYTNKNR-----RHLALKLLAHAVNEF--LKITNER---PNRYATLNFIMTTFEAKAASVQMQIILDHHKDINSPVAMKSVLTVCEKLDNCVEKLIRLGHRRKA----VTLTTEHASYLIMLARAATEVQVEHGYYLEALSVLKEAASLAEQVFTDALTLTSLQESQTLSFPVQRELANVYACQGELLVEVAALQVKEMRSIQLAEQRKGSIIRLVEEYTHQSPLLSPTQKGWLSKRLTVFEEAMTVLINAHSLAGNITELKIKALAGLGKVLRILAEHKDPDPPPLWL--VWEIEQLYQNADTEETEQEATEAGKINDKQDHVLASDDDNTTETRRFSKNSQLILSMTK---QHEASKLYYVYATECLFQGLSLAIAKKHKALAGQIALDLVKCFGQFDPNLASQFLALYQSCQTSLKLEELLYKAQRDPTSSRLAALLHQHQTLIRNNI--STNLGKSNMMTSVLKLLEQDCQAWKQLEILPNHLDILKEFPQ-NFNFVILQHSPDRDFLYGAVMEKPKISGGGGGKSNPRVSTGPGGSRAKIFGVDTDPRVLQSIIEKFRQHKQNVQTLLLKQEYRRTQAIQRQRMLENTDDDSKLSQKGTVE-------ILDESQHLEEDFQNLVNDMENYLRPVIAAVDAALSLTSSKDA-----SNECFILLPDAD-LLELPLEALSCLQADGI----DSLTRDFSLQMFYHRMFSGAVTENAGVD--------KKKKQEVPQVLSRIQGANEPKGKQSKSNLVKRSVQPWQVAVENNNIKYIVDPYREGSETDERKPGDQFRH-----ILEDYEQLTHKWLGIYGEDHTPSVGEWELYIKESSTFLFYGFERLVAYLSPAKLSALN 2601          

HSP 2 Score: 149.058 bits (375), Expect = 1.612e-31
Identity = 77/229 (33.62%), Postives = 134/229 (58.52%), Query Frame = 3
Query:  111 ECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDD-----GSVIN 782
            E F Q  D+ V   E   ++ +K I  +CL+++F      NQ+L RAYL QAQL+ P+  ++   LDK + +ILKAI+ +K+  R+H+L+YN+++IY+   R +L+PNF Q+L +SL  + + L E +D + ++R++L + LI+C +DAG + +   I    A F+ ++ P+L K +   ++ + +  L K     K  P +  + R+C+LK   D  +     G +IN
Sbjct:   31 ELFGQ--DLFVQCAEIAFEHGLKDITRDCLKMFFLKQQPTNQFLIRAYLCQAQLLAPQDANKPEELDKAVVYILKAISLAKQTDRYHFLVYNASVIYWHFCRPFLKPNFRQFLAQSLHQVVQALGETDDQDFEWRAKLTISLIECLLDAGQKADASSISMVGAAFIKQNVPHLYKQIFGLMVRHQLVELTKLNKEAKTSPELIIYYRICRLKCSLDLQEVRDYQGEIIN 257          
BLAST of cilia- and flagella-associated protein 46 vs. TrEMBL
Match: A0A267H1S6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026945g4 PE=4 SV=1)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 601/2415 (24.89%), Postives = 1078/2415 (44.64%), Query Frame = 2
Query:  791 KILSSLTGVDEVSISSSSETLNTKPDQKSTIV--IPINSKKLT--NEQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGE------NDKDVHGKFTKTFSWENVVTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHF-QIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSM----------KQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAG-QNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDA-EIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKVSPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCLHKTGQN-TSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRL-KLFLEPHTXXXXXXXXXXXXXKLP------------HILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLNT---EATKEKSLSHPNSSVKNRSRNNFRKPGSG------------------------------LKPNVKNENIQETPEMXXXXXXXXXXXXXXXPTWFFLQEFRPRTLEDICDIRMLSKFVICLTTQAKLLGNSGGKSRDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTXXXXXXXXXXXXXXPNSEPVQSKTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGL--HEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSPFVIPEYCAHVEIIKAN---LEEYKKQNKSQVLPMNFETQSTL----------PLKLS---------------------HLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYI---DAIGSCHFTFKQWSEIIDLLIEIGTDQANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNS----DNLIGKMN--YGLL----LLDRRIATL-DLGRSRNWENVS-EMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLIVIEKCLEIYQIIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESKE-WRIVTNGICDKICSTLSDVHTICS---QIPDINAQCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKM----------------SKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTKHKTANLSKPNNKPA--------AIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIFEKLGNFFPPGNERNSPSNQKANKETISQPGKDSIIILTDEILSVASLESIPKLK----SSISRDFSLQVLHHRLKG 7576
            KI   L   D+V++ +     + K  Q ++      I++K+L+  + ++  LLLELA++++ +  FD   QC++ ++            E +F+N   ++ +     E      ++ R + IE+C   LLN  R      I+ GCA+ +N+ LP+LQP+L   +   L LVA SLE I  L ++L  QVHIE+ +  A LEQ+  A+++L+KA   D   EY E I     +L ++ +LY +P  P D A Q+LEQ  +  + + + +   R LLAQ+G  LAPD F   ++ + S   G       +   +H    K   +   + +I+ +L R G T+D+ + RLW DL + +R  ++WD+CRVA  F +LYDDGRWKN   Q K E  S+K  +     +     +    ++   +  D  DS   ++KR   +S   +++           + +  EK L+  L E  FI AE+ +  +R++G QL   P  PKD +K P+G ++     D +W +YC+ + +LS   ++CF+R+A L ++L  PW   +AA Y+WNY  H+L +    +L      + D LR+  ++   +++ N      +G+I++++P P+              +        ++    K   Q  A  Q S E V   K+A+++  Y +D+T+   P                           I +  +  L+++W+Q KQ+ QQ VG+ LG ++  +     R + RA  +V+M+W+ +N   +F +   V +  Q +  C W +  V L L +KLA I ++   +N +   +K ++KA+++      G  ++  +   +  TV  +  LS      G  L +  Q   +V  Q +   + AC +AR    Y L++  +  +W  +  L+ +      + + ++ ++  +S TVD+KRL KLF  P  +E      A  E+  P              +Q   +Q ++       LF  +     S   LE+DLT+R  M+  +FQ +  +    +  K++D+AIA +PRT H+L +F+HR+LT+ +L  S+ +D+QKF+N+ E++ A LWR +A+ S+  +SQL AYK +IE L    ++ LKVDL++E SQWL+ + +P+ELC+  +D+AI+ILL     E  KE      ++  K R +   + P S                               L    + E  QE  +               NP+   +  F       + + R L   + C    A+L   +    R  L  A  CV+R++QVA+ +   A +E  K+KVE +                    +  + + + PKRKG  D++P + E+W+ +++ D+ LE    +  M + GL  H I+ P I  +   C  L E L   G   L+ P+L++ D ++R  +   ++  N  +HL  +   L +N    +  HE      F   E    V+ +  N   L ++ ++ ++QV       + TL          P +L+                     HL  +L +   +H  W+++A +L E    Q A  ++   +  +  + D +          +L + + +F +A   +    A+     + + W     LLIE       +   +S+ +   LR     E      +L  Q+ N     D L+G++   +G L     LDR    L   GR+  W  V+   +   L +L        + + F+ L    ME   +       +++   + +L+             +    D      P +      P  R    AKL L+DCL+++  I V++   +     AK   T+ V+E+V+E     ES+  W        D     L D H++ +    +P   A  L   G  ++L A  L P+   QW   L+DI DP         +   ++        +    E++D+      +  +                 +A +   ++R  L QA E++ Q+  +++  +  D    A++ L++  GQFD  ++ Q L LHQ+  TA Q+R  L   LR +++ + AA + Q D +  +++    N  +  +  + ++ L  T  AW+ + V     ++ K L     GFL  +HS + ++LY   ++ +      +KP              +  R+ + R  TS  ++E L +  R FKS++  LV   E +     ++  +   I    + +R+    + L    + ++  ++  ++ ++ +  EY+GP   +      P +   + S  +  ++   QP  D +++L D  L+   LE++ +L     S +SRDFSLQ++  RL G
Sbjct:  270 KIYRQLLAEDDVTVQAPKGKKDAKKSQAASKADAPAISTKRLSQHSPEKPKLLLELARLAVDQGQFDLATQCLSAIKACPPLPDQHFYTEVEFLNCYFIVKKLGPNEESYAKPIVQLRQQAIERCHEALLNANRQGRPDTIQAGCATQFNLILPLLQPNLRNLVRKPLSLVAQSLEAIDSLQFRLRCQVHIELARIEADLEQVQPALEHLRKAASFDDFSEYREGIAAMQKRLLLRSELYREPDSPEDRACQMLEQAEAA-SGKAVGVRMRRALLAQVGLALAPDAFGAAMEAENSGAGGGGQPKLGDPTQLHLYAAKASQYRQSIDKISGHLKRLGATNDRVRARLWADLARTARSQEVWDVCRVACRFCLLYDDGRWKNPVPQAKPEGDSKKKKKQQHQQTSPDPTQPQQPQSGSGNASDDHDSDAEKSKRGSVDSRGGSDAFLDAASAAPATRPNLYEKELVRTLAEVGFICAESHVHLVRSQGVQLYERPLPPKDTRKLPRGQVRKDPEADPDWNAYCDWVTELSAFCLSCFVRSAQLGLELNEPWLVTSAAAYVWNYGQHLLAMGRQNLLAQHLLPLVDCLRRGGHDGRTELLVNVCTAAGYGLIREWLP-PLPKRQPAAGEGEDGADGAAAPAAKKKPGSGKAKPQAAAPVQISPEGVPDCKRAVEVTAYALDVTNGNRP------------------------EDAIAVGMRYPLLQVWLQAKQMCQQAVGKGLGAEEGLDSYDPPRQMTRACAAVEMLWLGRNGVMEFKEAPGVGEAAQMVTDCQWTDNLVALQLWVKLAFIALEMQENNLV---LKCSDKALQLDGHLDDGQQQQQPQIQQHRQTV-GREHLSLAASLKGQALMRLMQGKMAVRRQAMSAFLLACRHARQARSYQLIAAAARLYWNAAASLVGQPIERQLLLEPLQTMLEAMSATVDRKRLKKLFERPEGQEGSAAAAAPEEDDSPTDPEERRLEQKIQFVQSAPEQTVL------GLFPPAVSPPPSAKQLEEDLTLRANMYGVLFQAYADKGDLDKGSKAMDDAIASMPRTKHRLLIFKHRILTRAKLGQSVAMDIQKFRNEPEDKQAELWRIVALSSHGMKSQLEAYKNAIECLTLPEHDWLKVDLLVEFSQWLYTNGFPLELCTAQVDWAIDILLGMAFEEPVKE------DTDKKARGKARQKGPPSAASTVASQQSKKAAAAKSAATAGSAKDAAKTLPHQSEAEEKQEKDQQQMILPAEKRIVIGANPSAKPVASF-----SALFNARQLDNLLRCFCLLARLTTPASPAHRHALHAAHACVLRLFQVALPAGLTATREAAKTKVEEKPGGGGGKGGKGGKG----GGKEKEPQKEKPKRKGGLDFVPQTTEDWATYDVPDELLEVFRRQDLMPAAGLGRHNIAKPTITLYY--CRLLTEKLRNSGLSHLSLPVLALQDCLTR--DLCKSRPANCLVHLTAMDVCLELNLHKGVEFHE------FCAGELAPGVDELTENRKMLVQW-RERRAQVRREEARARETLAELARELGRDPAELTAAAGAVHGGGGDAEDDSLAGGHLGEQLGEL-QLHTQWLEMARLLTEQAQYQTARLLLREVQLTASEIGDRRCLAGALQELGRLALREKQFGQAAQCVRQAQAMMQGWASEEDWFLSCQLLIEATAGDYTKKDALSRAKTEALRSIAVFE------ELGRQRSNKASLIDFLVGRLELLFGRLQIAWALDRLSQRLCSRGRAHRWLEVARRFLHCGLERLTNGRDFRHALECFQQLGTCQMEMSRL------ASDEEGKRQMLVDAASCFRAATRYAEAFVADAQTSGPPGDLRKVCPPAHRLAAAAKLSLADCLLQLLEIQVDEERTQAELQLAKSADTKAVEEFVQETPRLTESQSAWMSKVRLAFDLAVGQLQDAHSLSAPGGPLP-TRAHSLALIGRALRLLASRLDPDSPAQWR--LLDI-DPSAWPAGDSGDTAAAAAAGTDAEVAEEAGEDKDSSATAVKTPPLVAAAAREREAKAARRTRQAWTAFQRSRDRLAQATEVLQQAQTVALHKDALDVASQASQELLECIGQFDLSIAWQQLTLHQSCETAKQLRRTLRLALRDSNLSETAALINQLDNL--EAEAAFCNGLQSRVAAAARDTLRRTSLAWRQSCVDHAHQDIGKSLPPFL-GFLALQHSPDCRYLYAGAMERQRA----AKPGKAAQSGAGAAGHPLQSRSFVLRRDTSKERLERLLDEVRDFKSEVGTLVLKHEYQRSQAAKQKRMLEAITAGVDGERSGSANQ-LTEEHKADLELLQTWFARLVADTAEYIGPALHRFERLNRPSSA-TTVSTSRREQQQQQQP-DDCLVLLIDPNLAELPLEALQQLHFDSLSGMSRDFSLQLVARRLFG 2595          

