TNF receptor associated factor 4

Overview
NameTNF receptor associated factor 4
Smed IDSMED30032941
Length (bp)2232
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor 4 (SMED30032941) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor 4 (SMED30032941) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor 4 (SMED30032941) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor 4 (SMED30032941) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032941

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30032941SMESG000026092.1 SmedASXL_011194SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032941SMESG000027280.1 SMESG000027263.1 SMESG000026967.1 SMESG000026956.1 SMESG000026954.1 SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025794.1 SMESG000025583.1 SMESG000025517.1 SMESG000025934.1 SMESG000025926.1 SMESG000025797.1 Contig3847GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30032941SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor 4 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 127.102 bits (318), Expect = 5.754e-30
Identity = 134/518 (25.87%), Postives = 219/518 (42.28%), Query Frame = 2
Query:  137 SYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEY--LCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVL-CEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEI-FVHTKLLM----DFVVNFNNEMEILKANNNGLSPVN---ELLRNEINE-------------LKLDG----DRRR-------------------------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVEND--FQQQIAQC--ATNCQQAEIKQKELID-------KIGQMEN--KQKVDLTEMSNKID--------KLSGNVDR-KLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            S +Y+ +  +E+   C  C  +L N H   CG RFC  C+     L     CP D E  K      ++ +  D     ++  L V C     C  +  L + +DH++ C +Q  QC  SN  C +  + +D + +HL +   F   K L       V+N  N  E L        P N    +L+ E++E              K  G    D+RR                          +I DL +    +  +I+ L E I  L    +  +         +   QV    ++     + Q+ Q     N QQ +   + L++       KI  +EN  ++   L E +NK D        +LS N +R KLLE         NG+ +WK+  +  K  +A +G    I+S+SF T + G+++C   Y +GDG G+G+HLS++F +M+GEFD +L+WPFR  VT  L++Q  +         ++ D +  +F +P  +     G  +F++H  L
Sbjct:   30 SIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIK------SQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQC--SNEKCREPVLRKD-LKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTC-----YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMET---FKPDPNSSSFKRPDGEMNIASGCPRFVAHSVL 530          
BLAST of TNF receptor associated factor 4 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 127.102 bits (318), Expect = 5.754e-30
Identity = 134/518 (25.87%), Postives = 219/518 (42.28%), Query Frame = 2
Query:  137 SYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEY--LCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVL-CEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEI-FVHTKLLM----DFVVNFNNEMEILKANNNGLSPVN---ELLRNEINE-------------LKLDG----DRRR-------------------------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVEND--FQQQIAQC--ATNCQQAEIKQKELID-------KIGQMEN--KQKVDLTEMSNKID--------KLSGNVDR-KLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            S +Y+ +  +E+   C  C  +L N H   CG RFC  C+     L     CP D E  K      ++ +  D     ++  L V C     C  +  L + +DH++ C +Q  QC  SN  C +  + +D + +HL +   F   K L       V+N  N  E L        P N    +L+ E++E              K  G    D+RR                          +I DL +    +  +I+ L E I  L    +  +         +   QV    ++     + Q+ Q     N QQ +   + L++       KI  +EN  ++   L E +NK D        +LS N +R KLLE         NG+ +WK+  +  K  +A +G    I+S+SF T + G+++C   Y +GDG G+G+HLS++F +M+GEFD +L+WPFR  VT  L++Q  +         ++ D +  +F +P  +     G  +F++H  L
Sbjct:   30 SIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIK------SQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQC--SNEKCREPVLRKD-LKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTC-----YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMET---FKPDPNSSSFKRPDGEMNIASGCPRFVAHSVL 530          
BLAST of TNF receptor associated factor 4 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 127.102 bits (318), Expect = 5.754e-30
Identity = 134/518 (25.87%), Postives = 219/518 (42.28%), Query Frame = 2
Query:  137 SYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEY--LCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVL-CEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEI-FVHTKLLM----DFVVNFNNEMEILKANNNGLSPVN---ELLRNEINE-------------LKLDG----DRRR-------------------------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVEND--FQQQIAQC--ATNCQQAEIKQKELID-------KIGQMEN--KQKVDLTEMSNKID--------KLSGNVDR-KLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            S +Y+ +  +E+   C  C  +L N H   CG RFC  C+     L     CP D E  K      ++ +  D     ++  L V C     C  +  L + +DH++ C +Q  QC  SN  C +  + +D + +HL +   F   K L       V+N  N  E L        P N    +L+ E++E              K  G    D+RR                          +I DL +    +  +I+ L E I  L    +  +         +   QV    ++     + Q+ Q     N QQ +   + L++       KI  +EN  ++   L E +NK D        +LS N +R KLLE         NG+ +WK+  +  K  +A +G    I+S+SF T + G+++C   Y +GDG G+G+HLS++F +M+GEFD +L+WPFR  VT  L++Q  +         ++ D +  +F +P  +     G  +F++H  L
Sbjct:   30 SIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIK------SQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQC--SNEKCREPVLRKD-LKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTC-----YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMET---FKPDPNSSSFKRPDGEMNIASGCPRFVAHSVL 530          
BLAST of TNF receptor associated factor 4 vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 123.635 bits (309), Expect = 3.182e-29
Identity = 114/489 (23.31%), Postives = 205/489 (41.92%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKC--NISQDKVTDHLQSEIFVHTKLLMDFV-VNFNNEM-----------EILKANNNGLSPVNELLRNEIN---------------ELKLDG-DRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +  +LC LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  + V++  L ++C   E  C +   LR ++ H+  C++    CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E             +   N  G   +  LL                    E   D     + +   L   C NQ     +  ED+P       N +  L   +     ++    A+    ++ +              K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +S + +G+G G+G HLS++  ++ G FD +LEWPF   VTF+L++Q      +  H +    +  D +   F KP +  GS       FG+ +FISH+D+
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCP------NRCPMKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESV--------------KPHLAMMCALVSRQRQELQELRRELEELSVGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTE--TFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 124.02 bits (310), Expect = 6.551e-29
Identity = 98/371 (26.42%), Postives = 176/371 (47.44%), Query Frame = 2
Query:  377 LLVKCPEVLCEFQSELR-KMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            ++V CP   C  Q+ LR ++  H+  C    S C +   GC     +Q ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ +R++        +I  LQR   +QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  VT  L++Q +   H  GD  ++ D +  +F KP  +     G   F++   L
Sbjct:  200 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVL 543          
BLAST of TNF receptor associated factor 4 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 87.0409 bits (214), Expect = 9.012e-18
Identity = 35/103 (33.98%), Postives = 59/103 (57.28%), Query Frame = 2
Query: 1034 KLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTR 1342
            ++L  A    +    + +WK+DK   +  +AK+G +  I+S  F++H+ G+KM       GDG   G  +S++  L+KGEFD  LEWPF  ++  +L++Q  R
Sbjct:  249 RILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPR 351          
BLAST of TNF receptor associated factor 4 vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 73.559 bits (179), Expect = 8.916e-14
Identity = 40/115 (34.78%), Postives = 64/115 (55.65%), Query Frame = 2
Query:  989 EMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADA-KNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALIN 1330
            + S  +DK  G +  + + +A +  ++   +  +++ K    +  A KN  +  IYS+ F +H  G+KM     P GDG     + SVF  LMKGE+D ILEWPFR  VTF++++
Sbjct:  131 QQSAYVDKYVGML--QYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILS 243          
BLAST of TNF receptor associated factor 4 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 90.5077 bits (223), Expect = 1.163e-18
Identity = 44/136 (32.35%), Postives = 75/136 (55.15%), Query Frame = 2
Query: 1073 NGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGS-EFGFHQFISHRDLSANP 1477
             G  +WK+  ++ KMA+A+      + S  F T + G+K+  S++ +G+G G+  H+SV+  ++ GE+D +L+WPF HS+TF L  Q  +         +  D   + F +P ++     FGF +FISH  L + P
Sbjct:  330 TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP 465          
BLAST of TNF receptor associated factor 4 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 90.1225 bits (222), Expect = 1.470e-18
Identity = 44/136 (32.35%), Postives = 75/136 (55.15%), Query Frame = 2
Query: 1073 NGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGS-EFGFHQFISHRDLSANP 1477
             G  +WK+  ++ KMA+A+      + S  F T + G+K+  S++ +G+G G+  H+SV+  ++ GE+D +L+WPF HS+TF L  Q  +         +  D   + F +P ++     FGF +FISH  L + P
Sbjct:  321 TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP 456          
BLAST of TNF receptor associated factor 4 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 60.077 bits (144), Expect = 3.526e-9
Identity = 26/95 (27.37%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 1064 QRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLA 1348