HSP 2 Score: 197.208 bits (500), Expect = 0.000e+0
Identity = 87/231 (37.66%), Postives = 149/231 (64.50%), Query Frame = 3
Query:   87 LISKRNINECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDDGSVI 779
            +++ +  NE      D+ V+L E  +KN +  I+  CLR+Y SLD   NQ+ ARA+L QA+L++P   +   AL+KPI ++LK I   +K  ++H+L++N++++Y E+VR +L+P+F ++LC+SLS + K LE ++D + ++R++LM +L++C+IDAG RKE + + +  A F+ K+ P   KDLL  +  NS+G   K  W+ +    +  + RLCKLK+   + D  V+
Sbjct:   33 ILADKKPNESLPIGFDIFVLLAEEAVKNGLDAISKECLRIYLSLDAPNNQFRARAFLAQAKLLQPTSSEHPEALEKPIAYVLKTIELCRKIPKYHFLVFNASVVYSELVRPFLKPHFRRFLCQSLSQVVKALEAIDDKDYEWRAELMKILLECYIDAGLRKESLLLAEQAANFVTKNVPGHFKDLLELISVNSLGEHGKLQWWIRGSAELAIYYRLCKLKVAIKERDAEVV 263          

HSP 3 Score: 122.479 bits (306), Expect = 1.870e-23
Identity = 70/219 (31.96%), Postives = 112/219 (51.14%), Query Frame = 2
Query: 7652 RLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMET-----RKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNP 8293
            R+   RD +KK +KIIPL R +P G +A+DT+ +R +VDP  D + +        F+  M     R QQ TPRW+G+ GDD  P+  E E+YL+E    I+   E F++   P  +  +   D + +  FD  +T     R++K  +V++S       LR +     A L++L GV +   +QWA  +  N   + TF +  L+ G  VG+ +  +  P
Sbjct: 2647 RIPGLRDASKKQSKIIPLVRPVPPGHLAVDTSHIRHVVDPYLDCAETEQWKPLDQFRAMMERPE-RAQQFTPRWLGVTGDDHAPSVGEYEVYLREGTGFIFYGMERFLAHVPPHAVASLGLTDCRLVALFDMAQTSQSFLRQSKIDVVKRSD-----QLRLEKPVETALLMTLAGVPALCCHQWASTLKENATRLGTFLADVLEGGKTVGQAVNFVYEP 2859          
BLAST of cilia- and flagella-associated protein 46 vs. TrEMBL
Match: A0A1W5BDM0 (cilia- and flagella-associated protein 46 OS=Ciona intestinalis OX=7719 GN=LOC100175618 PE=4 SV=1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 610/2513 (24.27%), Postives = 1130/2513 (44.97%), Query Frame = 2
Query: 1100 EKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDK----DVHGKFTKTFSWENVVTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEFYKF--PDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITV----KGSVSNSINTLVKITEKAV--KVSPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCLHKT-GQNTSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRLKLFLEPHTXXXXXXXXXXXXXKLPHILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLNT--------EATKEKSLSHPNSSVKNRSRNNFRKPGSGLKPNVKNENIQETPEMXXXXXXXXXXXXXXXPTWFFLQE------FRPRTL----EDICDIRMLSKFVICLTTQAKLLGNSGGKSRDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTXXXXXXXXXXXXXXPNSEPVQSKTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSPFVIPEYCAHVEIIKANLE------EYKKQNKSQVLPMNFET--------------QSTLPLKLSHLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYI---DAIGSCHFTFKQWSEIIDLLIEIGTDQANEHGD----ISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLIVIEKCLEIYQIIFDDIYRVCS---PLESSA-FNLPIDRKLCRAKLMLSDCLIEMFSITV-EDTAEKVLQHRAKDHLTQIVDEYV--EEVIPDKESKEWRIVTNGICDKICSTLSDVHTICSQIPD---INAQCLLKYGHVMKLRAMELYP-NKRNQWSRPLMDIEDPLETQKSKLVNLQDSSN--NKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRY---YLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGF--LIFEHSLNQQFLYCAFID----TKHKTANLSKPNNKPAAI---GDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQT---EIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIFEKLGN-FFPPGNERNSPSNQK-ANKETISQPGKDSIIILTDEILSVASLESIPKLKS----SISRDFSLQVLHHRLKGMGESDPVDAPXXXXXXXXXXXXXPH-----RLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPS 8347
            E  + ++++ RL  I++ +  L N +RS N+ +++  CA+ WN+CLP+LQ +L   +   L  VA +LE I  L   L  +VH E+ K   A+EQI  A+K++ KA+ LD    Y E ++  +H+L++  +LY  P  P D A  ++EQ R +  +E   +   R LL + G  LAPD F  +LD +   K     K    +V     +   W   V +   +L R G+ +D+ + RLWVDLVK +R+  +WD+CRVA+ F +LYDD RWK + + K E S ++G+++   S+    A  +             DS+    K      D    S   +  +  LL  L E ++I  EA I  LR EG +L   P+ P D ++ PKG       ++ EW  Y + +  L+ Q  + FLRA  L ++L+  W   + A YLWNYS H+L  S +  L   FQ +   ++Q+ +     ++     V+A G+I+ ++P    L  ++  + +A+T    + K   +S  +   G T       + ++  K+AL++C+Y + +T+                         +     I    + QL+  WVQ KQ+LQQ +    GT++ +I   QR + +++  ++M+ + +N+  +F  P++  V D    +D C W  + V L +  +LAQ++        V    N  + + +KAV  K + E    + KR         TV  ++ L++     G  L  T   N S   Q +   V +  +     ++ LV      +W  +  LI        + + +E+++  +S+        +  EP           +   K   ++++ D +   + +  +++ +       S      D T+R  M+   FQ F  + +W E L  +D A+  +PRT H+L LF+HR++ K +L  ++++D+ KF+++ E+ V+ +W  +A+ S     QL A++K+IE+L +      K + ++EL+ W++ +++ I+     +++A +IL+N         +   ++        VK  SR       +  KP++K +  ++TP       +     E          E        P  L    ED+   R L   +      A + G      R    +A   V+R+W+++++S  V +K + K +      T+    + K   +    + PV+ +    KRKGP D LPTS  EW+ +E  D+ ++A          G+++ +I   G  +     L E L +     L+ P+L +   I+R    + +    Q I+++ +     ++  +A    E +I++ F+  +      I K  LE      E  KQ + ++   N +                   P  ++   RK+     + E W + A +L+++GY Q    ++  A  ++   ND  +  +     A L  ++G   +A+  +    AIG        W E I LLIE  T   +   D    ++K+  R L   D         KLS  +   ++ IG +   L      IA     R     + +     +L KL + E   +     + L  I ME  +    L K N+++          + I + +++ Q   D++ R+C+   PLE+    +LPI R++   +L  S  L++   ++  ED   K  +  AK  L + V+ YV   E   ++ +  W         +  S L+ +HT   Q+P    + A+ +   G  ++L +  ++P + + QW     D+E  L  Q  + V ++ S+   +  +E  +    + +    + Q  +  ++AK+    + +    L+QA E+  Q I +SI  +  D V  A   +++   Q D Q +   L LHQ++ ++  M+ +++K++   S  QLA+ + Q  ++++      S L   ++ K + + L+  F AWK   ++ N L+LLKD+    S F  +I +HS +++ LYC  +D    +   T   SK  +K  +      R  + +I   P +  ++ +    F+ +L   +   E +      R  +  ++        I    LE++A      M  ++I E + +I+ ++++Y+ P+   +      P  E+   +NQ  +N + +S+   + IIIL    L    LE++  L++    S++RDFSLQ+LH R       DP +A +  + K+ D    P      + A  + +   + KI+PLNR+LP    +IDT+   ++VDPS + S +        F+  +    +  Q  TPRW GL G +  P+  + E  +   ++ I+   E FI+   P  +  +N ++ Q     D+ +T K+     +     +   L  +     A L+SL G      NQW    + N  ++ TF    L+ G+ VG+ +++I NP +++   +++ ++  +P+
Sbjct:   11 EAYSKSSVEVRLSAIKRMEQALENAVRSGNANVVQGACATQWNLCLPLLQRNLRKHVRRPLTAVAKALEDISSLQVTLRCRVHTELAKCEEAVEQIEAAVKHVNKALELDDSGFYHERLQTMLHRLQLSTQLYRTPDRPEDVAAIIIEQARKS--SESGSVRMKRSLLVKAGLALAPDAFQYVLDSENETKASGGMKGLVSEVQILGARARQWSKCVKKAPGHLKRLGDENDRERSRLWVDLVKTARQQHVWDVCRVAATFCLLYDDARWKVNPKEK-EPSEKEGSKDKRKSANTSKAPGTG------------DSASVAGK----SPDTDQGSTDSNLHDADLLRMLAEVHYINGEALIHLLRCEGLKLNESPDPPVDNRQRPKGHEYKKPEQEPEWAEYTDWIHHLNKQATSAFLRAIELGIELEETWIICSGAAYLWNYSNHLLVASRYTELAPMFQQVLFGMQQIGHSTEATLLVRICEVIAKGLIRPWIPKKSSLEGSVTQATTAATKDTSRKKTAGKSTGNTAPGTTAGLAVDPDGMDDVKRALEVCEYGLQVTNG------------------------SNQGDIISTSVRHQLLATWVQVKQMLQQQISPGFGTENEKIP-EQRDMTKSLVMLEMLSLNRNDMMEFTVPEISEVCDA---VDECSWNNSGVELEVWSRLAQLSRLQKNHSLVVRCSNNALALEQKAVNKKHTKEKQADIHKR---------TVALEM-LAYASCIRGESLMDTCAANPSARRQAMHSFVDSAKFGERAGNFSLVMMACRRWWNAALPLIPSPLERELLRQPLEVLL--ISILRTANNAAVVDEPE----------DSGGKEKGVVKVIDGEGDGSSNTKQSIGV-------SLGDPSDDRTLRSAMYGLQFQTFADKGEWEEGLVVMDRALHHMPRTKHRLLLFKHRVIVKAKLGKNVQMDIAKFRDESEDYVSHMWHRVALCSRETLEQLMAFQKAIEALHSDDTQWQKFEYLLELATWMYSNEFSIDDTVNIVEWAADILINMKFHVELPEQTQADRGKGKKGKMVKPASRAQPPPKTTESKPSLKQQ--KKTPASRQKKQDEPKKVEEKQEEQHLPVEREAIIGVEPNNLNVKFEDLHSTRQLDGLIRSHVMLATISGKGSKSHRTFCQLAYSFVMRLWKISLTSAGVVMKHLPKPETTAADDTRKGSGSKKAKATPA-QTAPVKERI---KRKGPPDALPTSTSEWATYEPPDEIIKAFLFDT--SDCGINKGTITCAGMTVFYLLKLSEYLRDCSLHNLSLPVLCLAAVITRG--ILQSDSWTQLINIQQITVCYELHLINAAEQWENWIDNKFLTEQ---EQTISKQELEIKQISKELAKQEEERIRKANGDALVQDTKTSSAKSTSSKREPGPITLTGRKVGGVN-LSEIWAQKAKVLLKLGYYQHCRSLLNEALTVANYNNDTVLLVDIYHGLADLATHEGNNGQAIQLLRKAQAIGGDELF---WQENILLLIEAITLNQDPSPDDVVKVTKVIRRSLECLD---------KLSATRPTKNSTIGYLKSIL------IARSSFSR---LASCTSQPAVYLRKLVDAERTLQDLGFHRELASIHMEHADALLKLSKQNKESQH--------VYILQAIKLLQTSVDNVTRLCNDVVPLETDKEVSLPIHREMMNLQLHFSSLLLDAAEVSANEDRLSKAAE-AAKGALERFVENYVGTAESELNETAMLWNAQRTTFVHRAMSVLNTMHT---QLPTQHVLRAKWMYLIGRSLRLCSEGVHPDDPKYQW-----DVEALLPEQMLRDVGIKSSTGFMSTSMEEVNEDPTQQQHDVTSRQMKLFSNEAKTLDSTSEFSYKLLSQATEVFAQCINMSIQLQAIDIVSLAALEMVECCAQHDPQTATLYLALHQSAESSKAMKELVMKSVSDPSTSQLASLLHQDSWLMKGYI--SSGLDNCTVKKDIMKLLSDKFTAWKRLQLASNHLDLLKDMP---SNFNIIIMQHSPDKRTLYCGILDKPKSSTSTTDGKSKGKDKQTSSQTDTSRAAVYKIHVDPEKYNEMMDQHSDFQQRLMSFLLQSEYQRSQLAMRQKMLQQLSKSATVISISETALEEQA------MEEMKIREEFGDILNDMEKYVEPLSSHIKTKLLQPIIEQ---ANQHLSNGQLLSELTPEMIIILAGPTLMQLPLEALKCLQTPHVDSVTRDFSLQMLHRRWF----VDPEEAAAAAEKKRNDLKTAPKTPKGGKDAGKKGVATPAAKIVPLNRELPPDCASIDTHSFHYIVDPSNECSETEQYRPAQVFQQLLQ---MYGQTFTPRWNGLFGTEVFPSVGQWEEMINNCSAFIFYGMERFIAQLPPAKVAALNLDECQLALLIDKSQTNKSFRHQSKVDVDKTNTLLSIEKPLQTAMLLSLSGANCVCLNQWHTTSESNAAKLHTFMECVLEQGLTVGQAIRKITNPTLKKPEPVVEEVAPITPA 2374          
BLAST of cilia- and flagella-associated protein 46 vs. TrEMBL
Match: A0A267GM73 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026945g3 PE=4 SV=1)

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 339/1169 (29.00%), Postives = 589/1169 (50.38%), Query Frame = 2
Query:  791 KILSSLTGVDEVSISSSSETLNTKPDQKSTIV--IPINSKKLT--NEQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGE------NDKDVHGKFTKTFSWENVVTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHF-QIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSM----------KQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAG-QNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDA-EIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKVSPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCLHKTGQN-TSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRL-KLFLEPHTXXXXXXXXXXXXXKLP------------HILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLN 4186
            KI   L   D+V++ +     + K  Q ++      I++K+L+  + ++  LLLELA++++ +  FD   QC++ ++            E +F+N   ++ +     E      ++ R + IE+C   LLN  R      I+ GCA+ +N+ LP+LQP+L   +   L LVA SLE I  L ++L  QVHIE+ +  A LEQ+  A+++L+KA   D   EY E I     +L ++ +LY +P    D A Q+LEQ  +  + + + +   R LLAQ+G  LAPD F   ++ + S   G       +   +H    K   +   + +I+ +L R G T+D+ + RLW DL + +R  ++WD+CRVA  F +LYDDGRWKN   Q K E  S+K  +     +     +    ++   +  D  DS   ++KR   +S   +++           + +  EK L+  L E  FI AE+ +  +R++G QL   P  PKD +K P+G ++     D +W +YC+ + +LS   ++CF+R+A L ++L  PW   +AA Y+WNY  H+L +    +L      + D LR+  ++   +++ N      +G+I++++P P+              +        ++    K   Q  A  Q S E V   K+A+++  Y +D+T+   P                           I +  +  L+++W+Q KQ+ QQ VG+ LG ++  +     R + RA T+V+M+W+ +N   +F +   V +  Q +  C W +  V L L +KLA I ++   +N +   +K ++KA+ +      G  ++  +   +  TV  +  LS      G  L +  Q   +V  Q +   + AC +AR    Y L++  +  +W  +  L+ +      + + ++ ++  +S TVD+KRL KLF  P  +E      A  E+  P              +Q   +Q ++       LF  +     S   LE+DLT+R  M+  +FQ +  +    +  K++D+AIA +PRT H+L +F+HR+LT+ +L  S+ +D+QKF+N+ E++ A LWR +A+ S+  +SQL AYK +IE +    ++ LKVDL++E SQWL+ + +P+ELC+  +D+AI+ILL 
Sbjct:  270 KIYRQLLAEDDVTVQAPKGKKDAKKSQAASKADAPAISTKRLSQHSPEKPKLLLELARLAVDQGQFDLATQCLSAIKACPPLPDQHFYTEVEFLNCYFIVKKLGPNEESYAKPIVQLRQQAIERCHEALLNANRQGRPDTIQAGCATQFNLILPLLQPNLRNLVRKPLSLVAQSLEAIDSLQFRLRCQVHIELARIEADLEQVQPALEHLRKAASFDDFSEYREGIAAMQKRLLLRSELYREPDSAEDRACQMLEQAEAA-SGKAVGVRMRRALLAQVGLALAPDAFGAAMEAENSGAGGGGQLKLGDPTQLHLYAAKASQYRQSIDKISGHLKRLGATNDRVRARLWADLARTARSQEVWDVCRVACRFCLLYDDGRWKNPVPQAKPEGDSKKKKKQQHQQTSPDPTQPQQPQSGSGNASDDHDSDAEKSKRGSVDSRGGSDAFLDAASAAPATRPNLYEKELVRTLAEVGFICAESHVHLVRSQGVQLYERPLPPKDTRKLPRGQVRKDPEADPDWNAYCDWVTELSAFCLSCFVRSAQLGLELNEPWLVTSAAAYVWNYGQHLLAMGRQNLLAQHLLPLVDCLRRGGHDGRTELLVNVCTAAGYGLIREWLP-PLPKRQPAAGEGEDGADGAAAPAAKKKPGSGKAKPQAAAPVQISPEGVPDCKRAVEVTAYALDVTNGNRP------------------------EDAIAVGMRYPLLQVWLQAKQMCQQAVGKGLGAEEGLDSYDPPRQMTRACTAVEMLWLGRNGVMEFKEAPGVGEAAQMVTDCQWIDNLVALQLWVKLAFIALEMQENNLV---LKCSDKALHLDGHLDDGQQQQQPQIQQHRQTV-GREHLSLAASLKGQALMRLMQGKMAVRRQAMSAFLLACRHARQARSYQLIAAAARLYWNAAASLVGQPIERQLLLEPLQTMLEAMSATVDRKRLKKLFERPEGQEGSAAAAAPEEDDSPTDPEERRLEQKIQFVQSAPEQTVL------GLFPPAVSPPPSAKQLEEDLTLRANMYGVLFQAYADKGDLDKGSKAMDDAIASMPRTKHRLLIFKHRILTRAKLGQSVAMDIQKFRNEPEDKQAELWRIVALSSHGMKSQLEAYKNAIECITLPEHDWLKVDLLVEFSQWLYTNGFPLELCTAQVDWAIDILLG 1402          