            Q I G  +W++  ++ K+ ++K   + I++S  F     G+ + L +Y +G G  KG ++    +++ GE+D +L WP R      + +Q T +A
Sbjct:  251 QNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVA 344          
BLAST of TNF receptor associated factor 4 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 60.077 bits (144), Expect = 3.526e-9
Identity = 26/95 (27.37%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 1064 QRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLA 1348
            Q I G  +W++  ++ K+ ++K   + I++S  F     G+ + L +Y +G G  KG ++    +++ GE+D +L WP R      + +Q T +A
Sbjct:  251 QNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVA 344          
BLAST of TNF receptor associated factor 4 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0334036)

HSP 1 Score: 60.077 bits (144), Expect = 3.526e-9
Identity = 26/95 (27.37%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 1064 QRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLA 1348
            Q I G  +W++  ++ K+ ++K   + I++S  F     G+ + L +Y +G G  KG ++    +++ GE+D +L WP R      + +Q T +A
Sbjct:  251 QNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVA 344          
BLAST of TNF receptor associated factor 4 vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 132.109 bits (331), Expect = 7.747e-32
Identity = 99/356 (27.81%), Postives = 165/356 (46.35%), Query Frame = 2
Query:  428 KMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVN-ELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQ----RINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVS 1414
            K  DHI++C    + C +  +GCD   + ++K+ DH Q+  + H  LL+ F++        +K N   L P + EL  ++I+EL        +++G L   C   A       +   AL                +      A+    +  + ++ + +  CQ+ E+K            +E+      ME  N+Q      K+++  ++NK+ +L   V   D  ++EM A   +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCL +Y +GDG G+G HLS+FF +M+G  D +L+WPF   VT  L++Q  R         +  DI   +F +PVS
Sbjct:  201 KYVDHIKLCTKFRTPCRFHVVGCDM-TVEKEKIHDHEQACSYEHLNLLLHFIMG-------IKVNLESLQPQSLELASHKIHELHQSLRELELKMGQL---CGAGASV-----QGACALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEI--LNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVS 535          
BLAST of TNF receptor associated factor 4 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 121.324 bits (303), Expect = 1.264e-28
Identity = 111/480 (23.12%), Postives = 211/480 (43.96%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNI--SQDKVTDHLQSEIFVHTKLLMDFVVN-FNNEMEILKANNNGLSPVNELL-RNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQL------IIEGNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIG---QMENKQKVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +    C LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  +  +I  L ++C   E  C +  ++++++ H   C +    CP      ++C++  ++  + +HLQ +     K+  +F  + F  E      N+ G+ P   +   N+     +    RR+       +C  + +  +   ++          V D +   Q       +   NQ     +A   + N  ++        C   E   K    K+     +E   K  LT M + + +    +    R++ E++ + +    G  +WKL  ++ K+ +AK   N   +S  F TH+ G+K+ +S + +G+G G+G+HLS++  ++ GE+D +LEWPF + VTF++++Q     ++  H +   +   D +   F KP S   S       FG+ +FISH ++
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCP------NRCSVKLTRRDLPEHLQHDC-PKRKVKCEFCGSEFTGEA---YENHQGICPQESVYCENKCGARMM----RRLLSQHTMTECPKRTQPCKYCGKEF---------VYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSLVGRQRQEILELRREMEELSVSHD----GVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFN--PDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 121.324 bits (303), Expect = 1.264e-28
Identity = 111/480 (23.12%), Postives = 211/480 (43.96%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNI--SQDKVTDHLQSEIFVHTKLLMDFVVN-FNNEMEILKANNNGLSPVNELL-RNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQL------IIEGNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIG---QMENKQKVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +    C LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  +  +I  L ++C   E  C +  ++++++ H   C +    CP      ++C++  ++  + +HLQ +     K+  +F  + F  E      N+ G+ P   +   N+     +    RR+       +C  + +  +   ++          V D +   Q       +   NQ     +A   + N  ++        C   E   K    K+     +E   K  LT M + + +    +    R++ E++ + +    G  +WKL  ++ K+ +AK   N   +S  F TH+ G+K+ +S + +G+G G+G+HLS++  ++ GE+D +LEWPF + VTF++++Q     ++  H +   +   D +   F KP S   S       FG+ +FISH ++
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCP------NRCSVKLTRRDLPEHLQHDC-PKRKVKCEFCGSEFTGEA---YENHQGICPQESVYCENKCGARMM----RRLLSQHTMTECPKRTQPCKYCGKEF---------VYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSLVGRQRQEILELRREMEELSVSHD----GVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFN--PDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 111.694 bits (278), Expect = 7.399e-27
Identity = 68/206 (33.01%), Postives = 106/206 (51.46%), Query Frame = 2
Query:  875 FQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQ----RINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVS 1414
             Q Q+ + +  CQ+ E+K            +E+      ME  N+Q      K+++  ++NK+ +L   V   D  ++EM A   +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCL +Y +GDG G+G HLS+FF +M+G  D +L+WPF   VT  L++Q  R         +  DI   +F +PVS
Sbjct:   35 LQPQMVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEI--LNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVS 235          
BLAST of TNF receptor associated factor 4 vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 111.694 bits (278), Expect = 7.399e-27
Identity = 68/206 (33.01%), Postives = 106/206 (51.46%), Query Frame = 2
Query:  875 FQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQ----RINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVS 1414
             Q Q+ + +  CQ+ E+K            +E+      ME  N+Q      K+++  ++NK+ +L   V   D  ++EM A   +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCL +Y +GDG G+G HLS+FF +M+G  D +L+WPF   VT  L++Q  R         +  DI   +F +PVS
Sbjct:   35 LQPQMVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEI--LNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVS 235          
BLAST of TNF receptor associated factor 4 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 129.413 bits (324), Expect = 7.701e-31
Identity = 119/506 (23.52%), Postives = 221/506 (43.68%), Query Frame = 2
Query:  140 YDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYL---------CENR---------------------YCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHI-RMCNYQSSQ--------------------CPYSNIGCDK-CNI--------SQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISH 1456
            Y    +  +E++  C  C+ +L N     CG RFC  C++  L         CE+                      +C  +T  CK ELI++  N+++    + +  +L   CP   C+ +   + + DHI + C Y+ +                     CP   I C   C++        +  ++  H  S    H  L+ ++      ++ +L+  ++  +   ++L N++   +++ +R +         I  LQR    QA++++ L+++I   RN+ R   D  DG++   E  Q  +  +E      +A+ A +     ++ +  I++  QM +   + L +M  +          ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  V+  L++Q     H  GD  ++ D +  +F KP  +     G   F++ 
Sbjct:   34 YKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCK-ELITLG-NLLIHLKSDCQFEEL--SCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEI---RNL-RQTGDEADGMKSNYESLQNRLSQLE-----VMAKNAASWNPGVLETQ--INRHDQMLSVHDIRLADMDLRF---------QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQ 508          
BLAST of TNF receptor associated factor 4 vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 121.324 bits (303), Expect = 1.458e-28
Identity = 107/489 (21.88%), Postives = 208/489 (42.54%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQ---------------------SSQCPYSNIGCDKC--NISQDKVTDH----LQSEIFVHTKL---LMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  YDY+ + ++  + LC LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  DR +  ++  L ++C   E  C +  +L++++ H+ +C +                         CP   + C+ C  + + +   DH     Q  ++   K    +M  V++ ++ +E  K          E + + I   +    R           C NQ     +  ED+        ++ D           + + +   ++   +      T  +  E   +  +  +  + ++Q+ ++ E+  ++++LS + +               G  +WK+  ++ K+ +AK   N   +S  F THK G+K+ +S + +G+G G+G++LSV+  ++ GE+D +LEWPF + VTF+L++Q     ++  H +   +   D +   F KP     S       FG+ +FISH D+
Sbjct:    1 MPGYDYKFLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPYCNKEFVFDTIQSHQYQCPR-------YPTPCPNQCGIASIAREDL------SNHLKDSC--------SSALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSMMSSLVSRQRQEILELRKQVEELSVSSE---------------GVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFN--PDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 120.553 bits (301), Expect = 7.432e-28
Identity = 121/516 (23.45%), Postives = 216/516 (41.86%), Query Frame = 2
Query:  140 YDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYL---------CENR---------------------YCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHI-RMCNYQSSQCPY-------------SNIGCDKCNISQD---KVTDHLQSEIFVH---------TKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNE-------DIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVD-------LTEMSNKIDKLSGNVDRKLLEMAAN----QNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            Y    +  +E++  C  C+ +L N     CG RFC  C++  L         CE+                      +C  +T  CK ELI++  N+++    + +  +L   CP   C+ +   + + DHI + C Y+ + C +              ++ C    IS      V   L+SE+  H         T     +   F    + +KA+    S V       +N +K   +    ++  LQ + + + + I++L+        +I   +   RN   R+  LQ +IEG    ++ ++ +  + + Q        +   + L +++ Q+E   K         L    N+ D++    D +L +M       +    NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  V+  L++Q     H  GD  ++ D +  +F KP  +     G   F++   L