HSP 2 Score: 197.208 bits (500), Expect = 0.000e+0
Identity = 87/231 (37.66%), Postives = 149/231 (64.50%), Query Frame = 3
Query:   87 LISKRNINECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDDGSVI 779
            +++ +  NE      D+ V+L E  +KN +  I+  CLR+Y SLD   NQ+ ARA+L QA+L++P   +   AL+KPI ++LK I   +K  ++H+L++N++++Y E+VR +L+P+F ++LC+SLS + K LE ++D + ++R++LM +L++C+IDAG RKE + + +  A F+ K+ P   KDLL  +  NS+G   K  W+ +    +  + RLCKLK+   + D  V+
Sbjct:   33 ILADKKPNESLPIGFDIFVLLAEEAVKNGLDAISKECLRIYLSLDAPNNQFRARAFLAQAKLLQPTSSEHPEALEKPIAYVLKTIELCRKIPKYHFLVFNASVVYSELVRPFLKPHFRRFLCQSLSQVVKALEAIDDKDYEWRAELMKILLECYIDAGLRKESLLLAEQAANFVTKNVPGHFKDLLELISVNSLGEHGKLQWWIRGSAELAIYYRLCKLKVAIKERDAEVV 263          

HSP 3 Score: 183.341 bits (464), Expect = 5.934e-42
Identity = 250/1134 (22.05%), Postives = 473/1134 (41.71%), Query Frame = 2
Query: 4424 DIRMLSKFVICLTTQAKLLGNSGGKSRDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTXXXXXXXXXXXXXXPNSEPVQSKTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGL--HEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSPFVIPEYCAHVEIIKAN---LEEYKKQNKSQVLPMNFETQSTL----------PLKLS---------------------HLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYI---DAIGSCHFTFKQWSEIIDLLIEIGTDQANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNS----DNLIGKMN--YGLL----LLDRRIATL-DLGRSRNWENVSE-MMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLIVIEKCLEIYQIIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESKE-WRIVTNGICDKICSTLSDVHTICSQ---IPDINAQCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDP-------------LETQKSKLVNLQDSSNNKEIENNSY---GLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTKHKTANLSKPNNKPAA--------IGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIFEKLGNFFPPGNERNSPSNQKANKETISQPGKDSIIILTDEILSVASLESIPKLK----SSISRDFSLQVLHHRLKG 7576
            + R L   + C    A+L   +    R  L  A  CV+R++QVA+ +   A +E  K+KVE +                    +  + + + PKRKG  D++P + E+W+ +++ D+ LE    +  M + GL  H I+ P I  +   C  L E L   G   L+ P+L++ D ++R  +   ++  N  +HL  +   L +N    +  HE      F   E    V+ +  N   L +++ + ++QV       + TL          P +L+                     HL  +L +   +H  W+++A +L E    Q A  ++   +  +  + D +          +L + + +F +A   +    A+     + + W     LLIE       +   +S+ +   LR     E      +L  Q+ N     D L+G++   +G L     LDR    L   GR+  W  V+   +   L +L        + + F+ L    ME   +       +++   K LL+             +    D      P +   F  P  R    AK  L+DCL+++  I V++   +  +  AK   T+ V+E+V+E     ES+  W        D     L D H++ S    +P   A+ L   G  ++L A  L P+   QW   L+DI DP                  +     +++  +K+    S     L+     E+  +++ +  +A +   ++R  L QA E++ Q+  +++  +  D    A++ L++  GQFD  ++ Q L LHQ+  TA Q+R  L   LR +++ + AA + Q D +  +++    N  +  +  + ++ L  T  AW+ + V     ++ K L     GFL  +HS + ++LY   ++ +      +KP     +        +  R+ + R  TS  ++E L +  R FKS++  LV   E +     ++  +   I    + +R+      L    + ++  ++  ++ ++ +  EY+GP   +      P +     ++++  ++   QP  D +++L D  ++   LE++ +L     S +SRDFSLQ++  RL G
Sbjct: 1504 NARQLDNLLRCFCLLARLTTPASPAHRHALHAAHACVLRLFQVALPAGLTATREAAKTKVEEKPGGGGGKGGKGGKG----GGKEKEPQKEKPKRKGGLDFVPQTTEDWATYDVPDELLEVFRRQDLMPAAGLGRHNIAKPTITLYY--CRLLTEKLRNSGLSHLSLPVLALQDCLTR--DLCKSRPANCLVHLTAMDVCLELNLYKGVEFHE------FCAGEIAPGVDELTENRKMLVQWR-ERRAQVRREEARARETLAELARELGRDPAELTAAAGAVHGGGGDAEDDSLAGGHLGEQLGEL-QLHTQWLEMARLLTEQAQYQTARLLLREVQLTASEIGDRRCLAGALQELGRLALREKQFGQAAQCVRQAQAMMQGWASEEDWFLSCQLLIEATAGDYTKKDALSRAKTEALRSIAVFE------ELGRQRSNKASLIDFLVGRLELLFGRLQIAWALDRLSQRLCSRGRAHRWLEVARRFLHCGLERLTNGRDFRHALECFQQLGTCQMEMSRL------ASDEEGKKQLLVDAASCFRAATRYAEAFVADAQTSGPPGDLRKFCPPAHRLAAAAKQSLADCLLQLLEIQVDEERTQAERQLAKSADTKAVEEFVQETPRLTESQSAWMSKVRLAFDLAVGQLQDAHSLSSPGGPLP-TRARSLALIGRALRLLASRLDPDSPAQWR--LLDI-DPSAWPAGDSGDTAAAAAAGTDAEVAEEAGEDKDSSATSVKTPPLVAAAAREREAKAARRTRQAWTAFQRSRDRLAQATEVLQQAQTVALHKDALDVASQASQELLECIGQFDLSIAWQQLTLHQSCETAKQLRRTLRLALRDSNLSETAALINQLDNL--EAEAAFCNGLQSRVAAAARDTLRRTSLAWRQSCVDHAHQDIGKSLPPFL-GFLALQHSPDCRYLYAGAMERQRA----AKPGKAAQSAAGAAGHPLQSRSFVLRRDTSKERLERLLDEVRDFKSEVGTLVLKHEYQRSQAAKQKRMLEAITAGVDGERSG-SANHLTEEHKADLELLQTWFARLVADTAEYIGPALHRFERLNRPSSATTVSTSRREQQQ--QQP-DDCLVLLIDPNMAELPLEALQQLHFDSLSGMSRDFSLQLVARRLFG 2594          

HSP 4 Score: 122.865 bits (307), Expect = 1.371e-23
Identity = 72/226 (31.86%), Postives = 114/226 (50.44%), Query Frame = 2
Query: 7652 RLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMET-----RKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPE 8314
            R+   RD +KK +KIIPL R +P G +A+DT+ +R +VDP  D + +        F+  M     R QQ TPRW+G+ GDD  P+  E E+YL+E    I+   E F++   P  +  +   D + +  FD  +T     R++K  +V++S       LR +     A L++L GV +   +QWA  +  N   + TF +  L+ G  VG+ +  +  P     PE
Sbjct: 2646 RIPGLRDASKKQSKIIPLVRPVPPGHLAVDTSHIRHVVDPYLDCAETEQWKPLDQFRAMMERPE-RAQQFTPRWLGVTGDDHAPSVGEYEVYLREGTGFIFYGMERFLAHVPPHAVASLGLTDCRLVALFDMAQTSQSFLRQSKIDVVKRSD-----QLRLEKPVETALLMTLAGVPALCCHQWASTLKENASRLGTFLADVLEGGKTVGQAVNFVYEPYKRANPE 2865          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Cavefish
Match: ENSAMXT00000040417.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000591.1:11312:17800:-1 gene:ENSAMXG00000041134.1 transcript:ENSAMXT00000040417.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 1.035e-30
Identity = 63/171 (36.84%), Postives = 98/171 (57.31%), Query Frame = 3
Query:  204 LYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYL---------LKDLLTTLINNSIGTLEKYL 689
            +YF  +P  NQ+L RAY  QAQL  P        +DK + + LKAI  SK   R+H+L++N++L+Y++ VR +LRP   Q+L  SLS +   LE V +P+  +R++LML L++C +D+G  KE       T+ F+  H P +         L DLL +  + ++G L + L
Sbjct:    2 MYFETNPPSNQFLCRAYFCQAQLNSPHTVTTVEDMDKAVMYYLKAIEISKDYPRYHFLVFNASLLYFQTVRAFLRPGQRQHLVCSLSQVVSALEAVQEPDYAWRAELMLHLVECLVDSGKHKEAAAFSKVTSEFIEAHKPEMYPRIFSIQVLHDLLDS--SQTVGKLSRKL 170          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Cavefish
Match: ENSAMXT00000030730.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:12242508:12247413:1 gene:ENSAMXG00000038086.1 transcript:ENSAMXT00000030730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 3.915e-26
Identity = 53/130 (40.77%), Postives = 79/130 (60.77%), Query Frame = 3
Query:  141 VVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLML 530
            V+  E  L+   K IA +CL +YF  +P  NQ+L  AY  QAQL  P        +DK + + LKAI  SK   R+H+L++N++L+Y++ VR  LRP  +Q+L  SLS +   LE V +P+  +R++LML
Sbjct:   43 VLCSEQALQLGCKEIAEHCLMMYFETNPPSNQFLCHAYFCQAQLNSPHTVTTVEDMDKAVMYYLKAIEISKDYPRYHFLVFNASLLYFQTVRASLRPGQWQHLVCSLSQVVSALEAVLEPDYAWRAELML 172          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Cavefish
Match: ENSAMXT00000039877.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002288.1:158806:177299:-1 gene:ENSAMXG00000029056.1 transcript:ENSAMXT00000039877.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 3.350e-12
Identity = 60/246 (24.39%), Postives = 107/246 (43.50%), Query Frame = 2
Query: 7538 DFSLQVLHHRLKGMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRK---TKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVG 8266
            DFSLQV + RL+      PV++ +  + K         + A  +    K+ K+ P+N  LP  S+ +DT+  +++VDP  +  +    S     +  +    +   Q TP W G++G +   +  ELE  L   +S I+     F++   P  L  +N  + Q    FD ++        ++ VQ+S   SK  +  +     A L++L G  S + NQW+     N   ++      L    ++G
Sbjct:    9 DFSLQVFYTRLQ---RQQPVESDNKKETKGG-------KPAKGKGDQSKAIKVAPVNCVLPPHSLPVDTHNFKYIVDPYNEGGDCEWSSTAEIMRKTLQ---MYSHQFTPLWEGVIGSESTCSPTELERLLVNCSSFIFYGMGRFLAHIQPSRLATLNLAECQMAILFDLVQNSTLPCQSQQEVQESKFCSKTHVPLETPIQCAYLLTLCGAHSVMLNQWSSSARTNAQNMEAIMENLLKKKTDIG 241          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Cavefish
Match: ENSAMXT00000038776.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002288.1:158806:177388:-1 gene:ENSAMXG00000029056.1 transcript:ENSAMXT00000038776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 3.350e-12
Identity = 60/246 (24.39%), Postives = 107/246 (43.50%), Query Frame = 2
Query: 7538 DFSLQVLHHRLKGMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRK---TKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVG 8266
            DFSLQV + RL+      PV++ +  + K         + A  +    K+ K+ P+N  LP  S+ +DT+  +++VDP  +  +    S     +  +    +   Q TP W G++G +   +  ELE  L   +S I+     F++   P  L  +N  + Q    FD ++        ++ VQ+S   SK  +  +     A L++L G  S + NQW+     N   ++      L    ++G
Sbjct:    9 DFSLQVFYTRLQ---RQQPVESDNKKETKGG-------KPAKGKGDQSKAIKVAPVNCVLPPHSLPVDTHNFKYIVDPYNEGGDCEWSSTAEIMRKTLQ---MYSHQFTPLWEGVIGSESTCSPTELERLLVNCSSFIFYGMGRFLAHIQPSRLATLNLAECQMAILFDLVQNSTLPCQSQQEVQESKFCSKTHVPLETPIQCAYLLTLCGAHSVMLNQWSSSARTNAQNMEAIMENLLKKKTDIG 241          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002904.1 (pep scaffold:Pmarinus_7.0:GL476575:294585:302054:-1 gene:ENSPMAG00000002655.1 transcript:ENSPMAT00000002904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 9.706e-9
Identity = 24/80 (30.00%), Postives = 45/80 (56.25%), Query Frame = 2
Query: 3821 ALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLK 4060
            A+ +++ A++  PR NH+L L+R R+  K RL  ++EL+  +F+   E   A  W  +A+       QL  Y+ ++ +L+
Sbjct:  253 AMATVNHALSSTPRGNHRLPLYRRRVWLKTRLGQALELESARFREGGERACARAWLSLALAHPHPAQQLLCYRHALLALQ 332          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Nematostella
Match: EDO49124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW4])

HSP 1 Score: 172.94 bits (437), Expect = 4.825e-43
Identity = 104/344 (30.23%), Postives = 184/344 (53.49%), Query Frame = 2
Query:  923 RCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVHGKFTK----TFSWENVVTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKG 1942
            R  LL++LA++ L+    +   +C+  ++    +  + L  E +F+  EL++    +  E  +   ++ R+K I+K K  L+  IR     +I+ GC ++WN+CLP+LQP+L   +   L L+A +LE I  L   L  Q H+E+ K     +Q+  A+ +LQKA+ LD   +Y + +E  + +L+++  LY  P  P D A  ++EQ R++ +   + ++  R  L + G  L+PD F+ ++D +   K+    K       K       ++  V++   +L R G+ +D+ + R+W DL K +RK  +WD+ RVA+ F +LYD+GRW       I  SS +G
Sbjct:  254 RVPLLVDLARLCLENDCHELAAECLDSLRGPIKDLGMSL--EVEFMKCELMVKSLGNKKENYSKNVVEVRIKAIQKHKQFLITAIRRGIPNIIQAGCVTMWNLCLPLLQPNLRHHVRKQLTLMAQALEDIDSLLVVLRCQCHMELAKCEEDEDQLEYALTHLQKALSLDDSGQYRDRLETSLTRLQLRATLYRTPDRPEDLAAMIIEQARASDDASTVRMK--RASLVKAGEALSPDAFIHVMDSENDTKDPSGAKGPPTPLGKLAGMATQYQKAVSKAAGHLKRLGDENDQERARIWADLAKTARKQHVWDVTRVAARFCLLYDNGRW------SIRGSSGRG 587          

HSP 2 Score: 131.724 bits (330), Expect = 2.093e-30
Identity = 68/212 (32.08%), Postives = 124/212 (58.49%), Query Frame = 3
Query:  132 DMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDD 767
            D+ V+  E   K     +  +C++++F      NQ+L RAY  QAQL  P   +     DK + F+LKAINF+KK  R+++L+YN++++Y++  R +L+PN+ +YL KSL  + K L++++D +  +R+QLM+ LI+CH+DAG +++   + + T  F   + P L   +L   I   +  + K    TK+   +  F ++ +L+ + + +D
Sbjct:    1 DLFVLCAEAAYKLGKLDVMEDCIQMFFLKPVPSNQFLCRAYFCQAQLHAPSSSESPEQFDKSVEFLLKAINFAKKNPRYYFLVYNASVLYWQFCRPFLKPNYRKYLAKSLHQVVKALDDIDDKDYDWRAQLMIALIECHVDAGRKEDATLVSNATLQFTKSNVPSLYTTVLGLQIRYRLIDISKVSKETKSSNELYVFYKIQRLRTLIETED 212          

HSP 3 Score: 126.716 bits (317), Expect = 7.559e-29
Identity = 92/340 (27.06%), Postives = 157/340 (46.18%), Query Frame = 2
Query: 2153 AEAFIQALRNEGAQLLTFPERPKD-LKKHPKGFIKDTSN--EDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSAS-TNLDKKAKKDRESPKSKTVGQTGAGQNST----ESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQN---EFYKFPDLLSVNDCL--QY-IDLCDWEEASVLLNL 3130
                +Q LR +  QL   P  P+D +K  PK +     N  E  EW +YC  +  LS + ++ F RAA + V+L  PW   N+A YLWNY+ H+LT   +  +V  +  + D ++   ++    ++      +  G++Q +  +P   +     +PS    +   K  K R+S K    G + A         E  N+ K+AL++ +Y +++TS   P                           + +  +  LI+ WV CKQLL Q +G+NLG DD E    Q P+ +++ +++M+ +  N   EF + P L  V++ +  QY +  C      +LLN+
Sbjct:  585 GRGALQFLRTQNVQLGDKPIPPEDTVKLRPKRYEDQQVNLEEQPEWVTYCNWISSLSQEAISSFQRAAEIGVELNEPWLICNSAVYLWNYTNHMLTQGRYRDIVQIYTPVLDAMKATGHDGETILLCQLCNAICQGLMQPW--VPPLAVPTAPGTPSKEKPDKADKGAKGRQSGKGVKGGASKANVQGVTIDPEGTNELKQALEVIEYSLNVTSGTEP------------------------KNQVPVGVRHHLIKTWVFCKQLLNQQIGKNLGHDD-ESPQSQGPMCKSLCALEMLSLQGNGLPEFQQSPTLPEVSEIVVGQYRVAFCSIFLGILLLNI 897          

HSP 4 Score: 70.0922 bits (170), Expect = 1.301e-11
Identity = 26/73 (35.62%), Postives = 52/73 (71.23%), Query Frame = 2
Query: 3734 TSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFK 3952
            ++ +++L +R  M+  +FQ +  +  W + L+++D+AI D+PRT+H+L +F+HR++TK +L  ++  D+ KFK
Sbjct: 1050 SAYDEELMMRAAMYGVLFQAYADKCDWEQGLRAMDQAIKDMPRTHHRLLIFKHRVITKAKLGRNVLFDMGKFK 1122          
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Medaka
Match: ENSORLT00000044229.1 (cilia- and flagella-associated protein 46-like [Source:NCBI gene;Acc:105355713])

HSP 1 Score: 71.2478 bits (173), Expect = 5.953e-12
Identity = 94/398 (23.62%), Postives = 158/398 (39.70%), Query Frame = 2
Query: 7313 YSEIMENLQEYLGPIFEKLGNFF---PPGN----ERNSPSNQKANKETISQPGKDSIIILTDEILSVASLESIPKLK----SSISRDFSLQVLHHRLK----GMGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLRE------QQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQI-----------RNPPIEEVPEL--IKNLSLTSPSESFIKSNLVLYGLPNIAVS 8404
            + E+++++ +YL P+  +L NF    PP +       + S  + ++ + ++PG + ++IL D  L    LES+  L+    S +SRDFSLQ  + RL        ESD          K   K     +  A +    K+T + P+    P+ ++ +D     + VD                 + E  + ++RE      Q  T  W G           E E  L+  ++ IYV  + F+ +  P+ L  +N  + +    FD +  +             S Q L  Q+    A L+SL GV   V NQW   +  N     T     L    + G+ +Q +           RNP   +   L   K   +T    +F   N +LYGLP + ++
Sbjct:   63 FREVVQDMDDYLNPLLTQL-NFSCMRPPASPFQGSEVTKSKAEEDEASTAEPG-EGLVILADRNLLELPLESLSILQEEGLSFVSRDFSLQFFYSRLSPDKTQKAESD---------NKTDTKLSKGAKGKAHQSQGIKATPVGPVQ---PSLAIPVDIQNFHYFVDS----------------EGERCLPLMREVLETHMQPFTHLWGG-------SRVSETERVLRRCSAFIYVGRDRFVGIIPPKRLAALNLPECRLALLFDHVHKQAAPHSQSNHDPHKSMQRLALQEPVETALLLSLSGVSCVVLNQWPCSLQQNALNAATVLDELLRVRKSSGQTIQTLRGGVNSAEPHHRNPGWRDTGRLNNSKEDGVTGTPSAF---NCILYGLPYLTIT 420          
BLAST of cilia- and flagella-associated protein 46 vs. Planmine SMEST
Match: SMESG000014118.1 (SMESG000014118.1)