Sbjct:   34 YKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCK-ELITLG-NLLIHLKSDCQFEEL--SCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGTNQQIKAHEAS-SAV-----QHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEI-RNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVL 536          
BLAST of TNF receptor associated factor 4 vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 113.62 bits (283), Expect = 1.853e-26
Identity = 52/126 (41.27%), Postives = 77/126 (61.11%), Query Frame = 2
Query: 1040 LEM--AANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPV 1411
            LEM  A  +    +G F+WK+   T+K  DA  G    +YS +F T K G+K+CL +Y +GDG GKG H+S+FF +MKGE+D +L WPF+H VTF L++   R + F     +  D+   +F +P+
Sbjct:  216 LEMRSACLEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRDSVFDA---FRPDVTSASFQRPI 338          
BLAST of TNF receptor associated factor 4 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 107.071 bits (266), Expect = 9.290e-24
Identity = 95/376 (25.27%), Postives = 175/376 (46.54%), Query Frame = 2
Query:  383 VKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEI--------ELLNEDIPALRNVDRNVSDRLDGLQLII-EGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDR-KLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPE 1480
            V CP   C       +++ H+  C     QC +SN GC+   + + KV +H   + F+   +L  +V+N N ++E       GL    +L  ++I +L            D  + C  +  +           L+        +D+++      +QL+  E +++ +R + +  +    + +T         +   D+I  ++ + K     +SN   +++ N +R +L+E  +      NG+ +WK+  +  K  +A  G    I+S+ F T   G+++C   Y +GDG GKG+ LS++F +MKGEFD IL WPF+  VT  L++Q  +  H + D+ +  D +  +F +P S+     G  +F SH  L  NP+
Sbjct:  125 VPCPNA-CPVTCPRAELDKHLCECPEAELQCTFSNYGCN-VMVKRGKVKEH--EDTFLRDHML--YVLNRNMKLE---EQVLGLQQNLDLKEHQIQQL-----------SDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLST--------LEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTS-----YNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHIT-DV-FRADPNSSSFKRPDSEMNIASGCPRFASHAQLE-NPK 464          
BLAST of TNF receptor associated factor 4 vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 125.176 bits (313), Expect = 5.423e-30
Identity = 115/482 (23.86%), Postives = 209/482 (43.36%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKC--NISQDKVTDHLQSEIFVHTKLLMDFV-VNFNNEMEILKANNNGLSPVNELL-RNEINEL---KLDGDRRRVEIGDLQRKCAN----------QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC------QQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +  +LC LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  + V++  L ++C   E  C +   LR ++ H+  C++    CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E      ++ G+ P   +   N+       +L       E     + CA           Q+ + +     +P           R D    + +    A   V   F++  + C   C      +  E   K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +S + +G+G G+G HLS++  ++ G FD +LEWPF   VTF+L++Q      +  H +    +  D +   F KP +  GS       FG+ +FISH+D+
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCP------NRCPAKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEA---YESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAF--VLCPFKE--SGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELEELSIGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTE--TFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 123.635 bits (309), Expect = 5.020e-29
Identity = 98/371 (26.42%), Postives = 176/371 (47.44%), Query Frame = 2
Query:  377 LLVKCPEVLCEFQSELR-KMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            ++V CP   C  Q+ LR ++  H+  C    S C +   GC     +Q ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ +R++        +I  LQR   +QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  VT  L++Q +   H  GD  ++ D +  +F KP  +     G   F++   L
Sbjct:  199 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVL 542          
BLAST of TNF receptor associated factor 4 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 120.939 bits (302), Expect = 3.513e-28
Identity = 117/502 (23.31%), Postives = 214/502 (42.63%), Query Frame = 2
Query:  140 YDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENR-YCPGDTED-----------CKLELISIT---ENIMVDRPMNVKISKLLV-----------KCPEVLCEFQSELRKMEDHI-RMCNYQSSQ--------------------CPYSNIGCD-KCNI--------SQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISH 1456
            Y  + +  +ED+  C  C+ +L N     CG RFC  C++  L  +   C    E            CK E++++     N        + +  LLV            C    C+ +   + + DH+ + C Y+ +                     CP   + C  KC++        +  ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ +R++        +I  LQR   +QAE+++ L+++I       R   +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  VT  L++Q +   H  GD  ++ D +  +F KP  +     G   F++ 
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPF----RQNWEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQ 514          
BLAST of TNF receptor associated factor 4 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 120.939 bits (302), Expect = 3.513e-28
Identity = 117/502 (23.31%), Postives = 214/502 (42.63%), Query Frame = 2
Query:  140 YDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENR-YCPGDTED-----------CKLELISIT---ENIMVDRPMNVKISKLLV-----------KCPEVLCEFQSELRKMEDHI-RMCNYQSSQ--------------------CPYSNIGCD-KCNI--------SQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISH 1456
            Y  + +  +ED+  C  C+ +L N     CG RFC  C++  L  +   C    E            CK E++++     N        + +  LLV            C    C+ +   + + DH+ + C Y+ +                     CP   + C  KC++        +  ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ +R++        +I  LQR   +QAE+++ L+++I       R   +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  VT  L++Q +   H  GD  ++ D +  +F KP  +     G   F++ 
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPF----RQNWEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQ 514          
BLAST of TNF receptor associated factor 4 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 108.997 bits (271), Expect = 1.764e-24
Identity = 56/149 (37.58%), Postives = 84/149 (56.38%), Query Frame = 2
Query:  992 MSNKIDKLSGNVDRKLLEMAANQNQRIN--------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVS 1414
            +SNK+ +L  ++  K L MA +  Q+++        G F+WK+  FT K  +A  G    I+S +F T + G+KMCL VY +GDG G+G HLS+FF +MKG  D +L+WPF   VT  L++   R         +  D+   +F +PVS
Sbjct:  317 LSNKVQQLERSIGLKDLAMA-DLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDA---FRPDVTSSSFQRPVS 461          
BLAST of TNF receptor associated factor 4 vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 2.763e-29
Identity = 134/518 (25.87%), Postives = 219/518 (42.28%), Query Frame = 2
Query:  137 SYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEY--LCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVL-CEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEI-FVHTKLLM----DFVVNFNNEMEILKANNNGLSPVN---ELLRNEINE-------------LKLDG----DRRR-------------------------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVEND--FQQQIAQC--ATNCQQAEIKQKELID-------KIGQMEN--KQKVDLTEMSNKID--------KLSGNVDR-KLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            S +Y+ +  +E+   C  C  +L N H   CG RFC  C+     L     CP D E  K      ++ +  D     ++  L V C     C  +  L + +DH++ C +Q  QC  SN  C +  + +D + +HL +   F   K L       V+N  N  E L        P N    +L+ E++E              K  G    D+RR                          +I DL +    +  +I+ L E I  L    +  +         +   QV    ++     + Q+ Q     N QQ +   + L++       KI  +EN  ++   L E +NK D        +LS N +R KLLE         NG+ +WK+  +  K  +A +G    I+S+SF T + G+++C   Y +GDG G+G+HLS++F +M+GEFD +L+WPFR  VT  L++Q  +         ++ D +  +F +P  +     G  +F++H  L
Sbjct:   30 SIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIK------SQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQC--SNEKCREPVLRKD-LKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTC-----YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMET---FKPDPNSSSFKRPDGEMNIASGCPRFVAHSVL 530          
BLAST of TNF receptor associated factor 4 vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 3.793e-29
Identity = 115/482 (23.86%), Postives = 209/482 (43.36%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKC--NISQDKVTDHLQSEIFVHTKLLMDFV-VNFNNEMEILKANNNGLSPVNELL-RNEINEL---KLDGDRRRVEIGDLQRKCAN----------QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC------QQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +  +LC LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  + V++  L ++C   E  C +   LR ++ H+  C++    CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E      ++ G+ P   +   N+       +L       E     + CA           Q+ + +     +P           R D    + +    A   V   F++  + C   C      +  E   K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +S + +G+G G+G HLS++  ++ G FD +LEWPF   VTF+L++Q      +  H +    +  D +   F KP +  GS       FG+ +FISH+D+
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCP------NRCPAKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEA---YESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAF--VLCPFKE--SGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELEELSIGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTE--TFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI 445          
BLAST of TNF receptor associated factor 4 vs. UniProt/SwissProt
Match: sp|Q9BUZ4|TRAF4_HUMAN (TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.528e-28