HSP 1 Score: 4263.76 bits (11057), Expect = 0.000e+0
Identity = 2146/2192 (97.90%), Postives = 2155/2192 (98.31%), Query Frame = 2
Query:  785 SKKILSSLTGVDEVSISSSSETLNTKPDQKSTIVIPINSKKLTNEQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEADFVNFXXXXXXXXXXNEKITPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVHGKFTKTFSWENVVTRINSYLLRSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVGQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFXXXXXXXXXXXXXXXXXXKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKVSPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCLHKTGQNTSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRLKLFLEPHTXXXXXXXXXXXXXKLPHILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLNTEATKEKSLSHPNSSVKNRSRNNFRKPGSGLKPNVKNENIQETPEMXXXXXXXXXXXXXXXPTWFFLQEFRPRTLEDICDIRMLSKFVICLTTQAKLLGNSGGKSRDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTXXXXXXXXXXXXXXPNSEPVQSKTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKFINSPFVIPEYCAHVEIIKANLEEYKKQNKSQVLPMNFETQSTLPLKLSHLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYIDAIGSCHFTFKQWSEIIDLLIEIGTDQANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLIVIEKCLEIYQIIFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESKEWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAIEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKLNSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTKHKTANLSKPNNKPAAIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEENYSEIMENLQEYLGPIF 7360
            +KKILSSLTGVDE SISSSSETLNTKPDQKSTIVIPINSKKLTNEQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQE    N                PATLKFRLKTIEKCKTTLLNVIRSENSRLIELGC SLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVHGKFTKTFSWENVVTRINSYLLRSGNTDDKRKM LWVDLVKLSRKVQLWDICRV+SCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLR+AALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTV QTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFPTETTNPVPSPNTNSNNNKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQN+FYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKVSPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCLHKTGQNTSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRLKLF EPHTEEEGPR+EAELEEKLPHILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLNTEATKEKSLSHPNSSVKNRSRNNFRKPGSGLKPNVKNENIQETPEMTNDTSNTDNNEELTNPTWFFLQEFRPRTLEDICDIRMLSKFVICLTTQ+KLLGNSGGKS DNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTKSKDKAAKKDKSAKPNSEPVQ KTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAI HHEKFINSPFVIPEYCAHVEIIKANLEEYKKQNKSQVLPMNFETQSTLPLKLSHLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYIDAIGSCHFTFKQWSEIIDLLIEIGTDQANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKL+VIEKCLEIYQI FDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESKEWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYGHVMKLRAMELYPNK NQWSRPLMDIED LETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQA+EMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNIL KTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSV EKLNSTFPAWKMTNVSLN LELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTKHKTANLSKPNNKPAA GDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQ EIQRAFLEKEALNANIQMNILEI+ENYSEIMENLQEYLGPI 
Sbjct:  265 AKKILSSLTGVDEASISSSSETLNTKPDQKSTIVIPINSKKLTNEQRCSLLLELAKISLQKSIFDACHQCITKVQQMASEEMLPLLQEFKREN---------------NPATLKFRLKTIEKCKTTLLNVIRSENSRLIELGCVSLWNICLPILQPSLVLKIHSHLVLVADSLEMIGCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEHFIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQIGHCLAPDDFLVILDHDLSMKEGENDKDVHGKFTKTFSWENVVTRINSYLLRSGNTDDKRKMSLWVDLVKLSRKVQLWDICRVSSCFAILYDDGRWKNHFQIKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRKEESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPERPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRSAALSVDLQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMVDIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESPKSKTVSQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFPTETTNPVPSPNTNSNNNKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDAEIKLGQRPIVRAMTSVQMVWICQNDFYKFPDLLSVNDCLQYIDLCDWEEASVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKVSPETHIGVVKRANKTNTNTGTVDAKLALSFIYFCHGLCLHKTGQNTSVLMQCLQLLVKACCYARDGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKKRLKLFFEPHTEEEGPRVEAELEEKLPHILQIGDDQKLITLDNNKALFLTSYRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPRTNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNSRESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYIDFAINILLNTEATKEKSLSHPNSSVKNRSRNNFRKPGSGLKPNVKNENIQETPEMTNDTSNTDNNEELTNPTWFFLQEFRPRTLEDICDIRMLSKFVICLTTQSKLLGNSGGKSTDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIESPTKSKDKAAKKDKSAKPNSEPVQIKTKVPKRKGPADWLPTSNEEWSVFEISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELLTFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIIHHEKFINSPFVIPEYCAHVEIIKANLEEYKKQNKSQVLPMNFETQSTLPLKLSHLNRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMNTECNLLKAKLMINQGEFDEALLYIDAIGSCHFTFKQWSEIIDLLIEIGTDQANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLLLLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEISMEKLEIFDFLMKVNEKTNFKSLLIKKLLVIEKCLEIYQIFFDDIYRVCSPLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHLTQIVDEYVEEVIPDKESKEWRIVTNGICDKICSTLSDVHTICSQIPDINAQCLLKYGHVMKLRAMELYPNKPNQWSRPLMDIEDLLETQKSKLVNLQDSSNNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAVEMINQSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQMRNILSKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVMEKLNSTFPAWKMTNVSLNSLELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTKHKTANLSKPNNKPAATGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLVFNVENKTQIFEQRINLYSEIENQIEIQRAFLEKEALNANIQMNILEIQENYSEIMENLQEYLGPIL 2441          

HSP 2 Score: 493.812 bits (1270), Expect = 1.251e-140
Identity = 236/240 (98.33%), Postives = 237/240 (98.75%), Query Frame = 3
Query:   87 LISKRNINECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDDGSVINEAKKFFPA 806
            LISKRNINECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDDGSVINEAKK   +
Sbjct:   32 LISKRNINECFEQATDMCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPNFYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQIVDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRLCKLKIMKDKDDGSVINEAKKILSS 271          

HSP 3 Score: 63.929 bits (154), Expect = 2.602e-9
Identity = 32/41 (78.05%), Postives = 32/41 (78.05%), Query Frame = -2
Query:    6 CLFKTFIYVSFRNQYLARAYLIQAQLIKPERFDEETALDKP 128
            CL   F      NQYLARAYLIQAQLIKPERFDEETALDKP
Sbjct:   68 CLRLYFSLDPQENQYLARAYLIQAQLIKPERFDEETALDKP 108          
BLAST of cilia- and flagella-associated protein 46 vs. Planmine SMEST
Match: SMESG000014116.1 (SMESG000014116.1)

HSP 1 Score: 472.626 bits (1215), Expect = 3.924e-152
Identity = 263/279 (94.27%), Postives = 264/279 (94.62%), Query Frame = 2
Query: 7577 MGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPSESFIKSNLVLYGLPNIAVSGSV 8413
            MGESDPVDAPSTTDIKKKDKSKTPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVDPSQDSSNSNSPSLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFL               +QKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPSESFIKSNLVLYGLPNIAVSGSV
Sbjct:    1 MGESDPVDAPSTTDIKKKDKSKTPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVDPSQDSSNSNSPSLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFL---------------LQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPSESFIKSNLVLYGLPNIAVSGSV 264          
BLAST of cilia- and flagella-associated protein 46 vs. Planmine SMEST
Match: SMESG000014116.1 (SMESG000014116.1)