Identity = 114/489 (23.31%), Postives = 205/489 (41.92%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKC--NISQDKVTDHLQSEIFVHTKLLMDFV-VNFNNEM-----------EILKANNNGLSPVNELLRNEIN---------------ELKLDG-DRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +  +LC LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  + V++  L ++C   E  C +   LR ++ H+  C++    CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E             +   N  G   +  LL                    E   D     + +   L   C NQ     +  ED+P       N +  L   +     ++    A+    ++ +              K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +S + +G+G G+G HLS++  ++ G FD +LEWPF   VTF+L++Q      +  H +    +  D +   F KP +  GS       FG+ +FISH+D+
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCP------NRCPMKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESV--------------KPHLAMMCALVSRQRQELQELRRELEELSVGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTE--TFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI 445          
BLAST of TNF receptor associated factor 4 vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 3.146e-28
Identity = 98/371 (26.42%), Postives = 176/371 (47.44%), Query Frame = 2
Query:  377 LLVKCPEVLCEFQSELR-KMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            ++V CP   C  Q+ LR ++  H+  C    S C +   GC     +Q ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ +R++        +I  LQR   +QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  VT  L++Q +   H  GD  ++ D +  +F KP  +     G   F++   L
Sbjct:  200 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVL 543          
BLAST of TNF receptor associated factor 4 vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 3.511e-28
Identity = 98/371 (26.42%), Postives = 176/371 (47.44%), Query Frame = 2
Query:  377 LLVKCPEVLCEFQSELR-KMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            ++V CP   C  Q+ LR ++  H+  C    S C +   GC     +Q ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ +R++        +I  LQR   +QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  VT  L++Q +   H  GD  ++ D +  +F KP  +     G   F++   L
Sbjct:  199 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL-GDA-FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVL 542          
BLAST of TNF receptor associated factor 4 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.793e-91
Identity = 145/166 (87.35%), Postives = 152/166 (91.57%), Query Frame = 2
Query:  326 ITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGL 823
            + ENI VD PMN+KI+KL VKC E  C++  ELRKMEDH R C Y+S  CPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEME+LKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGL
Sbjct:   12 LNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGL 177          
BLAST of TNF receptor associated factor 4 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 9.493e-45
Identity = 121/455 (26.59%), Postives = 238/455 (52.31%), Query Frame = 2
Query:   98 MATKLENIWESMKSYDYETIGE-IEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENR-YCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFV------VNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQ--RING-------EFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYE-LDIDGDAFCKP 1408
            + +KL+N+ E +  Y+ + + E + +++LC+LC KL+ +A  + CGC +C+ C+  YL +N  YCPGD  +CK + +++  ++  +  ++ +IS+++VKCP + C + SEL ++++H+  C  +S +CP   IGC++  + +D++  HL  ++  HT+L+M F       +N NNE          +S + E+LR +    K   D +  ++  L  +  N+   I +L++DI  ++N           +  ++   +  ++ +++D   QI +     Q+ E  + +L + +G  + K +V   ++  +I  +  N+D    E     N   R+N        +F+W++++++ K     +     +YS+SF +H   +K CL++Y  GD  G      ++  +MKGE D  LEWP R +VT ++I Q +   H +    Y+    +  AF +P
Sbjct:    2 IPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNE-----TTKEDISHLKEVLRVQ----KALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKN----------EMITLLTSKESELKKLKSDI--QIFR-----QEIEFMKNDL-EVVGSTDIKNQV--KDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDFMWRIEEYSKKRRTVTD-----VYSDSFQSH--NYKFCLNLYIYGDNLG------LWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRP 414          
BLAST of TNF receptor associated factor 4 vs. TrEMBL
Match: A0A5A9NXF1 (TNF receptor-associated factor OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti007446 PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.541e-34
Identity = 128/467 (27.41%), Postives = 204/467 (43.68%), Query Frame = 2
Query:  167 EDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENR--YCPGDTEDCKLEL---ISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQ---------------------SSQCPYSNIGCDKCNI---------SQDKVTDHLQSEIFVHTKLLMDFVVNFNNEM--------EILKANNNGLSPVNELLRNEINELKLDGDRRRV-----EIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDF--QQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSK 1417
            +++ LC  C  +L  A    CG R+C  CV+  L  N+   C    ED  +E    +   +    D  +N +I  L V C    C ++S L+  EDH   C Y                         CP +   C  C+          + DKV +H       H +LL++ +    + +        EIL     G +  + L+ +E +EL+ DG    V      + D Q + A   ++++ L + +  + N+       +  L   +E  Q+ + A+E D    QQI Q      Q E K +E  + +     ++ + +T +   I  L              QN   +G F+W+L   T  + +A  G     YS +F T + GFK+C+ +Y +GDG GKG H+S+FF +MKGE+DGIL+WPFRH VTF LI+Q  R         +  D+   +F +PVS+
Sbjct:   35 KEKFLCSNCNNVLNKARQTVCGHRYCLACVNWLLRNNKDLVCTKCKEDQSIESDTSVLTLDQFFNDAAINKEILDLKVHCANQGCPWRSTLKNFEDHQSQCEYALIPCNIGCGIMVQRKALATHLERGCPNNKTTCASCSGVLTPRELQGNADKVKEHESCSHVGHLQLLLEVIRGLQSNLSSQERGIPEILDFLQPGTTG-SSLVSHEESELETDGGESGVNDKASSLHDDQAELA-VGQQLDTLQQRVQVMENI-------ISALNREVEKTQIGVVALERDNLNNQQIIQ------QLETKVEEQQEWL----TRKDIHITSLQQCISGL--------------QNVSYDGTFLWRLCDVTQSLREAATGHKISQYSPAFYTARYGFKVCMRLYLNGDGVGKGTHISLFFVIMKGEYDGILQWPFRHKVTFFLIDQNQREHVIDA---FRPDLCSASFHQPVSE 465          
BLAST of TNF receptor associated factor 4 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.719e-34
Identity = 76/190 (40.00%), Postives = 113/190 (59.47%), Query Frame = 2
Query:  113 ENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCE-NRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELK 679
            E I   + +Y++E  G + D + C LCK LLVNA  + CGCRFC  C+ EY+   N YCPG T +CK E ++I  NI  D  +N KI+K+ VKCPE  C+   EL  +E+H+R+C  +S  CP+  +GC++  +    +T+HLQ+  F H+KL++D + N  N+         GL+     LR +IN +K
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFF-------GLTTKEVELREDINLIK 186          
BLAST of TNF receptor associated factor 4 vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 3.610e-34
Identity = 120/444 (27.03%), Postives = 207/444 (46.62%), Query Frame = 2
Query:  164 IEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCEN--RYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQ--DKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILK-ANNNGLSPVNELLRNEINELKLDG--DRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQM--ENKQ-KVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            I D + C++C+ +L++A    CGCR+C  C+  YL EN  + C  + EDC+    S+  + + DR  N +IS L VKC    C F+  L+ ++ H+  C Y+       N  C  C +     + ++HL +E      LL + +  +   +   K  N + L   +  L  +   +   G     +V +   ++ C N+  E  L   D   L                 I  +Q+      + ++  +    T  ++ E + K + +++  +  EN+  K  L  M   + K SG++ R      AN+    NG+++WK+  F+    +A  G N  I SE+F T   G+KMC+ +YP GDG GKG HLS+FF +MKG++D IL WPF++ V   + +  ++  + S    ++ D     + +P  +     G  +FIS  +L
Sbjct:   25 INDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYL-ENGEKECVAEYEDCR----SVITSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYR-------NEMCSLCGMEYIIKEESNHLANEC-----LLREVLCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQL-----------------IPKDQMTEHLNTSSYEHTLT-IVTELRKLEKQNKHMEERMNILIEENQLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSD--TFKPDPKSICYQRPEEEYNIASGSPKFISFSEL 431          
BLAST of TNF receptor associated factor 4 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 133.265 bits (334), Expect = 3.087e-32
Identity = 104/362 (28.73%), Postives = 168/362 (46.41%), Query Frame = 2
Query:  428 KMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVN-ELLRNEINELKLDGDRRRVEIGDL------QRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQ----RINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVS 1414
            K  DHI++C    + C +  +GCD  ++ ++K+ DH ++  + H  LL+ F++        +K N   L P + EL  ++I EL        +++G L      Q  CA        L      L      V   L+ LQL  E             + ++A+ +  CQ+ E+K            +E+      ME  N+Q      K+++  ++NK+ +L   V   D  ++EM     +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCL +Y +GDG G+G HLS+FF +M+G  D +L+WPF   VT  L++Q  R         +  DI   +F +PVS
Sbjct:  201 KYVDHIKLCTKFRTPCRFHVVGCDM-SVEKEKIHDHERACSYEHLNLLLHFIMG-------IKVNLESLQPQSLELASHKIQELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPTLATSFTPLPTT---VGAALE-LQLHSE-------------KTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEI--LNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVS 532          
BLAST of TNF receptor associated factor 4 vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 117.857 bits (294), Expect = 1.166e-27
Identity = 110/480 (22.92%), Postives = 210/480 (43.75%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNI--SQDKVTDHLQSEIFVHTKLLMDFVVN-FNNEMEILKANNNGLSPVNELL-RNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQL------IIEGNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIG---QMENKQKVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  YDY+ + + +    C LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  +  +I  L ++C   E  C +  ++++++ H   C +    CP      ++C +  ++  + +HLQ +     K+  +F  + F  E      N+ G+ P   +   N+     +    RR+       +C  + +  +   ++          V D +   Q       +   NQ     +A   +    ++        C   +   K    K+     +E   K  LT M + + +    +    R++ E++ + +    G  +WKL+ ++ K+ +AK   N   +S  F TH+ G+K+ +S + +G+G G+G+HLS++  ++ GE+D +LEWPF + VTF++++Q     ++  H +   +   D +   F KP S   S       FG+ +FISH ++
Sbjct:    1 MPGYDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCP------NRCAVKLTRRDLPEHLQHDC-PKRKVKCEFCGSEFTGEA---FENHQGICPQESVYCENKCGARMM----RRLLAQHTMAECPKRTQPCKYCGKEF---------VYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTKSHLTMMCSLVGRQRQEIIELRREMEELSVSHD----GVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFN--PDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 117.472 bits (293), Expect = 3.638e-27
Identity = 93/371 (25.07%), Postives = 171/371 (46.09%), Query Frame = 2
Query:  383 VKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRN---EINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSA 1471
            V+CP   C    +  K++DH   C  Q + C Y   GC   N  + +V  H Q+E   H  LL             L++N+  +  V++L ++   +  ELK     R + + +L+R+ +     +  +   +   R +  +V   L  L+ ++E +      V++RA  +  ++Q+A             + L + +G +    +     +   + +L  +  R        ++   +G+ +WK+  +  K  +A   +N    S  F T  +G+K+   VY  G+G  +G HLS++  LM+G+FD +L WPFR +VT A+++Q     H S  L +  D+  + F +P S+  +  GF +FI+H DL A
Sbjct:  195 VQCPNK-CIHLVKRHKLKDHADECPEQETDCIYKKYGCTVRN-KRGQVKVHEQTEFNHHVLLL-------------LESNSKLIKQVDQLQQDFAAQQGELK----ERNLLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQVAM-----------TQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQR----FQQLESTSYDGKLIWKVHDYHRK-KEAGTALN----SPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVS--LSFTPDLASNNFRRPTSETNAALGFPRFITHADLEA 524          
BLAST of TNF receptor associated factor 4 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 112.464 bits (280), Expect = 1.363e-25
Identity = 85/320 (26.56%), Postives = 147/320 (45.94%), Query Frame = 2
Query:  473 CPYSNIGCD-KCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDL---QRKCANQAEEIEL-LNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSK 1417
            C +S IGC  K N   DKV +H  S    H  LL++ V N    +           P    ++    +L L+G     + GD     +  +   ++ EL + + + AL+   + + + +  L   +E  Q+ +  +E D    +                LI  +  +  +Q+  L     +I  L  ++       +A Q+   +G F+W++   + K+ +A  G  +  YS +F T + GFK+C+ +Y  GDG GKG H+S+FF +MKG++D +L WPF+  VTF LI+Q  R         +  D+   +F +PVS+
Sbjct:  196 CVFSEIGCTFKGN--PDKVREHEVSSTSAHLHLLVEVVRNVQMSVP---------PPPERTVQYPALDLTLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNM---------------NLIQHLEAVVAEQQQRLIRKDLQISSLQQSI-------SAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDA---FRPDLRSASFQRPVSE 479          

HSP 2 Score: 51.6026 bits (122), Expect = 2.276e-6
Identity = 38/115 (33.04%), Postives = 50/115 (43.48%), Query Frame = 2
Query:  176 MLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENR--YC------PGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGC 496
             LC  C  +L  AH   CG R+C  CV   L  N+   C      PG   D  + L    ++   D  +N +I +L V C    C ++S L+  EDH   C Y    C   NIGC
Sbjct:   27 FLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMML--TLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor associated factor 4 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 112.079 bits (279), Expect = 2.073e-25
Identity = 85/324 (26.23%), Postives = 151/324 (46.60%), Query Frame = 2
Query:  473 CPYSNIGCD-KCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNE----INELKLDGDRRRVEIGDL---QRKCANQAEEIEL-LNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSK 1417
            C +S IGC  K N   DKV +H  S    H  LL++ V N    +            ++  L+N+    + ++ L+G     + GD     +  +   ++ EL + + + AL+   + + + +  L   +E  Q+ +  +E D    +                LI  +  +  +Q+  L     +I  L  ++       +A Q+   +G F+W++   + K+ +A  G  +  YS +F T + GFK+C+ +Y  GDG GKG H+S+FF +MKG++D +L WPF+  VTF LI+Q  R         +  D+   +F +PVS+
Sbjct:  206 CVFSEIGCTFKGN--PDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPALDLHLQNQDMTPLPDITLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNM---------------NLIQHLEAVVAEQQQRLIRKDLQISSLQQSI-------SAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDA---FRPDLRSASFQRPVSE 502          

HSP 2 Score: 51.9878 bits (123), Expect = 2.143e-6
Identity = 38/115 (33.04%), Postives = 50/115 (43.48%), Query Frame = 2
Query:  176 MLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENR--YC------PGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGC 496
             LC  C  +L  AH   CG R+C  CV   L  N+   C      PG   D  + L    ++   D  +N +I +L V C    C ++S L+  EDH   C Y    C   NIGC
Sbjct:   27 FLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMML--TLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor associated factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 1.213e-30
Identity = 101/408 (24.75%), Postives = 176/408 (43.14%), Query Frame = 2
Query:  284 CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEI----LKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLD--GLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKL--LEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPEL 1483
            CP   E CK    ++T +++ +R    + ++  + CP    E      ++  H+  C   +  C +  +GC     + + V +H +S +  H  L    V++ N+E+E+    L+ +    + ++E+L   + +L+ D        G    +  +  E +   NE + +L    R      D   L+  +   +  +RA+E         C   C   E                Q++ +       D L    +R+L  LE A       +G+ VWK+  +  +  +A +G    +YS+ F T   G+KMC   Y +GDG G+G HLS+FF +M+GE+D +LEWPFR  VT +L++Q     H S    +  D    +F +P        G   F+SH  L  +  L
Sbjct:   29 CPHRAEFCKYCSAAVTCSLL-ERHHKEECAQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTL----VISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNP-GPCEERCHMHE----------------QRLTMH------DGLLDTAERRLQVLETAG-----YSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSD--TFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYL 401          
BLAST of TNF receptor associated factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 3.974e-29
Identity = 97/391 (24.81%), Postives = 171/391 (43.73%), Query Frame = 2
Query:  362 VKISKLLVKCPEVLCEFQSELRK-MEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGD-----------LQRKCANQAEEIELLNEDIPAL-RNVDRN-VSDRLDGLQLIIE--GNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSG-NVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPEL 1483
             +  +  + CP   CE QS  R+ +  H+ +C Y+ ++C +S  GC K   +   + +H       H  L+     N   ++ +L++     +   +LL   + EL    ++  + +G            +QR  A Q E +  L E +    R  D + +   LDG    +   G +VA  A+E                  +       ++  +++      T++     +L+  ++  ++LE A+      NG+ VWK+  +  +  DA +G    +YS+ F T   G++MC   Y +GDG G+G HLS+FF +M+GE+D +L WPFR  VT  L++Q       S    ++ D    +F +P S      G   F+SH  L +   L
Sbjct:   96 TRCPRYPIPCPNK-CEEQSIAREELVSHLGICPYKQAECFFSQFGC-KYKGTLQGLKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVREL----EKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQESMQGTTRRADHDALRGDLDGTAATLHELGTRVA--AIEES-------------GGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETAS-----YNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSD--TFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYL 458          
BLAST of TNF receptor associated factor 4 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 81.6481 bits (200), Expect = 2.040e-16
Identity = 109/510 (21.37%), Postives = 206/510 (40.39%), Query Frame = 2
Query:  134 KSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRYCPGDTEDCKLELISITEN-IMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCN--ISQDKVTDHLQSEIF------VHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEIN-ELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRL--DGLQL----IIEGNQVAMRAVEN---------------DFQQQIA--------QCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSG------NVDRKLLEMAANQNQRI-NGEFVWKLDKFTDKMAD------AKNGIN----AIIYSESFLTHKNGFKMCLSV-------YPDGDG------GGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTR-LAHFSGDLDYELDIDGDAFCKP-VSKCGSEFGFHQFI 1450
            + Y+ +    +E +  C +C   L      PCG RFC  C+   +      P     C ++   + E  +  D     +I  L V+CP   C  + ELR +++H         +C Y+ + C +C   + +  +  H + E        +H    M +  + N+E        N      EL+R ++   L++D  + +V        C     E +++   + A  +    V  RL  +GL++    + +G Q +  A  +               D Q   A        + A +C Q   + +E+   + +    Q   + E+S K D   G       + R L    A    R+  G F W++++F+  +        A +G++    A+++S  F T   G+++CL +        P G         G+  HL++F HL++G++D  L WPF+  +  ++++Q  R   H +  +D +  +   AF +P V +    FG+  F+
Sbjct:   49 QGYEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGP----KCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEH-------QLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNHEQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGC-----EAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQL--SAFQRPSVHRNPKGFGYMNFM 540          
BLAST of TNF receptor associated factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 9.125e-8
Identity = 30/133 (22.56%), Postives = 61/133 (45.86%), Query Frame = 2
Query:  920 EIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLL----EMAANQNQRINGEFVWKLDKFTDKMADAKNGIN--AIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPF 1300
            +++  E   + G ++  +   L     +++      +R +L     +A  +N   NG F+WK+    +++ +A NG      I S +F T + G+++ L +   G+      H+S +  L  G +D  L WP+
Sbjct:  269 DVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAMLGPGPYDATLAWPY 395          
BLAST of TNF receptor associated factor 4 vs. Ensembl Sea Lamprey
Match: rnf41l (ring finger protein 41, like [Source:ZFIN;Acc:ZDB-GENE-030131-9441])

HSP 1 Score: 48.9062 bits (115), Expect = 2.247e-7
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 2
Query:  137 SYDYET-IGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVL--CEFQSELRKMEDHIRMCNYQSSQCPYSN 487
             YD E  +G ++D +LC +C+ +L +   APC   FC  C+  +L  N  CP D +      +  +E   + R M   ++ L + C      CE    L  +  H + C Y  + CP++ 
Sbjct:    2 GYDAERFVGRVKDGLLCCVCRDVLEDPLQAPCEHAFCSACIHGWLVHNHTCPEDRQP-----LDASELRPLFRYMRNDLNALRLHCTHRARGCEGVCALETIAIHEQQCPYTPTPCPHTG 116          
BLAST of TNF receptor associated factor 4 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 139.813 bits (351), Expect = 5.317e-35
Identity = 131/515 (25.44%), Postives = 215/515 (41.75%), Query Frame = 2
Query:  155 IGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCP--EVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGC-------------DKC------------NISQDKVTDHLQS-------------------EIFVH-------TKLLMDFV---VNFNNEMEILKAN--NNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNV------DRKLLEMAANQNQ--------------RINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDL 1465
            +  ++ +  C +C   L +    PCG RFC  C+   L     CP D E+ K++   + +++   R    +I  L   CP  ++ CE+  +L+ +E+H   C Y+  QC   N GC             ++C             I    + DHLQ+                   E+  H        +L   F     +F    E L+ +  +     VN LL    NE K   +    ++  ++++ A Q E++    E +       R    +L+    +IE +    R    + +++I       Q+ E   +E   ++G +EN+        S     + G +      DR   ++A +  Q                +G ++WK+D++T +  +  +G    IYS  F   + G+K C  VYP+GDG GKG+HLS+FF LM+GEFD +L WPFR  VTF L++Q     H  GD  +  D    +F +P S      G   FISH +L
Sbjct:   12 VEPLDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSKCPVDGEELKID--GVFKDVCCRR----EILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQC--HNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMA-AKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLN----VIERSVAEQRRELAELKERI-----QLQEVEAAIREQDRRLGMIENEASRGAAPSSGP-GSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDR--VHDIGDT-FRPDPTSSSFKRPTSNMNIASGCPLFISHTNL 504          
BLAST of TNF receptor associated factor 4 vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 130.183 bits (326), Expect = 8.168e-32
Identity = 86/330 (26.06%), Postives = 152/330 (46.06%), Query Frame = 2
Query:  365 KISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLL-------MDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQ 1333
            K     ++CP      + E +K+  H R C    + C +S +GC    + +  + +H    +  H  LL          ++   N++E     N       E  + E  ++K   + +   +G +++  ANQ  +I                +  R D   L+    +V MR       +   +    C  + +K+ E+ D      NK    L+++ + I      + ++ L +   Q    +G F+WK+DKFT++ A+AK+G    IYS  F TH+ G+K+C  ++P+GDG  + N+LS+F  LM+GE+D IL WPF+ ++T  LI+Q
Sbjct:  155 KCPAFPIECPNECGVKRIERKKLSAHTRECPNALTDCRFSPLGCTY-KVKKIALREHQNKHVIKHMILLGRTTGEPQPNLLELENQLERFDGENTSFKTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIA--------------EIWMRFDQENLV---GEVRMRDKLKK-FKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQ 465          
BLAST of TNF receptor associated factor 4 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 121.709 bits (304), Expect = 2.645e-29
Identity = 105/408 (25.74%), Postives = 182/408 (44.61%), Query Frame = 2
Query:  140 YDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRY--CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGD-LQRKCANQAEEIELLNEDIP-ALRNVDRNVSDRLDGLQLIIEGNQVAMRAVEN----DFQQQIAQCATNCQQAEIK-QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR 1336
            YD E +  + +E  C +C   L       CG RFC  C+ E         CP D E      + + +++ +D+     I   LVKCP   C++++ELR +E H R C+Y+   C  SN  C    + +  V +HL  E     +L++       +   + KA+            N +   +L     R+++ + L  +C  +    E   ++ P  L+    N  D+   L     G Q+    + +    + Q  +  CA      E++ Q  L+D+      +  +++T     + + SG    +L +     N+ +   FVW++  F D +  AK G+   + SE F T KNG+K+  ++YP+G   GK  H+S F  + +GE+DGIL WPF   +   L++Q+
Sbjct:   11 YDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREP-----LDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTC--SNPMCSA-QLPRMDVDEHLLVE--CDWRLIVCEYCGDESPYCLQKAHARNCDYKLVTCSNPMCSAQLP----RMDVDEHLLVECDWRLIVCEYCGDESPYCLQKDHSNQCDKFPVLCPNDCGTQITREKLRDHQSEECQFAVVPCAFRDFGCEVEIQNRLMDQHLDTNIQSHLNMTCNQLLLSRDSGAQFHELQQGLGRVNELLKMRFVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQK 404          
BLAST of TNF receptor associated factor 4 vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 114.775 bits (286), Expect = 5.013e-27
Identity = 125/479 (26.10%), Postives = 204/479 (42.59%), Query Frame = 2
Query:  128 SMKSYDYETI-GEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC---PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLL----MDFVVNFNNEMEILKANNNGLSPVN------ELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEI---KQKELIDKIGQMENKQKVDLTEMSNKIDKL--------SGNVDRKL----LEMAAN--QNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLD-YELDIDGDAFCKPVSKCGSEFGFHQFISHRDLS 1468
            +M  Y+  T    I  + LC  C+ ++ +A    CG R+C  C+S  L      P   + C    I+  E    D+  + +I +L V C   P   C ++ ELR  ++H   C +    C +   G     +S  K+ +HLQ+E     +         VV     M+          PVN      EL+R E++      + R +E G   R C N  E +E     I  L      +   ++GLQ +     +   A+  D  +++A         E+   +    +D++ +   +  V L E  + I +L         G   R L    LE   N  Q    +   +WK+    +K ++A +G     YS  F T  +G+KMC  +Y +GDG G+ +H+S+FF +M+GEFD +L WPFR  VT  L++Q   + H    +D +  D    +F +P ++     G   F SH  L+
Sbjct:    5 AMVGYEIATTDTAIAAKHLCAKCRLIVKDAVQTACGHRYCSPCISPLLSRG---PIQCDVCG-STITKPETFR-DKFADREILELHVHCVNQPHG-CPWEGELRHRQNHHTKCEFNPISCVHPECGK---KLSVAKLPEHLQNECQYREETCSYCEQPVVVA---RMKEHHEKTCPSYPVNCPKCSKELIRVEVHSTPFTREPR-LEKG---RGCENTLEVLEDHESRIKKLEQRGGGIG--VNGLQSMRISENIDNEAI-GDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQ-DNVEHV---IDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLT 460          
BLAST of TNF receptor associated factor 4 vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 107.071 bits (266), Expect = 1.679e-24
Identity = 111/461 (24.08%), Postives = 199/461 (43.17%), Query Frame = 2
Query:  155 IGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCP--EVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEM--EILKANNNGLSPVNELLRNEINELKLDGDRRRVE--IGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDR-LDGLQLIIEGN----QVAMRAVE----NDFQQQIAQCA---TNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRT-RLAHFSGDLDYELDIDGDAFCKPVSKCGS-EFGFHQFISHRDLSA 1471
            +  + + +LC +C   + NA   + CG RFC  C++  L E R  CP D        I  ++ +  D   N  I  L V C   +  C+++ +LRK++ H+  C + S+ C  S   C    I + ++++H   +               + E     L+  N G      L+ + +   +  G+R RV+     ++  C N+    +  N +I   R  DR    +      L    N    Q+    VE     D +  I QC      C + +  Q+ L   I +   +    ++E++ +  K   +    L E+  +     + + +W++D F +   + K      ++S  F T   G+K  + ++P G+G G+G HLS++  L+ GE+D +L WPF   +T  L++Q T + A       +  D +  +F +P     S  FG+ QF+SHR L +
Sbjct:    9 VPAVRENLLCRICHLPVRNAVQVSVCGHRFCDSCLNHALGETRLRCPVDNT-----AIDYSQ-VYADDVTNQMIMSLTVICDYYQAGCKWKGQLRKLQGHLAECKFVSADCSNS---CGA-RIQKRRMSEHTSKDCPKRRVCCARCKAEMSYEQLRVSLRYRNEG-----ALVSDHVTCPRNCGERMRVQDKARHMREDCLNRWVFCQYCNTEI-VFR--DRQTHHQSCPSFPLSCPNNCGVAQIPRGEVELHLSRDCRSNIMQCPFRHVGCHK-QFPQRSLQRHIEESVQQHLELVSELAIQQQKEINS----LKEIVRHCKPYHDSKLLWRIDDFWEAFDEGKRKPGTELHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKRHISQSFSPDPNWKSFQRPSKNSTSLGFGYPQFVSHRGLES 446          
BLAST of TNF receptor associated factor 4 vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 130.568 bits (327), Expect = 2.539e-31
Identity = 101/361 (27.98%), Postives = 169/361 (46.81%), Query Frame = 2
Query:  428 KMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIG-----DLQRKCANQ-AEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQN----QRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVS 1414
            K  DHI+ C+   + C +  +GCD  ++ ++K+ DH +   + H  LL+ F++     +E L+     L   ++ L +E+++   D + R  ++G      LQ  CA   A     L+  + A              L+L ++  +            ++A+ +  CQ+ E+K            +EL      ME  N+Q      K+++  +SNK+ +L   V   D  ++EM            +G F+WK+  FT K  DA  G    ++S +F T K G+KMCL +Y +GDG G+G HLS+FF +M+G  D +L+WPF   VT  L++Q  R         +  DI   +F +PVS
Sbjct:  202 KYVDHIKFCSKFKAPCRFHVVGCDT-SVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQR--LEVASQKL-HELHQSLRDLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGA-------------ALELQLQSEKT-----------KVAELSRRCQELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDKIEI--LSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVS 529          
BLAST of TNF receptor associated factor 4 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 123.25 bits (308), Expect = 1.765e-29
Identity = 107/439 (24.37%), Postives = 189/439 (43.05%), Query Frame = 2
Query:  167 EDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYL-CENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVL--CEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSAN 1474
            E +  C  C+ +L       CG RFC+ C+++ L C N  CP D E          + I  D   + +I  L V C      C+ Q  L+++ DH+ +C +    CP   +G  K  + + ++ +HL  +   + +   +F  N     E+ K              N      L    + +         ++  E++  L  ++ +L    R + D ++ L+  ++  +  + A+E              Q      +  +++   M +  ++ L +M  +          ++LE A+      NG  +WK+  +  +  DA  G    +YS+ F T   G+KMC  VY +GDG GKG HLS+FF +M+GE+D +L WPF+  VT  L++Q     H  GD  ++ D    +F +PV++     G   F+S   L + 