HSP 1 Score: 471.47 bits (1212), Expect = 9.396e-152
Identity = 263/279 (94.27%), Postives = 263/279 (94.27%), Query Frame = 2
Query: 7577 MGESDPVDAPXXXXXXXXXXXXXPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVXXXXXXXXXXXXXLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRKTKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPSESFIKSNLVLYGLPNIAVSGSV 8413
            MGESDPVDAPSTTDIKKKDKSKTPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVDPSQDSSNSNSPSLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQ                IVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPSESFIKSNLVLYGLPNIAVSGSV
Sbjct:    1 MGESDPVDAPSTTDIKKKDKSKTPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFLVDPSQDSSNSNSPSLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTCELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQ----------------IVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNKWEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPSESFIKSNLVLYGLPNIAVSGSV 263          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CFAP468.744e-6225.30cilia and flagella associated protein 46 [Source:H... [more]
CFAP467.667e-2828.18cilia and flagella associated protein 46 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000034331.11.344e-3826.26pep primary_assembly:Xenopus_tropicalis_v9.1:7:193... [more]
fen12.982e-921.72flap structure-specific endonuclease 1 [Source:Xen... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cfap463.859e-8124.46cilia and flagella associated protein 46 [Source:M... [more]
Cfap461.244e-3326.80cilia and flagella associated protein 46 [Source:M... [more]
Cfap463.491e-2728.57cilia and flagella associated protein 46 [Source:M... [more]
Cfap461.908e-2528.40cilia and flagella associated protein 46 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8IYW2|CFA46_HUMAN4.199e-6125.30Cilia- and flagella-associated protein 46 OS=Homo ... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4CMX46.215e-3624.84Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7P8L81.612e-3124.91Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A267H1S61.870e-2324.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1W5BDM00.000e+024.27cilia- and flagella-associated protein 46 OS=Ciona... [more]
A0A267GM735.934e-4229.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000040417.11.035e-3036.84pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030730.13.915e-2640.77pep primary_assembly:Astyanax_mexicanus-2.0:25:122... [more]
ENSAMXT00000039877.13.350e-1224.39pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000038776.13.350e-1224.39pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002904.19.706e-930.00pep scaffold:Pmarinus_7.0:GL476575:294585:302054:-... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO491244.825e-4330.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000044229.15.953e-1223.62cilia- and flagella-associated protein 46-like [So... [more]
back to top
BLAST of cilia- and flagella-associated protein 46 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000014118.11.251e-14097.90SMESG000014118.1[more]
SMESG000014116.13.924e-15294.27SMESG000014116.1[more]
SMESG000014116.19.396e-15294.27SMESG000014116.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032947 ID=SMED30032947|Name=cilia- and flagella-associated protein 46|organism=Schmidtea mediterranea sexual|type=transcript|length=8424bp
CGATCTGGCTTGTCAAGAGCAGTTTCTTCATCAAATCTTTCTGGTTTTAT
TAATTGGGCCTGGATTAAATATGCTCTGGCTAAATACTGATTTCTAAACG
AAACATAAATGAATGTTTTGAACAAGCAACAGACATGTGTGTTGTCCTCG
GAGAAAATTGCCTTAAAAATGATATCAAAATTATTGCTAATAATTGTTTA
AGGCTATATTTTTCTTTGGATCCTCAAGAAAATCAGTATTTAGCCAGAGC
ATATTTAATCCAGGCCCAATTAATAAAACCAGAAAGATTTGATGAAGAAA
CTGCTCTTGACAAGCCTATCGGATTTATATTGAAAGCAATAAATTTTTCG
AAAAAGGAAAAACGGTTTCACTATCTCATTTACAATTCAGCACTGATATA
TTATGAAATCGTACGGAATTACTTACGACCAAATTTCTACCAATATCTCT
GCAAATCTCTCAGTTCAATATGTAAGACTCTCGAAGAAGTGAATGATCCG
AACATCCAGTTTCGCAGTCAATTAATGTTACTTCTCATTCAATGCCACAT
TGATGCTGGTCACCGGAAAGAAGTTATTCAAATAGTAGACGGAACTGCTA
CCTTCCTTGGCAAGCACTCCCCGTATTTATTAAAAGACCTCCTTACGACA
TTGATTAATAACAGTATCGGAACTTTAGAAAAATATCTGTGGTATACTAA
AAATCATCCAGCCATGCAAACATTTATTCGTTTGTGCAAATTGAAAATAA
TGAAAGATAAAGACGACGGTTCTGTTATAAATGAAGCAAAAAAATTCTTT
CCAGCTTGACAGGTGTAGATGAAGTTTCCATTAGTAGTTCTTCGGAAACT
CTCAATACAAAGCCTGATCAGAAATCTACAATCGTGATTCCCATAAATTC
AAAGAAACTGACTAATGAGCAAAGATGCTCTCTCCTGCTAGAACTTGCAA
AGATTAGCTTACAAAAGTCCATATTTGATGCATGTCATCAATGTATCACA
AAAGTTCAACAAATGGCTTCGGAAGAAATGTTACCATTGCTCCAAGAAGC
AGACTTCGTAAATTTTGAATTATTAATGATGGAATCTGAAAGTTTAAACG
AGAAAATAACCCCAGCTACATTAAAATTTCGATTGAAAACCATTGAGAAA
TGTAAAACGACATTATTAAATGTTATCAGATCAGAAAATAGTCGATTAAT
TGAATTAGGCTGTGCTAGTCTTTGGAACATTTGTCTTCCAATTCTTCAGC
CGAGTCTCGTGTTGAAGATCCACAGTCATCTGGTGTTGGTCGCTGATTCC
TTGGAAATGATTGGATGTTTAAATTACAAACTTTGTGCTCAAGTTCATAT
TGAAGTTGGCAAAGGATATGCCGCTTTAGAACAGATTAATGACGCCATCA
AATACCTTCAAAAAGCCATTTTATTGGATAGAAAAAAGGAATATACGGAA
TTAATAGAACATTTCATTCATAAATTGAAAATGCAAGAAAAGCTTTATGA
GAAACCTTTAGACCCTTGTGATGAGGCCAGGCAGTTATTGGAACAAGTTA
GATCGACATTGAACAATGAAATAATTCCAATTGAAAAATTGCGACCTCTT
TTGGCTCAAATCGGGCATTGCTTGGCTCCAGATGATTTTCTCGTGATTCT
CGACCACGATTTGTCAATGAAGGAGGGGGAAAATGATAAGGATGTCCATG
GGAAATTCACCAAAACATTTTCTTGGGAAAACGTTGTGACGAGAATAAAT
TCATATTTACTGAGATCGGGAAATACGGATGACAAGAGAAAAATGAGGTT
GTGGGTGGATTTGGTTAAATTATCAAGAAAGGTACAATTGTGGGATATAT
GTCGCGTTGCCAGCTGTTTTGCCATACTATATGATGATGGGAGGTGGAAA
AATCATTTTCAAATTAAAATTGAAAACTCTTCGAGAAAAGGTAACAGGAA
CATGGGGGCCAGCTCTGGAATGCAGAATGCAGAAACGAGCGCAGTGGAAA
CCAATCAAATGTCTGAGTTAGATGTCACCGATTCGTCGATCAACGAAAAT
AAACGAAGGAAAGAAGAAAGTGATTTGTCGAACAATTCCATGAAACAGAG
TCGATTGGAGAAAGTGTTATTGGAACAACTTACGGAAACCTATTTCATTA
GAGCTGAAGCATTCATTCAAGCCCTAAGAAATGAAGGAGCTCAATTATTG
ACATTTCCCGAAAGGCCGAAAGATCTTAAAAAACATCCAAAAGGTTTCAT
TAAAGACACTTCTAATGAAGATAAAGAATGGAAAAGTTACTGTGAATCTT
TGGAGAAATTGTCAAATCAAATCGTCGCCTGCTTCTTGCGCGCTGCTGCT
TTATCAGTGGATCTACAAGCGCCGTGGTTCACTCAAAATGCAGCTACCTA
TTTATGGAATTATTCCATGCATATTTTGACTCTTTCAGATCATGGGATTT
TGGTTTCGAGCTTCCAAACCATGTACGATTATTTGCGACAAATGATCAAT
GAGAAAATGGTTGACATAATTACGAATTATGGAATAGTTCTTGCGCACGG
CATGATTCAGAAATATATGCCGATTCCGGTTTTTCTATTGGATAATATTT
TCGACAGCCCATCAGCGTCAACAAATCTCGATAAGAAAGCCAAAAAAGAC
CGAGAATCACCAAAAAGTAAAACTGTTGGTCAAACGGGAGCTGGACAGAA
CTCTACTGAGTCTGTAAACCAATTTAAAAAAGCTCTTGATATCTGTCAAT
ATCTAATGGACATTACATCCGATGTTCCTCCATTTCCAACAGAGACCACT
AATCCAGTTCCAAGTCCCAACACCAACAGTAACAACAACAAAACAGCTCA
AATAAACCGAACAATTGACATTAAAACAAAGGGTCAACTAATAGAGATCT
GGGTCCAGTGCAAGCAATTGCTCCAACAGCCAGTTGGTAGAAATCTAGGA
ACCGATGATGCAGAAATAAAACTCGGGCAACGTCCGATTGTTCGAGCAAT
GACATCAGTACAAATGGTTTGGATTTGCCAGAATGAGTTTTATAAGTTTC
CAGATTTGCTCTCAGTCAATGATTGCTTGCAATACATAGATCTATGTGAC
TGGGAGGAGGCATCAGTCCTATTAAATCTATTAATGAAACTGGCACAAAT
TACTGTAAAAGGATCTGTTTCTAATTCGATAAATACCCTGGTTAAAATCA
CGGAAAAAGCAGTTAAAGTATCCCCTGAAACCCATATTGGTGTTGTGAAA
AGAGCAAATAAAACAAATACTAATACTGGGACTGTTGACGCAAAACTGGC
ATTGTCATTTATTTATTTCTGTCATGGTTTATGCCTCCATAAAACGGGCC
AGAATACATCTGTACTCATGCAATGCTTGCAACTATTGGTTAAAGCATGC
TGCTACGCAAGAGATGGAAACGATTACTTTTTGGTGTCACAAATATCTCA
CTATTTCTGGAGGATCTCTCAAGTTCTGATTAAAAGGTTCTCCAATACCT
GCCAAATAGCCAAGGAAATCGAGATCATCATCAATTGTCTTTCACTGACC
GTGGATAAGAAAAGATTGAAATTATTTTTAGAACCTCATACAGAAGAAGA
AGGTCCTCGACTAGAGGCAGAACTTGAAGAAAAATTACCCCATATTTTAC
AAATTGGCGATGATCAAAAACTAATCACTCTTGATAACAATAAAGCTCTC
TTTCTAACAAGTTACAGAAGACAAATGTCCAAGACAAGTTTAGAACAAGA
TCTAACAATTCGAATTCAAATGCACATTGCTATATTTCAATGCTTTTGCT
TTCAAGAAAAATGGACGGAAGCTCTGAAATCTCTAGATGAAGCCATTGCG
GATCTTCCAAGAACGAATCACAAATTAGACCTTTTCAGACATAGACTGCT
TACAAAGGTGCGGCTAAACCATTCAATTGAATTGGATGTTCAGAAATTCA
AGAATCAAAAAGAAGAGGAAGTGGCAACACTTTGGAGAGAAATTGCTATC
GTCAGCAATTCACGAGAATCCCAGTTATTTGCGTATAAAAAATCTATTGA
AAGTTTAAAAAATAAATCCAACAACTTACTGAAAGTTGACTTGATAATGG
AATTGTCCCAATGGTTATTTCATTCCGACTACCCAATTGAACTGTGCTCC
CAATACATTGACTTTGCCATAAATATTCTACTCAATACAGAAGCGACTAA
AGAAAAATCTTTGTCACATCCAAACTCTTCCGTCAAAAACAGATCGAGAA
ACAATTTTAGGAAACCCGGTTCAGGACTTAAACCCAATGTCAAAAACGAA
AACATTCAGGAAACTCCTGAAATGACCAATGACACTTCTAATACAGATAA
CAACGAGGAACTAACCAATCCAACCTGGTTTTTTTTGCAAGAATTTCGAC
CAAGAACCCTCGAGGATATTTGTGACATTCGGATGTTATCAAAATTTGTT
ATCTGCCTTACGACACAAGCAAAACTTCTAGGGAATTCAGGTGGTAAATC
TAGAGATAATCTCATTATGGCCAGTGGATGTGTCATACGCATGTGGCAAG
TTGCAATGAGTTCTTTGACTGTGGCAATTAAAGAAATAGGAAAATCCAAA
GTCGAAATAGAATCACCGACAAAATCCAAAGATAAAGCAGCTAAAAAAGA
TAAAAGTGCCAAGCCAAACTCAGAGCCTGTACAGAGTAAGACAAAAGTTC
CCAAACGAAAAGGACCGGCAGATTGGCTACCAACATCCAATGAAGAATGG
TCAGTGTTTGAGATTTCTGATGACGCATTGGAAGCAATAACATCCAAAGT
TTATATGAAATCCACAGGACTTCATGAAATTAGTATTCCCAATATCGGAC
AATTTATGGGTGCCTGTGATGCACTAATAGAAATGTTGGCTGAGCAAGGC
TATGAATTGTTAACATTTCCTATTTTGTCCATAATGGACGCAATTTCTCG
ATCAGATGAGACCGTTCCGGCAAAATTATTAAATCAGTATATCCATTTAC
GATGGCTTCAATTTTCGTTACGCATCAACAATCAAGATGCAATTTTTCAT
CATGAAAAATTTATTAATTCTCCGTTTGTTATACCAGAATATTGCGCCCA
CGTCGAAATAATCAAAGCTAATCTCGAAGAATATAAAAAACAAAACAAGT
CTCAAGTTCTACCTATGAATTTTGAAACTCAGTCTACTCTTCCATTAAAA
TTATCCCATTTAAATAGAAAATTGACAAAGTTCGGCTACATTCATGAGAC
TTGGATCAAGATTGCATGGATTCTTGTAGAAATTGGATATAATCAAGAAG
CATCTGAAGTGATTTGTGTAGCAGAAGAGCTTTCTAAAATGTTGAATGAC
GAAAAAATGAATACCGAATGTAATCTTTTAAAAGCAAAATTAATGATAAA
TCAAGGCGAATTTGATGAAGCACTTTTATACATTGATGCGATTGGTTCTT
GTCATTTCACATTTAAACAATGGAGTGAAATTATTGATTTATTGATTGAA
ATTGGAACCGATCAAGCAAATGAGCACGGGGATATCTCCAAGATCCGATT
GAGGCTGTTGCGAATGAAAGATCATACCGAGAACAGAGTTGCGGAAATTA
AATTATCCAACCAGCAGCTAAATAGCGATAATCTTATTGGGAAAATGAAT
TATGGCCTTCTGTTATTAGATAGACGAATTGCCACTTTGGATCTTGGACG
CAGTCGAAATTGGGAAAATGTCAGCGAGATGATGGAAGCGTTTCTCGGGA
AATTAGAAGAAATCGAATCCCTACACGAATCCAATAAAAGTTTCAAGTAT
TTAATTGAGATTTCAATGGAAAAACTAGAAATATTTGATTTCCTAATGAA
AGTCAATGAAAAAACAAATTTCAAATCGTTGTTAATAAAAAAATTAATAG
TAATTGAAAAATGTTTAGAAATTTACCAGATTATCTTCGATGATATCTAT
CGGGTTTGTTCTCCATTAGAGAGTTCTGCTTTCAACTTGCCGATTGACCG
GAAATTGTGCCGAGCAAAATTAATGCTCAGTGACTGCTTAATAGAAATGT
TTTCTATCACAGTTGAGGATACCGCTGAAAAGGTTTTGCAACACAGAGCT
AAGGACCATTTGACACAAATTGTCGATGAATATGTGGAAGAAGTCATTCC
TGACAAGGAATCCAAAGAATGGAGAATTGTAACCAACGGAATCTGTGATA
AAATTTGCAGTACTCTAAGTGATGTACATACAATATGTTCACAAATCCCC
GATATCAATGCTCAATGCTTGTTAAAATATGGTCATGTAATGAAACTTCG
AGCAATGGAATTGTATCCTAATAAACGTAATCAGTGGTCTCGGCCTCTCA
TGGACATCGAAGATCCTTTGGAAACACAAAAATCCAAACTAGTCAATCTG
CAAGATTCCTCAAATAACAAAGAAATTGAGAACAATAGTTATGGATTACT
AGAAAACGAAGATACAGAGAAGAATTACCAAAGTTCTATCAAAATGTCAA
AAGCAAAAAGTCAAATGATCCAAAACCGTTACTATCTGAACCAAGCCATT
GAAATGATAAATCAGTCCATAGCGATTTCAATTGCACACGAATTCTACGA
TTGCGTTGTCACAGCAACAGAATTATTAATTGACATTTTTGGTCAATTTG
ATTGTCAACTTTCCGGTCAACTCCTCTGTTTGCACCAGAACAGCCGAACG
GCAGCACAGATGAGGAATATTTTGTTAAAAACCTTACGCAAAGCCTCAAT
GGGCCAGTTGGCAGCGTTTGTGTTGCAACGCGACTACATGATTAGGAAAT
CCAAACGGGAAGAATCCAATTTGACTGAGTTCTCGCTGTATAAATCAGTA
AAGGAAAAACTTAACTCCACATTTCCGGCTTGGAAAATGACAAATGTGTC
ATTAAATCCTTTAGAACTGTTAAAAGATTTATCATATTTAACTTCCGGGT
TTCTAATATTTGAACACTCTCTGAACCAGCAATTCCTTTATTGCGCCTTT
ATTGATACAAAGCACAAAACGGCTAACCTCTCCAAACCGAACAATAAGCC
GGCCGCCATAGGTGACCGAACAAAGATCTGCCGAATAGCAACCTCTCCTA
GTCAGATAGAGGATTTACAAAACTACTGGCGGGGATTTAAATCGAAGTTA
GAAAAACTCGTCTTCAACGTAGAAAATAAGACCCAGATATTTGAACAGAG
AATAAATTTATATTCGGAAATTGAAAATCAAACAGAAATCCAAAGAGCTT
TCTTGGAAAAGGAAGCATTGAATGCAAACATTCAAATGAATATATTAGAA
ATCGAAGAAAACTATTCAGAAATTATGGAAAATCTCCAAGAATATTTAGG
ACCTATATTTGAGAAATTAGGAAATTTCTTTCCTCCTGGTAACGAAAGGA
ATAGTCCAAGCAACCAGAAAGCTAACAAAGAAACGATTTCACAGCCTGGA
AAAGATTCCATAATAATATTGACAGATGAAATTTTGTCAGTGGCGAGTTT
AGAATCTATTCCAAAGCTAAAATCATCCATTTCCAGGGATTTCAGTTTAC
AGGTCTTGCATCATAGATTGAAGGGCATGGGTGAATCAGACCCGGTGGAC
GCGCCTTCAACGACAGATATAAAAAAGAAAGACAAATCTAAAACTCCTCA
TAGACTGGCAGCTTTCAGAGATATTAATAAGAAGTCCACTAAAATCATTC
CTCTAAACCGACAACTGCCAACTGGTTCAATGGCCATAGATACGAATCAA
ATGAGATTTCTTGTAGATCCATCTCAAGACTCCTCGAATTCCAATAGTCC
TTCTTTAGGGTCGTTTTTCAAAAACGAAATGACAATTTCGGTACTCCGAG
AGCAGCAAATCACGCCGCGCTGGGTCGGCCTCGTTGGGGATGACGAGTGT
CCGACGACGTGTGAACTGGAGCTCTACCTCAAAGAGGCTAACTCAATGAT
TTATGTCAACACGGAGAATTTTATTTCTCTATTTTCACCGCAACTTCTCC
TCATGATTAATGCTAACGATTTGCAGTTTTTGTGTTGTTTTGATCGAATG
GAAACCAGGAAAACTAAAGAGAGAATAGTGCAGAAATCCAGCGCTATGAG
TAAACAAGATTTAAGAAGTCAAGATTCAACAAGTGCAGCTCAACTGATAA
GTTTGATGGGCGTCAAATCCTTTGTATTTAATCAATGGGCAGGTTTGATA
GATTGGAATAAATGGGAGATCAAAACGTTCTTTTCTGGTTTCCTTGACGA
TGGAATGAATGTTGGAGAATGCCTTCAACAAATACGAAATCCTCCCATCG
AAGAAGTTCCTGAACTCATTAAAAATCTTTCTCTTACATCTCCATCAGAA
TCTTTTATTAAATCAAATTTGGTGCTTTATGGGTTGCCGAATATAGCGGT
TTCCGGTTCCGTTTAAACCTTCAA
back to top