Sbjct:   43 EAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPL------FKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCP---LGKCKERMMRKEIPEHLAWKC-KYRESTCEFCKNKMPLTELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLM---------SSHTEKLLELELELRSL----RQLRDEMESLRGTLDTVRTRLSALE--------------QGGRASLETQLNRHDDMLSVHEIRLADMDLRF---------QVLETAS-----YNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHL-GDA-FKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLESG 428          
BLAST of TNF receptor associated factor 4 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 122.479 bits (306), Expect = 3.942e-29
Identity = 111/475 (23.37%), Postives = 213/475 (44.84%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNI--SQDKVTDHLQSEIFVHTKLLMDFVVN-FNNEMEILKANNNGLSPVNELL-RNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIE-GNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIG---QMENKQKVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +    C LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  +  +I  L ++C   E  C +  ++++++ H   C +    CP      ++C++  ++  + DHLQ +     K+  +F  + F  E      N+ G+ P   +   N+     +    RR+       +C  + +  +   ++       D   + +    +  ++  NQ     +A   + N  +         C   +   K    K+     +E+  K  LT M N + +    +    R++ E++ + +    G  +WKL+ ++ K+ +AK   N   +S  F TH+ G+K+ +S + +G+G G+G+HLSV+  ++ GE+D +LEWPF + VTF++++Q     ++  H +    +  D +   F KP S   S       FG+ +FISH ++
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCP------NRCSVKLTRRDLPDHLQHDC-PKRKVKCEFCGSEFTGEA---FENHQGVCPQESVYCENKCGARMM----RRLLSQHGMAECPKRTQPCKYCGKEF----VFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSRQRQEILELRREMEELSVSHD----GVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITE--TFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 122.479 bits (306), Expect = 5.552e-29
Identity = 111/475 (23.37%), Postives = 213/475 (44.84%), Query Frame = 2
Query:  131 MKSYDYETIGEIEDEMLCLLCKKLLVNA-HSAPCGCRFCFVCVSEYLCENRY-CPGDTEDCKLELISITENIMVDRPMNVKISKLLVKC--PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNI--SQDKVTDHLQSEIFVHTKLLMDFVVN-FNNEMEILKANNNGLSPVNELL-RNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIE-GNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIG---QMENKQKVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQR----TRLAHFSGDLDYELDIDGDAFCKPVSKCGS------EFGFHQFISHRDL 1465
            M  +DY+ + + +    C LC K +      + CG RFC  C+ E+L E  + CP D      +L      I  D  +  +I  L ++C   E  C +  ++++++ H   C +    CP      ++C++  ++  + DHLQ +     K+  +F  + F  E      N+ G+ P   +   N+     +    RR+       +C  + +  +   ++       D   + +    +  ++  NQ     +A   + N  +         C   +   K    K+     +E+  K  LT M N + +    +    R++ E++ + +    G  +WKL+ ++ K+ +AK   N   +S  F TH+ G+K+ +S + +G+G G+G+HLSV+  ++ GE+D +LEWPF + VTF++++Q     ++  H +    +  D +   F KP S   S       FG+ +FISH ++
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPED------QLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCP------NRCSVKLTRRDLPDHLQHDC-PKRKVKCEFCGSEFTGEAF---ENHQGVCPQESVYCENKCGARMM----RRLLSQHGMAECPKRTQPCKYCGKEF----VFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSRQRQEILELRREMEELSVSHD----GVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITE--TFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEI 445          
BLAST of TNF receptor associated factor 4 vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 110.923 bits (276), Expect = 6.379e-25
Identity = 118/525 (22.48%), Postives = 226/525 (43.05%), Query Frame = 2
Query:  122 WESMKS---YDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRYCPGDTEDCKLELISITEN-IMVDRPMNVKISKLLVKCP-EVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQS------EIFVH------TKLLMDFVVNFNNEMEILKANN-NGLSPVNELLRN--EINELKLD-----------GDRRRVEIGD------------------------LQRKCANQAEEIEL-------LNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQ-KELIDKIGQ---MENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQ-------RINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGS--EFGFHQFISHRDLSA 1471
            WES  +   +  + + ++++E +C +CK +++N     CG  +CF C+ + L E+    G    C +E  +IT + +  D     +IS L V C    LC     L ++++H++ C Y+   C  SN GC +  + +  + +HL +      E   H        ++ D V +   E+++   +  + L P N L  +     E+  D           G RR+V++ +                        +Q++   + +E++        L E + ++    R+    +   Q  +   + A+ +V+ D QQ    C       E+++ K  +D + Q        +  +  +     + SG ++  + ++A N+           +G  +WK+  F  +      G +  + S  F T + G+KM +  Y +GDG G+G HLS++  LM G+FD +L WPF+ +V+ ++++Q     H S   ++  D     F +P ++  S    GF  FIS   L A
Sbjct:   45 WESELASLQHSLKFVMKLKEEFICPICKGVVLNPQQNSCGHIYCFHCL-QGLLESSLLSGPV--CPVEKAAITPSEVFQDNCCKREISSLEVYCTNSPLCTSVLALNQLQEHLKSCQYEQLLC--SNPGCTEL-LQRRLLQEHLNATCPHRRESCPHCLQPFQLSVIQDHVQSSCPEVKVGCPDGCSTLVPRNRLTEHGESCPEVHTDCSFKMFGCSVKGKRRKVKLHEEAAVCHHVLLVLKSSAHLEQQVVFVQKEALLRQQEVQTDTLLLSDLQEQLGSVLQQSRSQEHIVATAQRTLSRQEDALSSVQLDLQQ--VSCGMGSGLDELRRFKTSLDGVMQELLAAETLREHIATLEENRKRHSGLLELHVAQLALNKQHLQELELTSYDGRLIWKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQS--FNFRPDPTNTCFHQPAAESASNVAVGFPCFISLDALEA 559          
BLAST of TNF receptor associated factor 4 vs. Planmine SMEST
Match: SMESG000025980.1 (SMESG000025980.1)

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 373/462 (80.74%), Postives = 409/462 (88.53%), Query Frame = 2
Query:  101 ATKLENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYL-CENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPEL 1483
             +KLEN+ + M+ Y+YE++ EI+++MLCLLCKKLLVNA  APC CRFCF C+S++L  + + CPG+TE+CK E++ + ENI VD PMN+KI+KL VKC E+ C++  ELRKMEDH R C Y+S  CPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEF+WKLDKFTDKMADAK GINA IYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRL H S   +     +   F +P  +     GF +F+SH +LS+NP+L
Sbjct:    3 GSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDFLDHKKKNCPGNTEECKQEMLHLNENICVDYPMNMKIAKLQVKCKEMSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKKGINAFIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKITECANYPNNKEFIQPTDRNAGR-GFARFVSHEELSSNPDL 463          
BLAST of TNF receptor associated factor 4 vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 338/462 (73.16%), Postives = 376/462 (81.39%), Query Frame = 2
Query:  101 ATKLENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYL-CENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPEL 1483
             +KLEN+W+ M+ Y+YE++ EI+++MLC LCKKLLVNA  APCGCRFCF C+S++L  + + CPGDTE+CK E++ + ENI VD PMN+KISKL VKC E+ C +  ELRKMEDH R C Y+S  CPYSNIGCDKCNISQDKVTDHLQSEIF HTKLLMDFVVNFNNEME+LKANNNGLS VNELLRNEINELKLDG+RRRVEI DLQRKCA+QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN                            QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEF+WKLDKFTDKMADAKNGIN  IYSESFLTHKNGFKMCL V PDG+GGGKG HLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRL H S  +      +  A  +P  +  +  GF +F+SH +LS+NP+L
Sbjct:    3 GSKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRVEIADLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN----------------------------QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQPTDR-NAGLGFPKFVSHEELSSNPDL 435          
BLAST of TNF receptor associated factor 4 vs. Planmine SMEST
Match: SMESG000025982.1 (SMESG000025982.1)

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 346/462 (74.89%), Postives = 381/462 (82.47%), Query Frame = 2
Query:  101 ATKLENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYL-CENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPEL 1483
             +KLEN+ + M+ Y+YE++ EI+++MLCLLCKKLLVNA  APC CRFCF C+S++L  + + CPG+TE+CK E++ + ENI VD PMN+KI+KL VKC E+ C++  ELRKMEDH R C Y+S  CPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN                            QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAK GINA IYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRL H S   +     +   F +P  +     GF +F+SH +LS+NP+L
Sbjct:    3 GSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDFLDHKKKNCPGNTEECKQEMLHLNENICVDYPMNMKIAKLQVKCKEMSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN----------------------------QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAFIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKITECANYPNNKEFIQPTDRNAGR-GFARFVSHEELSSNPDL 435          
BLAST of TNF receptor associated factor 4 vs. Planmine SMEST
Match: SMESG000025934.1 (SMESG000025934.1)

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 334/402 (83.08%), Postives = 364/402 (90.55%), Query Frame = 2
Query:  101 ATKLENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRH 1306
             +KLEN+W+ M+ Y+YE++ EI+++MLCLLCKKLLVNA  APC CRFCF C+S+YL +N  CPG+TEDCK E++ + ENI VD+PMN+KISKL VKC E+ C++  ELRKME+H R C Y+S  CPYSNIGCDKCNISQDKVTDHLQSEIF HTKLLMDFVVNF+NEME+LKANNNGLS VNELLRNEINELKLDG+RRR EI +LQ KCA+QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDK SGNVDRKLLEMAANQNQRINGEF+WKLDKFTDKMADAK GINAIIYSESFLTHKNGFKMCL V PDGDG GKG HLSVFF LMKGEFDGILEWPF H
Sbjct:    3 GSKLENVWQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQEVLYLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRACKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFHNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQMKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKSSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 404          
BLAST of TNF receptor associated factor 4 vs. Planmine SMEST
Match: SMESG000025901.1 (SMESG000025901.1)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 342/495 (69.09%), Postives = 379/495 (76.57%), Query Frame = 2
Query:  104 TKLENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCFVCVSEYLCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRR-----------------------------------VEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPEL 1483
            +KLEN+W+ M+ Y+YE++ EI+++MLCLLCKKLLVNA  APC CRFCF C+S+YL +N  CPG+TEDCK E++ + ENI VD+PMN+KISKL VKC E+ C++  ELRKME+H R C Y+S  C YSNIGCDKCNISQDKV DHLQSEIFVHTKLLMDFVVNFNNEME+LKANNNGLS VNELLRNEINELKLDG+RRR                                   VEIGDLQRKCA+QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN                            QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDG G GKG HLSV+FHLMKGEFDGILEWPFRHSVT ALINQRTRL H S    Y  D +     +P  +  +  GF +F+SH +LS+NP+L
Sbjct:    4 SKLENVWQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQEVLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSEACLYSNIGCDKCNISQDKVEDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELRVNIICLNGENAAMRENMDKLISAGERNQVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN----------------------------QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGVGVGKGTHLSVYFHLMKGEFDGILEWPFRHSVTLALINQRTRLPHVSETTKYANDSNSKTLIQPTDR-NAGLGFPKFVSHEELSSNPDL 469          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF55.754e-3025.87TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF55.754e-3025.87TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF55.754e-3025.87TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF43.182e-2923.31TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF36.551e-2926.42TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-19.012e-1833.98TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-28.916e-1434.78TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.163e-1832.35gene:FBgn0026319 transcript:FBtr0077429[more]
Traf41.470e-1832.35gene:FBgn0026319 transcript:FBtr0334401[more]
Traf-like3.526e-927.37gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like3.526e-927.37gene:FBgn0030748 transcript:FBtr0074274[more]
Traf-like3.526e-927.37gene:FBgn0030748 transcript:FBtr0334036[more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a7.747e-3227.81Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf4a1.264e-2823.13tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a1.264e-2823.13tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
BX901915.17.399e-2733.01pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.17.399e-2733.01pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh27.701e-3123.52slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
sytl21.458e-2821.88synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
ssh27.432e-2823.45slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
hspb61.853e-2641.27heat shock protein family B (small) member 6 [Sour... [more]
slc12a19.290e-2425.27solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf45.423e-3023.86TNF receptor associated factor 4 [Source:MGI Symbo... [more]
Traf35.020e-2926.42TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.513e-2823.31TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.513e-2823.31TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf21.764e-2437.58TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00463|TRAF5_HUMAN2.763e-2925.87TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|Q61382|TRAF4_MOUSE3.793e-2923.86TNF receptor-associated factor 4 OS=Mus musculus O... [more]
sp|Q9BUZ4|TRAF4_HUMAN1.528e-2823.31TNF receptor-associated factor 4 OS=Homo sapiens O... [more]
sp|Q13114|TRAF3_HUMAN3.146e-2826.42TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE3.511e-2826.42TNF receptor-associated factor 3 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWW31.793e-9187.35TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
T1E1019.493e-4526.59TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A5A9NXF11.541e-3427.41TNF receptor-associated factor OS=Triplophysa tibe... [more]
I1ZID82.719e-3440.00TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1DBK63.610e-3427.03TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a3.087e-3228.73TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf4a1.166e-2722.92TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf53.638e-2725.07TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf11.363e-2526.56TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf12.073e-2526.23TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002130.11.213e-3024.75pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.13.974e-2924.81pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf62.040e-1621.37TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.19.125e-822.56pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
rnf41l2.247e-727.50ring finger protein 41, like [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494645.317e-3525.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352378.168e-3226.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412432.645e-2925.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388735.013e-2726.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377501.679e-2424.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.22.539e-3127.98TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf31.765e-2924.37TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a3.942e-2923.37TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a5.552e-2923.37TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSORLT00000001369.26.379e-2522.48TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025980.10.000e+080.74SMESG000025980.1[more]
SMESG000025794.10.000e+073.16SMESG000025794.1[more]
SMESG000025982.10.000e+074.89SMESG000025982.1[more]
SMESG000025934.10.000e+083.08SMESG000025934.1[more]
SMESG000025901.10.000e+069.09SMESG000025901.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032941 ID=SMED30032941|Name=TNF receptor associated factor 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2232bp
CATTATTTTTCATCAAGTTTTAATTATCAATTTAATATTTAAATCATAAT
ATAAAAAATCAAACCAAAATTTTATTCAAATTTTAATTTATATTAAAATG
GCTACAAAATTAGAAAATATTTGGGAATCTATGAAAAGTTATGATTATGA
AACAATTGGTGAAATTGAGGATGAAATGTTATGTTTGTTGTGTAAAAAAT
TATTAGTCAATGCGCACAGTGCTCCATGTGGATGCAGATTTTGCTTTGTT
TGTGTATCTGAGTATTTATGTGAAAATAGATATTGTCCGGGTGACACAGA
AGACTGTAAACTCGAATTGATTAGTATTACTGAAAATATTATGGTCGATC
GTCCAATGAATGTTAAAATATCAAAGTTGTTAGTGAAGTGTCCAGAGGTT
CTATGTGAATTTCAAAGTGAATTACGTAAAATGGAGGATCATATACGGAT
GTGCAATTATCAATCATCACAATGTCCATATTCCAATATCGGATGTGACA
AATGCAATATATCCCAGGATAAAGTTACGGATCATTTGCAATCTGAAATA
TTTGTGCACACAAAATTATTGATGGATTTCGTGGTCAATTTCAATAATGA
AATGGAGATTTTGAAGGCCAATAATAACGGGTTGAGTCCAGTGAATGAAT
TATTGCGAAATGAAATCAACGAATTGAAATTGGATGGCGACAGGAGACGA
GTTGAAATTGGAGATTTGCAGAGGAAATGTGCAAATCAAGCTGAGGAAAT
CGAATTACTGAATGAAGACATTCCGGCATTGAGGAATGTAGATAGAAATG
TGAGCGATAGATTGGATGGATTGCAATTGATTATCGAGGGCAACCAGGTG
GCCATGCGAGCAGTTGAGAACGATTTCCAGCAACAAATTGCCCAATGCGC
CACCAATTGCCAGCAAGCAGAAATTAAACAAAAAGAATTAATTGATAAAA
TCGGTCAAATGGAAAATAAACAAAAAGTAGATCTGACGGAAATGTCGAAT
AAAATTGATAAATTAAGTGGAAATGTCGACAGGAAATTATTGGAAATGGC
AGCCAATCAAAATCAGCGGATAAATGGAGAATTTGTGTGGAAGCTCGACA
AATTCACTGACAAAATGGCAGACGCAAAAAATGGAATCAACGCAATCATT
TATAGCGAATCATTTCTCACGCATAAAAATGGTTTCAAAATGTGTTTGAG
TGTGTATCCTGATGGAGATGGTGGTGGCAAGGGCAATCATTTGTCTGTGT
TCTTTCATTTGATGAAGGGCGAGTTTGATGGCATTTTGGAATGGCCATTC
AGGCATTCAGTCACATTTGCATTGATCAATCAGCGGACCCGACTGGCTCA
TTTCAGTGGTGATTTAGATTATGAGCTTGACATAGATGGTGATGCATTCT
GTAAGCCTGTTAGCAAATGCGGATCGGAATTCGGTTTCCATCAATTTATA
AGTCACAGGGATTTATCAGCAAATCCCGAATTATCTTTGAAAAATCAAAT
TTTCATTAAATTTAACATAAATATTGGATCCTGAACGACTCAAGTATAAT
TTTAACTACTGAAAACTTATTGCAATTATTGAATGACAATATTTTTCTAA
TTTTAGAATTTAAATGTACTTGATTGGACTTGAGAAATTGGAGAGTGGTT
AATATTGGATTACTTTTGGTGATTTATATTGAAGGCCTGTCAGCTATTAC
AGAAGGATAGTACACCATGACACATTAAATTGAACTGTAATAGCCATTAT
AGCGCACCCTTATAAGTTATTAACATTTATCTTTAAATTAGTTTTCATTA
AAAGTTTATATAAATGAAAAGGATTCTTACGTTAAAAAGCATTTTAATTC
CAGGTTGCCGATAATTGTCTTCGGAGGTCCTATTAAATTACCCTTGGTGT
ATCAAACTATGAATAAGCTGTAACAACCGTTCCTTTGTACATATTACTCA
ATTATCTAGCGACTAATGATGATGTAGCGTCATGCATATACTGTTGCATA
ATTCCCGGGTTTGACACAGCACGCTGGGTTATGTAATATTCTGTAATAAT
TTGTAAATTGCATTATTAGATAAAAATCACCCAAATGAAATGTTCATTTA
GGATTTTGTTTGAATGGAATTTTTTTTATATTCAAGTGCAAATTTTAAAT
GTATTATGCGATGTGATTGGAAACTTGTAGAGTATAAATCAAGGCTTTGC
AGTTGGAGTTAGACTCGCTGTGTTTTTTCCGG
back to top

protein sequence of SMED30032941-orf-1

>SMED30032941-orf-1 ID=SMED30032941-orf-1|Name=SMED30032941-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=479bp
MATKLENIWESMKSYDYETIGEIEDEMLCLLCKKLLVNAHSAPCGCRFCF
VCVSEYLCENRYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPE
VLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKCNISQDKVTDHLQSE
IFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRR
RVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQ
VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMS
NKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAI
IYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWP
FRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQF
ISHRDLSANPELSLKNQIFIKFNINIGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 86..106
NoneNo IPR availableCOILSCoilCoilcoord: 153..173
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 6..283
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 139..283
e-value: 4.7E-33
score: 116.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 208..283
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 6..283
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 208..283
score: 14.229