protein sequence of SMED30032947-orf-1

>SMED30032947-orf-1 ID=SMED30032947-orf-1|Name=SMED30032947-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2468bp
MASEEMLPLLQEADFVNFELLMMESESLNEKITPATLKFRLKTIEKCKTT
LLNVIRSENSRLIELGCASLWNICLPILQPSLVLKIHSHLVLVADSLEMI
GCLNYKLCAQVHIEVGKGYAALEQINDAIKYLQKAILLDRKKEYTELIEH
FIHKLKMQEKLYEKPLDPCDEARQLLEQVRSTLNNEIIPIEKLRPLLAQI
GHCLAPDDFLVILDHDLSMKEGENDKDVHGKFTKTFSWENVVTRINSYLL
RSGNTDDKRKMRLWVDLVKLSRKVQLWDICRVASCFAILYDDGRWKNHFQ
IKIENSSRKGNRNMGASSGMQNAETSAVETNQMSELDVTDSSINENKRRK
EESDLSNNSMKQSRLEKVLLEQLTETYFIRAEAFIQALRNEGAQLLTFPE
RPKDLKKHPKGFIKDTSNEDKEWKSYCESLEKLSNQIVACFLRAAALSVD
LQAPWFTQNAATYLWNYSMHILTLSDHGILVSSFQTMYDYLRQMINEKMV
DIITNYGIVLAHGMIQKYMPIPVFLLDNIFDSPSASTNLDKKAKKDRESP
KSKTVGQTGAGQNSTESVNQFKKALDICQYLMDITSDVPPFPTETTNPVP
SPNTNSNNNKTAQINRTIDIKTKGQLIEIWVQCKQLLQQPVGRNLGTDDA
EIKLGQRPIVRAMTSVQMVWICQNEFYKFPDLLSVNDCLQYIDLCDWEEA
SVLLNLLMKLAQITVKGSVSNSINTLVKITEKAVKVSPETHIGVVKRANK
TNTNTGTVDAKLALSFIYFCHGLCLHKTGQNTSVLMQCLQLLVKACCYAR
DGNDYFLVSQISHYFWRISQVLIKRFSNTCQIAKEIEIIINCLSLTVDKK
RLKLFLEPHTEEEGPRLEAELEEKLPHILQIGDDQKLITLDNNKALFLTS
YRRQMSKTSLEQDLTIRIQMHIAIFQCFCFQEKWTEALKSLDEAIADLPR
TNHKLDLFRHRLLTKVRLNHSIELDVQKFKNQKEEEVATLWREIAIVSNS
RESQLFAYKKSIESLKNKSNNLLKVDLIMELSQWLFHSDYPIELCSQYID
FAINILLNTEATKEKSLSHPNSSVKNRSRNNFRKPGSGLKPNVKNENIQE
TPEMTNDTSNTDNNEELTNPTWFFLQEFRPRTLEDICDIRMLSKFVICLT
TQAKLLGNSGGKSRDNLIMASGCVIRMWQVAMSSLTVAIKEIGKSKVEIE
SPTKSKDKAAKKDKSAKPNSEPVQSKTKVPKRKGPADWLPTSNEEWSVFE
ISDDALEAITSKVYMKSTGLHEISIPNIGQFMGACDALIEMLAEQGYELL
TFPILSIMDAISRSDETVPAKLLNQYIHLRWLQFSLRINNQDAIFHHEKF
INSPFVIPEYCAHVEIIKANLEEYKKQNKSQVLPMNFETQSTLPLKLSHL
NRKLTKFGYIHETWIKIAWILVEIGYNQEASEVICVAEELSKMLNDEKMN
TECNLLKAKLMINQGEFDEALLYIDAIGSCHFTFKQWSEIIDLLIEIGTD
QANEHGDISKIRLRLLRMKDHTENRVAEIKLSNQQLNSDNLIGKMNYGLL
LLDRRIATLDLGRSRNWENVSEMMEAFLGKLEEIESLHESNKSFKYLIEI
SMEKLEIFDFLMKVNEKTNFKSLLIKKLIVIEKCLEIYQIIFDDIYRVCS
PLESSAFNLPIDRKLCRAKLMLSDCLIEMFSITVEDTAEKVLQHRAKDHL
TQIVDEYVEEVIPDKESKEWRIVTNGICDKICSTLSDVHTICSQIPDINA
QCLLKYGHVMKLRAMELYPNKRNQWSRPLMDIEDPLETQKSKLVNLQDSS
NNKEIENNSYGLLENEDTEKNYQSSIKMSKAKSQMIQNRYYLNQAIEMIN
QSIAISIAHEFYDCVVTATELLIDIFGQFDCQLSGQLLCLHQNSRTAAQM
RNILLKTLRKASMGQLAAFVLQRDYMIRKSKREESNLTEFSLYKSVKEKL
NSTFPAWKMTNVSLNPLELLKDLSYLTSGFLIFEHSLNQQFLYCAFIDTK
HKTANLSKPNNKPAAIGDRTKICRIATSPSQIEDLQNYWRGFKSKLEKLV
FNVENKTQIFEQRINLYSEIENQTEIQRAFLEKEALNANIQMNILEIEEN
YSEIMENLQEYLGPIFEKLGNFFPPGNERNSPSNQKANKETISQPGKDSI
IILTDEILSVASLESIPKLKSSISRDFSLQVLHHRLKGMGESDPVDAPST
TDIKKKDKSKTPHRLAAFRDINKKSTKIIPLNRQLPTGSMAIDTNQMRFL
VDPSQDSSNSNSPSLGSFFKNEMTISVLREQQITPRWVGLVGDDECPTTC
ELELYLKEANSMIYVNTENFISLFSPQLLLMINANDLQFLCCFDRMETRK
TKERIVQKSSAMSKQDLRSQDSTSAAQLISLMGVKSFVFNQWAGLIDWNK
WEIKTFFSGFLDDGMNVGECLQQIRNPPIEEVPELIKNLSLTSPSESFIK
SNLVLYGLPNIAVSGSV*
back to top

protein sequence of SMED30032947-orf-2

>SMED30032947-orf-2 ID=SMED30032947-orf-2|Name=SMED30032947-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=225bp
MCVVLGENCLKNDIKIIANNCLRLYFSLDPQENQYLARAYLIQAQLIKPE
RFDEETALDKPIGFILKAINFSKKEKRFHYLIYNSALIYYEIVRNYLRPN
FYQYLCKSLSSICKTLEEVNDPNIQFRSQLMLLLIQCHIDAGHRKEVIQI
VDGTATFLGKHSPYLLKDLLTTLINNSIGTLEKYLWYTKNHPAMQTFIRL
CKLKIMKDKDDGSVINEAKKFFPA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035082axoneme assembly
GO:0060294cilium movement involved in cell motility
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
IPR019734TPR_repeat
IPR002491ABC_transptr_periplasmic_BD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium