von Willebrand factor D and EGF domain-containing protein

Overview
Namevon Willebrand factor D and EGF domain-containing protein
Smed IDSMED30032931
Length (bp)2115
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of von Willebrand factor D and EGF domain-containing protein (SMED30032931) t-SNE clustered cells

Violin plots show distribution of expression levels for von Willebrand factor D and EGF domain-containing protein (SMED30032931) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of von Willebrand factor D and EGF domain-containing protein (SMED30032931) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for von Willebrand factor D and EGF domain-containing protein (SMED30032931) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032931

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032931SMESG000005380.1 SmedASXL_011232SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032931SMESG000005380.1 dd_Smed_v4_20318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032931SMESG000005380.1 dd_Smed_v6_20318_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Human
Match: VWDE (von Willebrand factor D and EGF domains [Source:HGNC Symbol;Acc:HGNC:21897])

HSP 1 Score: 179.104 bits (453), Expect = 4.163e-46
Identity = 87/198 (43.94%), Postives = 117/198 (59.09%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            C  E CN  CQ+ G C+    C CP G+ G  C+  +CN  C+NGG+C+ P+ICQC  G+ G  C    CD  C NGG C +PN C C  G+ G+ C+   C+PPC+ GG C + N+C C EG  G R +K  C P CMNGG C+G + C CP  +SG  C   IC  +C NGG+C+  ++C CP+ + G  C+  IC
Sbjct: 1357 CDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPICLQKCKNGGECIAPSICHCPSSWEGVRCQIPIC 1554          

HSP 2 Score: 164.851 bits (416), Expect = 1.711e-41
Identity = 85/204 (41.67%), Postives = 115/204 (56.37%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            +I   C    C+  C+N+G+C+K   C C  G+ G  C    CN  C++GG C+  N+C C  GF G  CE + C+  CENGGQCL P++C C  G+ G  C   +C+P C  GG C K N C CP G  G  C+   C+P C NGG C+  N C C + ++G   +  IC   C NGGKCVG + C CP+G+ G  C + IC+
Sbjct: 1320 YIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPICL 1523          

HSP 3 Score: 153.68 bits (387), Expect = 8.647e-38
Identity = 91/225 (40.44%), Postives = 115/225 (51.11%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRIC-ITGLKFRKIIKPVIVQFPVIVSNKMCIESTC 1994
            C   C  + +CV    C C  GY G  CQ  +C+  CKN GKCI PNICQC  G  G  C++  C+  C++GG CL  NLCTC +G++G  CE  +CN  C+ GG C   +IC C  G  G  C    C P C+NGG+C   N C CP  F G  C+N  C   C NGG C+  N+C C  G+ G   +  IC  T +   K + P     P   S K C    C
Sbjct: 1298 CKYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPIC 1522          

HSP 4 Score: 144.821 bits (364), Expect = 5.266e-35
Identity = 71/162 (43.83%), Postives = 92/162 (56.79%), Query Frame = 3
Query: 1422 ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKC-VGNMCQCPTGFFGPECKSRIC 1901
            IC   C    +C+ PNIC+C  G+ G  C+   CD  C+N G+C++PN+C C  G+ G  C++  CNPPCQ GG C  GN+C+CP G VG RCE   C   C NGG C+  + C C   + G  C   +C   C NGG C   N C CP GFFG  C++  C
Sbjct: 1297 ICKYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFC 1458          

HSP 5 Score: 133.65 bits (335), Expect = 2.132e-31
Identity = 73/168 (43.45%), Postives = 92/168 (54.76%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR 1817
            C    C+  C N G C K   C CP G+ G+ CQN  C+  CKNGG C+  N+C C EG+ G   +K  CD TC NGG+C+ P+ C+C  G+ GK C   IC   C+ GG C   +IC CP    G RC+   C P+C+ GG CI  N C C   +SG  CE  I  R
Sbjct: 1421 CSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPICLQKCKNGGECIAPSICHCPSSWEGVRCQIPICNPKCLYGGRCIFPNVCSCRTEYSGVKCEKKIQIR 1588          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Human
Match: VWDE (von Willebrand factor D and EGF domains [Source:HGNC Symbol;Acc:HGNC:21897])

HSP 1 Score: 149.058 bits (375), Expect = 1.509e-36
Identity = 82/191 (42.93%), Postives = 104/191 (54.45%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSR 1895
            C   C  + +CV    C C  GY G  CQ  +C+  CKN GKCI PNICQC  G  G  C++  C+  C++GG CL  NLCTC +G++G  CE  +CN  C+ GG C   +IC C  G  G  C    C P C+NGG+C   N C CP  F G  C+N  C   C NGG C+  N+C C  G+ G   + R
Sbjct:  752 CKYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKR 942          

HSP 2 Score: 143.28 bits (360), Expect = 1.136e-34
Identity = 71/162 (43.83%), Postives = 92/162 (56.79%), Query Frame = 3
Query: 1422 ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKC-VGNMCQCPTGFFGPECKSRIC 1901
            IC   C    +C+ PNIC+C  G+ G  C+   CD  C+N G+C++PN+C C  G+ G  C++  CNPPCQ GG C  GN+C+CP G VG RCE   C   C NGG C+  + C C   + G  C   +C   C NGG C   N C CP GFFG  C++  C
Sbjct:  751 ICKYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFC 912          

HSP 3 Score: 135.961 bits (341), Expect = 2.580e-32
Identity = 69/171 (40.35%), Postives = 95/171 (55.56%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSG-SFCENHI 1808
            +I   C    C+  C+N+G+C+K   C C  G+ G  C    CN  C++GG C+  N+C C  GF G  CE + C+  CENGGQCL P++C C  G+ G  C   +C+P C  GG C K N C CP G  G  C+   C+P C NGG C+  N C C + ++G  F + H+
Sbjct:  774 YIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKRHL 944          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Human
Match: TNC (tenascin C [Source:HGNC Symbol;Acc:HGNC:5318])

HSP 1 Score: 130.568 bits (327), Expect = 2.050e-30
Identity = 71/220 (32.27%), Postives = 100/220 (45.45%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C++ +C+  E       S   +KRCP +     C N G+CV  +C C  G+ G  C    C   C   G+C+    C C EG+ G  C +L+C   C + G+C+    C C  G+ G  C    C   C + G C  G +C C +G  G  C   +C   C N G C+   +C C   F+G  C    C   C+  G+CV   C C  GF G +CK + C
Sbjct:  356 CEEGQCVCDEGFAGVDCS---EKRCPAD-----CHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQ-CVCDEGYTGEDCSQLRCPNDCHSRGRCVEGK-CVCEQGFKGYDCSDMSCPNDCHQHGRCVNG-MCVCDDGYTGEDCRDRQCPRDCSNRGLCV-DGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRC 563          

HSP 2 Score: 129.413 bits (324), Expect = 5.277e-30
Identity = 83/256 (32.42%), Postives = 111/256 (43.36%), Query Frame = 3
Query: 1176 SPRSSWST--CSVTCGIGWQKRYRPCQDDECLEKENIKSEI-------RSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKC-KNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRICITG 1910
            S R ++ST  C   C  GW+     C + EC    +++             F  + C   +C   C + G+CV   C C  GY G  C   IC   C +  G C+   +C C +GF G  C K  C   C N G+C+  N C C  G+ G+ C + IC   C   G C  G  C C EG  G  C K  C   C   G C  + +C C + F+G  C    C   C+N G+CV   C+C  GF G +C    C  G
Sbjct:  162 SGRGNFSTEGCGCVCEPGWKGP--NCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVD-GLCVCHDGFAGDDCNKPLCLNNCYNRGRCVE-NECVCDEGFTGEDCSELICPNDCFDRGRCINGT-CYCEEGFTGEDCGKPTCPHACHTQGRC-EEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNG 411          

HSP 3 Score: 128.642 bits (322), Expect = 9.737e-30
Identity = 71/215 (33.02%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            C + +C+  E    E  S   Q RCPN+     C + G+CV+ KC C  G++G  C +  C   C   G+C+   +C C +G+ G  C   +C   C N G C+    C C  G+ G  C +  C   C   G C  G  C C EG +G  C++  C   C   G C+   +C C + F+G  C  H C + C N G+CV   C C  G+ G +C
Sbjct:  418 CVNGQCVCDEGYTGEDCS---QLRCPND-----CHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCVNGQ-CVCHEGFMGKDCKEQRCPSDCHGQGRCV-DGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDC 620          

HSP 4 Score: 128.257 bits (321), Expect = 1.008e-29
Identity = 66/208 (31.73%), Postives = 92/208 (44.23%), Query Frame = 3
Query: 1281 KSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            + E    F    C    C   C  +G+CV  +C C  GY G+ C    C   C + G+C+    C C +GF+G  C  + C   C   G+C+   +C C  GY G+ C  R C   C   G+C  G  C C +G  G  C +  C   C   G C+   +C C + F G  C+   C + C+  G+CV   C C  GF G +C    C
Sbjct:  391 RCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCV-EGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCV-NGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSC 594          

HSP 5 Score: 54.6842 bits (130), Expect = 7.701e-7
Identity = 24/72 (33.33%), Postives = 35/72 (48.61%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL 1517
            F+ K C  + C   C   G+CV  +C C  G+ G  C    C   C N G+C+    C C+EG+ G  C ++
Sbjct:  553 FMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGR-CICNEGYSGEDCSEV 623          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Human
Match: TNC (tenascin C [Source:HGNC Symbol;Acc:HGNC:5318])

HSP 1 Score: 129.028 bits (323), Expect = 6.799e-30
Identity = 69/220 (31.36%), Postives = 97/220 (44.09%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C++ +C+  E         F    C  + C   C N G+CV  +C C  G+ G  C    C   C   G+C+    C C EG+ G  C +L+C   C + G+C+    C C  G+ G  C    C   C + G C  G +C C +G  G  C   +C   C N G C+   +C C   F+G  C    C   C+  G+CV   C C  GF G +CK + C
Sbjct:  356 CEEGQCVCDEG--------FAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQ-CVCDEGYTGEDCSQLRCPNDCHSRGRCVEGK-CVCEQGFKGYDCSDMSCPNDCHQHGRCVNG-MCVCDDGYTGEDCRDRQCPRDCSNRGLCV-DGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRC 563          

HSP 2 Score: 127.487 bits (319), Expect = 1.780e-29
Identity = 83/256 (32.42%), Postives = 111/256 (43.36%), Query Frame = 3
Query: 1176 SPRSSWST--CSVTCGIGWQKRYRPCQDDECLEKENIKSEI-------RSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKC-KNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRICITG 1910
            S R ++ST  C   C  GW+     C + EC    +++             F  + C   +C   C + G+CV   C C  GY G  C   IC   C +  G C+   +C C +GF G  C K  C   C N G+C+  N C C  G+ G+ C + IC   C   G C  G  C C EG  G  C K  C   C   G C  + +C C + F+G  C    C   C+N G+CV   C+C  GF G +C    C  G
Sbjct:  162 SGRGNFSTEGCGCVCEPGWKGP--NCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVD-GLCVCHDGFAGDDCNKPLCLNNCYNRGRCVE-NECVCDEGFTGEDCSELICPNDCFDRGRCINGT-CYCEEGFTGEDCGKPTCPHACHTQGRC-EEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNG 411          

HSP 3 Score: 127.102 bits (318), Expect = 2.779e-29
Identity = 66/208 (31.73%), Postives = 92/208 (44.23%), Query Frame = 3
Query: 1281 KSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            + E    F    C    C   C  +G+CV  +C C  GY G+ C    C   C + G+C+    C C +GF+G  C  + C   C   G+C+   +C C  GY G+ C  R C   C   G+C  G  C C +G  G  C +  C   C   G C+   +C C + F G  C+   C + C+  G+CV   C C  GF G +C    C
Sbjct:  391 RCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCV-EGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCV-NGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSC 594          

HSP 4 Score: 126.716 bits (317), Expect = 3.114e-29
Identity = 71/215 (33.02%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            C + +C+  E    E  S   Q RCPN+     C + G+CV+ KC C  G++G  C +  C   C   G+C+   +C C +G+ G  C   +C   C N G C+    C C  G+ G  C +  C   C   G C  G  C C EG +G  C++  C   C   G C+   +C C + F+G  C  H C + C N G+CV   C C  G+ G +C
Sbjct:  418 CVNGQCVCDEGYTGEDCS---QLRCPND-----CHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCVNGQ-CVCHEGFMGKDCKEQRCPSDCHGQGRCV-DGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDC 620          

HSP 5 Score: 53.9138 bits (128), Expect = 1.157e-6
Identity = 24/72 (33.33%), Postives = 35/72 (48.61%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL 1517
            F+ K C  + C   C   G+CV  +C C  G+ G  C    C   C N G+C+    C C+EG+ G  C ++
Sbjct:  553 FMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGR-CICNEGYSGEDCSEV 623          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Human
Match: TNC (tenascin C [Source:HGNC Symbol;Acc:HGNC:5318])

HSP 1 Score: 128.257 bits (321), Expect = 1.122e-29
Identity = 69/220 (31.36%), Postives = 97/220 (44.09%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C++ +C+  E         F    C  + C   C N G+CV  +C C  G+ G  C    C   C   G+C+    C C EG+ G  C +L+C   C + G+C+    C C  G+ G  C    C   C + G C  G +C C +G  G  C   +C   C N G C+   +C C   F+G  C    C   C+  G+CV   C C  GF G +CK + C
Sbjct:  356 CEEGQCVCDEG--------FAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQ-CVCDEGYTGEDCSQLRCPNDCHSRGRCVEGK-CVCEQGFKGYDCSDMSCPNDCHQHGRCVNG-MCVCDDGYTGEDCRDRQCPRDCSNRGLCV-DGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRC 563          

HSP 2 Score: 127.102 bits (318), Expect = 2.910e-29
Identity = 83/256 (32.42%), Postives = 111/256 (43.36%), Query Frame = 3
Query: 1176 SPRSSWST--CSVTCGIGWQKRYRPCQDDECLEKENIKSEI-------RSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKC-KNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRICITG 1910
            S R ++ST  C   C  GW+     C + EC    +++             F  + C   +C   C + G+CV   C C  GY G  C   IC   C +  G C+   +C C +GF G  C K  C   C N G+C+  N C C  G+ G+ C + IC   C   G C  G  C C EG  G  C K  C   C   G C  + +C C + F+G  C    C   C+N G+CV   C+C  GF G +C    C  G
Sbjct:  162 SGRGNFSTEGCGCVCEPGWKGP--NCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVD-GLCVCHDGFAGDDCNKPLCLNNCYNRGRCVE-NECVCDEGFTGEDCSELICPNDCFDRGRCINGT-CYCEEGFTGEDCGKPTCPHACHTQGRC-EEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNG 411          

HSP 3 Score: 126.331 bits (316), Expect = 4.624e-29
Identity = 66/208 (31.73%), Postives = 92/208 (44.23%), Query Frame = 3
Query: 1281 KSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            + E    F    C    C   C  +G+CV  +C C  GY G+ C    C   C + G+C+    C C +GF+G  C  + C   C   G+C+   +C C  GY G+ C  R C   C   G+C  G  C C +G  G  C +  C   C   G C+   +C C + F G  C+   C + C+  G+CV   C C  GF G +C    C
Sbjct:  391 RCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCV-EGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCV-NGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSC 594          

HSP 4 Score: 125.946 bits (315), Expect = 5.271e-29
Identity = 71/215 (33.02%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            C + +C+  E    E  S   Q RCPN+     C + G+CV+ KC C  G++G  C +  C   C   G+C+   +C C +G+ G  C   +C   C N G C+    C C  G+ G  C +  C   C   G C  G  C C EG +G  C++  C   C   G C+   +C C + F+G  C  H C + C N G+CV   C C  G+ G +C
Sbjct:  418 CVNGQCVCDEGYTGEDCS---QLRCPND-----CHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCVNGQ-CVCHEGFMGKDCKEQRCPSDCHGQGRCV-DGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDC 620          

HSP 5 Score: 53.5286 bits (127), Expect = 1.399e-6
Identity = 24/72 (33.33%), Postives = 35/72 (48.61%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL 1517
            F+ K C  + C   C   G+CV  +C C  G+ G  C    C   C N G+C+    C C+EG+ G  C ++
Sbjct:  553 FMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGR-CICNEGYSGEDCSEV 623          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Celegans
Match: apx-1 (Anterior pharynx in excess protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41990])

HSP 1 Score: 97.0561 bits (240), Expect = 7.206e-21
Identity = 85/245 (34.69%), Postives = 111/245 (45.31%), Query Frame = 3
Query: 1230 KRYRPCQDDECLEKENIKSEIRSCF---IQKR------CPNESCNITCQNNGQCVKWKCF------CPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLR--PNLCTCAFGYIGKFC--EKRICN--PPCQKGGIC------QKGNICSCPEGTVGNRCE----KYECYPQ--CMNGGTCIGKN----KCHCPQSFSGSFCE--NH---ICTRCYNGGKC 1838
            + +RP  D E      I  E    F   +Q R         + CN  C  N + + W+C       C  G+ G+ C NPIC   C N G+C+ PN C C++GF G  CE+      C N G C+   PN C C  G+IG  C  + +IC+   PC  GGIC        G  C CP   VG++C+    K  C  +  C NGG CI  +    +C C + FSG FCE  NH      RC  G  C
Sbjct:   98 QHHRPAADTEWNSDAPIVIETSRGFNVTVQLRNLCSSNYHGKRCNRYCIANAK-LHWECSTHGVRRCSAGWSGEDCSNPICAGGCSNRGRCVAPNQCSCADGFNGTRCEQCLPRAGCVN-GDCVNETPNTCKCRDGFIGDRCDIDIKICSLEKPCANGGICSIDSSSSTGYKCHCPFEFVGSQCKTPLSKVRCSAEHVCKNGGACISMDDTNIQCKCRRGFSGKFCEIGNHGDCSAMRCSAGETC 340          

HSP 2 Score: 56.6102 bits (135), Expect = 4.410e-8
Identity = 51/156 (32.69%), Postives = 70/156 (44.87%), Query Frame = 3
Query: 1479 CSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQ--CMNGGTCIGK--NKCHCPQSFSGSFCENHI--CTR---CYNGGKC-------VGNMCQCPTGFFGPECKSRI 1898
            CS  + G  C +  C    +   +C    +  C+ G+ G+ C   IC   C   G C   N CSC +G  G RCE  +C P+  C+NG  C+ +  N C C   F G  C+  I  C+    C NGG C        G  C CP  F G +CK+ +
Sbjct:  132 CSSNYHGKRCNRY-CIANAKLHWECSTHGVRRCSAGWSGEDCSNPICAGGCSNRGRCVAPNQCSCADGFNGTRCE--QCLPRAGCVNG-DCVNETPNTCKCRDGFIGDRCDIDIKICSLEKPCANGGICSIDSSSSTGYKCHCPFEFVGSQCKTPL 283          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Celegans
Match: crb-1 (Drosophila CRumBs homolog [Source:UniProtKB/TrEMBL;Acc:Q19350])

HSP 1 Score: 91.2781 bits (225), Expect = 1.352e-18
Identity = 82/226 (36.28%), Postives = 106/226 (46.90%), Query Frame = 3
Query: 1341 TCQNNGQCVKW----KCFCPTGYQGKFCQNPI--CNEK-CKNGGKC---IGPNICQCSEGFEGLFCE---KLKCDIT-CENGGQCLRPNL---CTCAFGYIGKFCEKR------ICNPP---CQKGGICQKGNICSCPEGTVGNRCEKYECYP----QCMNGGTCI--GKN--KCHCPQSFSGSFCENHI-----CTRCYNGGKCV----GNMCQCPTGFFGPECK 1889
            TCQNNG CV      KC CP G+ G  C+     C E  C+NG  C    G   C+C +GF G +CE   K +C    C N GQC+       C C+ G+ G FCE +      IC  P   C       +   C CP G +G  C++ +  P     C+NGG C+  G+N   C C  SF+G +C   +      + C NGGKCV       CQCP GF G  C+
Sbjct:  133 TCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCE 358          

HSP 2 Score: 70.4774 bits (171), Expect = 3.407e-12
Identity = 71/218 (32.57%), Postives = 88/218 (40.37%), Query Frame = 3
Query: 1344 CQNNGQCVK-----WKCFCPTGYQGKFCQNPIC----NEKCKNGGKCI---GPNICQCSEGFEGLFCEKLKC--------DITCENGGQCLRPN----LCTCAFGYIGKFCE-KRICN-PPCQKGGICQKGN---ICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI-CTRCYNGGKCV----GNMCQCPTGFFGPECKSR 1895
            C N G CV      + CFC   + G +C  P+        CKNGGKC+       CQC EGF G  CE            DI C NGG C         C C  G+ G FCE K  C   PCQ GG CQ  +    C C  G  G  CE  +   +       +G           G F ++ I C  C N   C+    G +C C  G+FG +C  +
Sbjct:  291 CLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPKSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVD---EPSTPIPTLGTFPSFTTSGIDG-FSQSKISCEDCVNSSNCLDVESGPVCICDDGYFGQKCDQK 504          

HSP 3 Score: 67.781 bits (164), Expect = 2.204e-11
Identity = 78/248 (31.45%), Postives = 110/248 (44.35%), Query Frame = 3
Query: 1326 ESCNIT---------CQNNGQCVK-----WKCFCPTGYQGKFCQNPI---CNEKCKNGGKCI----GPNICQCSEGFEGLFCEKL--KCDI-TCENGGQC---LRPNLCTCAFGYIGKFCEKRI---CNPPCQKGGICQKGN----ICSCPEGTVGNRCE-KYECY-PQCMNGGTCIG----KNKCHCPQSFSGSFCENHI----CTRCYNGGKC----VGNMCQCPTGFFGPECKSRICITGLKFRK 1925
            +SCN+T         CQN GQC++     ++C C  GY G+ C+      CN    N G C+    GP  CQC  G+ G FCEKL  +C   TC + G C       +C C   + G  C+ ++    + PC   G+C+  +     C C +  +G RCE +  C   QC++ G CI      + C C   + G  C+  I       C NG  C     G  C C  GF G +C+  I    L+F K
Sbjct: 1284 DSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGP-ACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVH-GECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCK 1529          

HSP 4 Score: 67.781 bits (164), Expect = 2.380e-11
Identity = 74/251 (29.48%), Postives = 98/251 (39.04%), Query Frame = 3
Query: 1341 TCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGG---KCIGPNICQCSEGFEGLFCEKLKCDI------------------------------------TCENGGQCLRPN---LCTCAFGYIGKFCE--KRICNPP-CQKGGICQ--KGNI-CSCPEGTVGNRCE---KYECYPQ-CMNGGTCIGKNK---CHCPQSFSGSFCE-------------NHICTRCYNGGKCVGNMCQCPTGFFGPECK 1889
            TC  N +   ++C CP G+ G  CQ+  C+  C +G       G   CQCSEG+ G  C+ L  D                                     TC+N G C+  N    C C  G++G  CE  +  C    CQ G  C+  KG+  C C +G  G  CE   K +C    C N G CI       C C   F G+FCE              H+C+     G      C+CP+GF G +CK
Sbjct:   32 TCTVNDETRMFQCECPKGFSGLLCQDN-CSLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLV--NGTSRTTQCECPSGFMGADCK 279          

HSP 5 Score: 60.4622 bits (145), Expect = 4.878e-9
Identity = 67/225 (29.78%), Postives = 98/225 (43.56%), Query Frame = 3
Query: 1341 TCQNNGQCV----KWKCFCPTGYQGKFCQNPICNEK---CKNGGKC---IGPNICQCSEGFEGLFCE--KLKCD-ITCENGGQCLRPN----LCTCAFGYIGKFCEKRIC----NPPCQKGGIC-QKGNI---CSCPEGTVGNRCEKY---ECYPQCMNGGTC---IGKNKCHCPQSFSGSFCENHI----CTRCYNGGKCV----GNMCQCPTGFFGPECKSRI 1898
            TC N   CV    K KC CP G+ G+ C++ + + K   C   G C   I    C C+ GF G  CE  K +C+ + C NGG+C++      +C C   ++G  C         + PCQ  G C QK +    C+C +G  G  CE+    EC     N G C   +    C C   ++G FCE  +       C + G C       +C C   + G  C+ ++
Sbjct: 1182 TCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQM 1406          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Celegans
Match: glp-1 (pep chromosome:WBcel235:III:9092241:9099698:1 gene:WBGene00001609.1 transcript:F02A9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:glp-1)

HSP 1 Score: 88.5817 bits (218), Expect = 8.565e-18
Identity = 85/245 (34.69%), Postives = 107/245 (43.67%), Query Frame = 3
Query: 1341 TCQNNGQCV----KWKCFCPTGYQGKFCQNPI--CNEK-CKNGGKCIGPN----ICQCSEGFEGLFCE--------KLKCDI------------TCENGGQCLRPNLCTCAFGYIGKFCE---KRICNP--------PCQKGGIC----QKGNICSCPEGTVGNRCEKYE-CYPQ-CMNGGTCIGKN---KCHCPQSFSGSFCE---NHICTR--CYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            TC NN  C      + C C  GY GK+C+  I  C +  C+N G C   +    IC C +GF G  CE         + CD+            TC N G+C+    C C   YIG  CE   K    P        PC     C      G  C CP G  G  CE++  C P  C NGGTC G N   +C+CP  FSG +CE     +C+R  C NGG C     C+C  G+ GP C+  + I
Sbjct:  241 TCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCIN-GFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLLCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCKNTGYCECQYGYTGPTCEEVLVI 484          

HSP 2 Score: 76.2554 bits (186), Expect = 6.245e-14
Identity = 76/243 (31.28%), Postives = 102/243 (41.98%), Query Frame = 3
Query: 1350 NNGQCV-------KWKCFCPTGYQGKFCQNP----ICNEKCKNGGKCI---GPNICQCSEGFEGLFCEK---LKCDITCENGGQCLRPN----LCTCAFGYIGKFCEKR--------ICNPPCQK------------GGICQKGNICSCPEGTVGNRCE------KYEC-----YPQCMNGGTCIG-KNK---CHCPQSFSGSFCENHIC---TRCYNGGKCVGN----MCQCPTGFFGPECK 1889
            N+G+C+        ++C C +GY+G+FC       +  E C N   C    G   C C  G+ G +CE+   +  D  C+N G C   +    +C C  G+ G+ CE           C+ P Q+             G C  G  C C    +G+RCE      K+       Y  C+N  TCI  KN    CHCP  F G  CE H+    T C NGG C G      C CP GF G  C+
Sbjct:  202 NHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCING-FCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLLCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCE 443          

HSP 3 Score: 70.4774 bits (171), Expect = 3.653e-12
Identity = 64/204 (31.37%), Postives = 84/204 (41.18%), Query Frame = 3
Query: 1371 WKCFCPTGYQGKFCQNPICNEKCK--NGGKCIGPNI-------CQCSEGFEGLFCEKLK----CDITCENGGQCLRPN---LCTCAFGYIGKFCEKRIC---NPPCQKGGICQKGN----ICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI----CTR----CYNGGKCVGNMCQCPTGFFGPECK 1889
            + C CP G  G++C+   C       N G+CI PN        C C  G+EG FC K K     + TC N   C   +    CTC  GY GK+CE+ I    +  CQ  G C   +    IC C +G  G RCE                     CP  F G  C+  +    C+R    CYN G+C+   C C   + G  C+
Sbjct:  176 YYCDCPIGKSGRYCERTECALMGNICNHGRCI-PNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCE-------------------IECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCINGFCVCEPDYIGDRCE 359          

HSP 4 Score: 58.151 bits (139), Expect = 2.395e-8
Identity = 62/214 (28.97%), Postives = 85/214 (39.72%), Query Frame = 3
Query: 1344 CQNNGQCVKWK-----CFCPTGYQGKFC-QNPICNEK-CKNGGKCIGPN---ICQCSEGFEGLFCE----KLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECY---------PQC------MNGGTCIGK----NKCHCPQSFSGSFCENHICTR-------CYNGGKCVGNMCQCPT 1865
            C NN  C+  K     C CP G+ G  C Q+ +C    C NGG C G N    C C  GF G +CE    +L     C+NGG C     C C +GY G  CE+ +               I    E  + + CE+ +C          P+C       +GG C G     +KC  P   +  F  N +C +        Y+G  C   + +CP 
Sbjct:  378 CVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLLCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCKNTGYCECQYGYTGPTCEEVLV--------------IEKSKETVIRDLCEQRKCMDLASNGICNPECNLEECNFDGGDCSGGQRPFSKCQYPARCADQFA-NGVCNQECNNEECLYDGLDCQSELFRCPA 576          

HSP 5 Score: 50.447 bits (119), Expect = 5.580e-6
Identity = 76/247 (30.77%), Postives = 89/247 (36.03%), Query Frame = 3
Query: 1341 TCQNNGQCVKWK------CFCPTGYQGKFCQNPICNEKCKNGGKCI----GPN---ICQ---------------CSEGFEG------LFCEKLKCDITCENGGQCLR---PNLCTCAFGYIGKFCEKRI---CNPPCQKGGICQKG---NICSCPEGTVGNRCEKYEC--YPQCMNGGTCI-----GKN-KCHCPQSFSGSFCENHICTRCYNGGKCVGN----------MCQCPTGFFGPECKSRI 1898
             C  NG+C   K      C C  G+ G FC+   C+  CK G KCI    G N   ICQ               C EG+ G      LF     CD    N G C        C C  GY G +CE+ I       C +G  C        C CP G  G  CE+ EC       N G CI      KN +C C   + G FC N     C     CV N           C C  G+ G  C+  I
Sbjct:   28 ACSVNGKCYNGKLIETYWCRCKKGFGGAFCERE-CDLDCKRGEKCIYDVYGENPTCICQDCEDETPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDSDPCNNGLCYPFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFC-NKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAI 272          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 87.0409 bits (214), Expect = 2.940e-17
Identity = 60/221 (27.15%), Postives = 85/221 (38.46%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLK--CDIT-CENGGQCLRPNLCTCAFGYIGKFCEKRIC-NPPCQKGGICQKGNICSCPEGTVGNRCEKYE----CYPQCMN----GGTCIGKNKCHCPQSFSGSFCENHICTR-------------------CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C   C   G+CV  KC C  G+ G+ C   +C   C   G   G  IC C  GF+G  CE     C++  C   G+C     C C  G+ G+ CE R C +  C   G+C  G  C C +G  GN C  +       PQ  +    G      +K    Q       E    +R                   C   G+ + ++CQC +G+   +C  + C
Sbjct:  594 CESNCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSG-GICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGT-CYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQLIDDICQCESGWDSVDCSQQAC 812          

HSP 2 Score: 78.1814 bits (191), Expect = 1.899e-14
Identity = 40/129 (31.01%), Postives = 58/129 (44.96%), Query Frame = 3
Query: 1515 LKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQ---CMNGGTCIGKNKCHCPQSFSGSFCENHIC--TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            L C+  C   G+C+    C CA G+ G+ C++ +C   C   G+   G IC C  G  G  CE    + +   C   G C    +C C   ++G  CE   C    C++ G CV   C C  G+ G +C
Sbjct:  592 LVCESNCNQRGECVHGK-CHCAPGFTGRTCDEAVCPVVCSGNGVFS-GGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGNDC 718          

HSP 3 Score: 72.7886 bits (177), Expect = 7.598e-13
Identity = 46/151 (30.46%), Postives = 65/151 (43.05%), Query Frame = 3
Query: 1266 EKENIKSEIRSCFIQK-RCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGN-----ICSCPEGTVGNRC 1700
            EK+    E++   I   + P ES +  C  +GQ +   C C +G+    C    C  +C NG  C+    CQC +G+ G  C   KC I CE+ G+C     C C+ G+ G+ C    C   C   G C          C C  G+ G  C
Sbjct:  759 EKKKESRELQKPIIATVQVPTESSH-PCSAHGQLIDDICQCESGWDSVDCSQQAC--QCVNG-DCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDC 905          

HSP 4 Score: 68.5514 bits (166), Expect = 1.727e-11
Identity = 86/384 (22.40%), Postives = 133/384 (34.64%), Query Frame = 3
Query:  984 IRKFFSGSVQKLHLKVSKNVIIRVSTDSLETFKNTVCSN----VFYDHSSNV----LNASKIQQLSIPLSTVS---------PRSSWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQ---NPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKC-DITCENGGQCLRPNLCTCAFGYIGKFC----------------------------------------EKRICNPPCQKGGIC------QKGNICSCPEGTVGNRCE------KYECYPQ---CMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGN-MCQCPTGFFGPECKSRIC 1901
            + +F S S + L    S++  I + +    TF+  V        F +  S V      A ++Q+ + P  T S         P +S   C   C           Q  EC+     K      F  + C    C + C  NG      C C +G++GK C+   N      C   G+C     C+C+ G+ G  CE   C   +C + G C+    C C  G+ G  C                                        EK+  +   QK  I       +  + CS     + + C+        +C  Q   C+N G C+    C C + + GS C +  C   C + GKC  +  C+C +G+ G  C    C
Sbjct:  505 VEEFGSRSRRSLGASSSRHRNIEILSPRSATFEQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCN----------QRGECVHG---KCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVN-GTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQLIDDICQCESGWDSVDCSQQACQCVN-GDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGC 873          

HSP 5 Score: 60.077 bits (144), Expect = 5.888e-9
Identity = 54/236 (22.88%), Postives = 84/236 (35.59%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFC--------------------QNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQC-----LRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNM------CQCPTGFFGPECKSRI---CITGL 1913
            + CP+ SC+    + G CV   C+C  G++G  C                    Q P  + K +       P   +  E  E          +  E+   C     L  ++C C  G+    C ++ C   C  G     G+ C C +G  G+ C   +C   C + G C     C C   ++G  C    C  +C   G+C  +       C+C  G  G +C   +   C  GL
Sbjct:  689 RACPHASCH----DRGVCVNGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQLIDDICQCESGWDSVDCSQQACQ--CVNGDCLDDGS-CQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDCSVSVEMHCDDGL 917          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 87.0409 bits (214), Expect = 3.315e-17
Identity = 60/221 (27.15%), Postives = 85/221 (38.46%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLK--CDIT-CENGGQCLRPNLCTCAFGYIGKFCEKRIC-NPPCQKGGICQKGNICSCPEGTVGNRCEKYE----CYPQCMN----GGTCIGKNKCHCPQSFSGSFCENHICTR-------------------CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C   C   G+CV  KC C  G+ G+ C   +C   C   G   G  IC C  GF+G  CE     C++  C   G+C     C C  G+ G+ CE R C +  C   G+C  G  C C +G  GN C  +       PQ  +    G      +K    Q       E    +R                   C   G+ + ++CQC +G+   +C  + C
Sbjct:  441 CESNCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSG-GICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGT-CYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQLIDDICQCESGWDSVDCSQQAC 659          

HSP 2 Score: 77.7962 bits (190), Expect = 2.088e-14
Identity = 40/129 (31.01%), Postives = 58/129 (44.96%), Query Frame = 3
Query: 1515 LKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQ---CMNGGTCIGKNKCHCPQSFSGSFCENHIC--TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            L C+  C   G+C+    C CA G+ G+ C++ +C   C   G+   G IC C  G  G  CE    + +   C   G C    +C C   ++G  CE   C    C++ G CV   C C  G+ G +C
Sbjct:  439 LVCESNCNQRGECVHGK-CHCAPGFTGRTCDEAVCPVVCSGNGVFS-GGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGNDC 565          

HSP 3 Score: 72.7886 bits (177), Expect = 8.289e-13
Identity = 46/151 (30.46%), Postives = 65/151 (43.05%), Query Frame = 3
Query: 1266 EKENIKSEIRSCFIQK-RCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGN-----ICSCPEGTVGNRC 1700
            EK+    E++   I   + P ES +  C  +GQ +   C C +G+    C    C  +C NG  C+    CQC +G+ G  C   KC I CE+ G+C     C C+ G+ G+ C    C   C   G C          C C  G+ G  C
Sbjct:  606 EKKKESRELQKPIIATVQVPTESSH-PCSAHGQLIDDICQCESGWDSVDCSQQAC--QCVNG-DCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDC 752          

HSP 4 Score: 68.1662 bits (165), Expect = 1.950e-11
Identity = 86/384 (22.40%), Postives = 133/384 (34.64%), Query Frame = 3
Query:  984 IRKFFSGSVQKLHLKVSKNVIIRVSTDSLETFKNTVCSN----VFYDHSSNV----LNASKIQQLSIPLSTVS---------PRSSWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQ---NPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKC-DITCENGGQCLRPNLCTCAFGYIGKFC----------------------------------------EKRICNPPCQKGGIC------QKGNICSCPEGTVGNRCE------KYECYPQ---CMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGN-MCQCPTGFFGPECKSRIC 1901
            + +F S S + L    S++  I + +    TF+  V        F +  S V      A ++Q+ + P  T S         P +S   C   C           Q  EC+     K      F  + C    C + C  NG      C C +G++GK C+   N      C   G+C     C+C+ G+ G  CE   C   +C + G C+    C C  G+ G  C                                        EK+  +   QK  I       +  + CS     + + C+        +C  Q   C+N G C+    C C + + GS C +  C   C + GKC  +  C+C +G+ G  C    C
Sbjct:  352 VEEFGSRSRRSLGASSSRHRNIEILSPRSATFEQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCN----------QRGECVHG---KCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVN-GTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQLIDDICQCESGWDSVDCSQQACQCVN-GDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGC 720          

HSP 5 Score: 60.077 bits (144), Expect = 6.597e-9
Identity = 54/236 (22.88%), Postives = 84/236 (35.59%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFC--------------------QNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQC-----LRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNM------CQCPTGFFGPECKSRI---CITGL 1913
            + CP+ SC+    + G CV   C+C  G++G  C                    Q P  + K +       P   +  E  E          +  E+   C     L  ++C C  G+    C ++ C   C  G     G+ C C +G  G+ C   +C   C + G C     C C   ++G  C    C  +C   G+C  +       C+C  G  G +C   +   C  GL
Sbjct:  536 RACPHASCH----DRGVCVNGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQLIDDICQCESGWDSVDCSQQACQ--CVNGDCLDDGS-CQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDCSVSVEMHCDDGL 764          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0340089)

HSP 1 Score: 117.087 bits (292), Expect = 1.291e-27
Identity = 93/328 (28.35%), Postives = 143/328 (43.60%), Query Frame = 3
Query:  885 KNEDLSFNVFINDSGIFVETFCIF------RMFTIYNEKIRKFFSGSVQKLHLKVSKNVIIRVST------------DSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSP--RSSWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCE---KYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            +NE+   +++IN+  + + T   F      R++ I+N ++      +     L +   V     T            D L+T   ++        + ++  + +I Q     S   P   +S  T S   G+  Q R+          K    + IR  F +K C +  C++ C  NG C +   C C  GY G++C+   C  +C NGG C  P++C C EG++G  CE   C   C NGG+C++ + C C+ GY G  CE   C  PC+  G C   N+C CP G  G+ CE   K     +C N GTC+    C C   F G  C
Sbjct:  111 RNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAP----TLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRH---------NKPLSGTPIRLNF-KKECAHRECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRN-GTCVSHKHCKCHPGFYGRHC 423          

HSP 2 Score: 110.538 bits (275), Expect = 1.768e-25
Identity = 68/169 (40.24%), Postives = 84/169 (49.70%), Query Frame = 3
Query: 1404 KFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE-----NHICTRCYNGGKCVGNMCQCPTGFFGPECKSR 1895
            K C +  C+ KC   G C   +IC+C+ G+ G +CE   C   C NGG C  P++CTC  GY G  CE  IC   C  GG C + + C C +G  G RCE  +C   C N G CIG N C CP    G  CE       IC +C NG       C+C  GF+G  C  R
Sbjct:  259 KECAHRECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSIC-KCRNGTCVSHKHCKCHPGFYGRHCNGR 426          

HSP 3 Score: 84.7297 bits (208), Expect = 5.918e-17
Identity = 44/105 (41.90%), Postives = 60/105 (57.14%), Query Frame = 3
Query: 1596 KFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRICI 1904
            K C  R C+  C K G C + +IC C  G  G  CE   C+PQC+NGG C   + C CP+ + G+ CE  IC  +C NGGKC+  + CQC  G++G  C+   C+
Sbjct:  259 KECAHRECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCV 363          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0340090)

HSP 1 Score: 116.701 bits (291), Expect = 1.616e-27
Identity = 93/331 (28.10%), Postives = 144/331 (43.50%), Query Frame = 3
Query:  885 KNEDLSFNVFINDSGIFVETFCIF------RMFTIYNEKIRKFFSGSVQKLHLKVSKNVIIRVST------------DSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSP--RSSWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQK---RCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCE---KYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            +NE+   +++IN+  + + T   F      R++ I+N ++      +     L +   V     T            D L+T   ++        + ++  + +I Q     S   P   +S  T S   G+  Q R+          K    + IR  F ++   R P+  C++ C  NG C +   C C  GY G++C+   C  +C NGG C  P++C C EG++G  CE   C   C NGG+C++ + C C+ GY G  CE   C  PC+  G C   N+C CP G  G+ CE   K     +C N GTC+    C C   F G  C
Sbjct:  111 RNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAP----TLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRH---------NKPLSGTPIRLNFKKECAHRAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRN-GTCVSHKHCKCHPGFYGRHC 427          

HSP 2 Score: 111.694 bits (278), Expect = 9.549e-26
Identity = 67/165 (40.61%), Postives = 83/165 (50.30%), Query Frame = 3
Query: 1416 NPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE-----NHICTRCYNGGKCVGNMCQCPTGFFGPECKSR 1895
            +P C+ KC   G C   +IC+C+ G+ G +CE   C   C NGG C  P++CTC  GY G  CE  IC   C  GG C + + C C +G  G RCE  +C   C N G CIG N C CP    G  CE       IC +C NG       C+C  GF+G  C  R
Sbjct:  267 DPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSIC-KCRNGTCVSHKHCKCHPGFYGRHCNGR 430          

HSP 3 Score: 80.8777 bits (198), Expect = 8.822e-16
Identity = 44/109 (40.37%), Postives = 60/109 (55.05%), Query Frame = 3
Query: 1596 KFCEKRICNPPCQ----KGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRICI 1904
            K C  R  +P C     K G C + +IC C  G  G  CE   C+PQC+NGG C   + C CP+ + G+ CE  IC  +C NGGKC+  + CQC  G++G  C+   C+
Sbjct:  259 KECAHRAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCV 367          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0340088)

HSP 1 Score: 115.161 bits (287), Expect = 6.514e-27
Identity = 92/339 (27.14%), Postives = 146/339 (43.07%), Query Frame = 3
Query:  885 KNEDLSFNVFINDSGIFVETFCIF------RMFTIYNEKIRKFFSGSVQKLHLKVSKNVIIRVST------------DSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSP--RSSWSTCSVTCGIGWQKRY-RPCQ--------DDECLEK--ENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCE---KYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            +NE+   +++IN+  + + T   F      R++ I+N ++      +     L +   V     T            D L+T   ++        + ++  + +I Q     S   P   +S  T S   G+  Q R+ +P            EC  +   +I +   +     + P+  C++ C  NG C +   C C  GY G++C+   C  +C NGG C  P++C C EG++G  CE   C   C NGG+C++ + C C+ GY G  CE   C  PC+  G C   N+C CP G  G+ CE   K     +C N GTC+    C C   F G  C
Sbjct:  111 RNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAP----TLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRN-GTCVSHKHCKCHPGFYGRHC 444          

HSP 2 Score: 112.079 bits (279), Expect = 8.715e-26
Identity = 69/175 (39.43%), Postives = 85/175 (48.57%), Query Frame = 3
Query: 1386 PTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE-----NHICTRCYNGGKCVGNMCQCPTGFFGPECKSR 1895
            PT        +P C+ KC   G C   +IC+C+ G+ G +CE   C   C NGG C  P++CTC  GY G  CE  IC   C  GG C + + C C +G  G RCE  +C   C N G CIG N C CP    G  CE       IC +C NG       C+C  GF+G  C  R
Sbjct:  274 PTSLTTLQAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSIC-KCRNGTCVSHKHCKCHPGFYGRHCNGR 447          

HSP 3 Score: 80.4925 bits (197), Expect = 1.291e-15
Identity = 41/98 (41.84%), Postives = 57/98 (58.16%), Query Frame = 3
Query: 1617 CNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRICI 1904
            C+  C K G C + +IC C  G  G  CE   C+PQC+NGG C   + C CP+ + G+ CE  IC  +C NGGKC+  + CQC  G++G  C+   C+
Sbjct:  287 CSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCV 384          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0070978)

HSP 1 Score: 112.079 bits (279), Expect = 7.351e-26
Identity = 62/161 (38.51%), Postives = 84/161 (52.17%), Query Frame = 3
Query: 1326 ESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCE---KYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            + C++ C  NG C +   C C  GY G++C+   C  +C NGG C  P++C C EG++G  CE   C   C NGG+C++ + C C+ GY G  CE   C  PC+  G C   N+C CP G  G+ CE   K     +C N GTC+    C C   F G  C
Sbjct:  281 QECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRN-GTCVSHKHCKCHPGFYGRHC 440          

HSP 2 Score: 111.309 bits (277), Expect = 1.262e-25
Identity = 66/162 (40.74%), Postives = 81/162 (50.00%), Query Frame = 3
Query: 1425 CNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE-----NHICTRCYNGGKCVGNMCQCPTGFFGPECKSR 1895
            C+ KC   G C   +IC+C+ G+ G +CE   C   C NGG C  P++CTC  GY G  CE  IC   C  GG C + + C C +G  G RCE  +C   C N G CIG N C CP    G  CE       IC +C NG       C+C  GF+G  C  R
Sbjct:  283 CSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSIC-KCRNGTCVSHKHCKCHPGFYGRHCNGR 443          

HSP 3 Score: 103.219 bits (256), Expect = 5.664e-23
Identity = 57/141 (40.43%), Postives = 77/141 (54.61%), Query Frame = 3
Query: 1518 KCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVG-NMCQCPTGFFGPECKSRICITGLKFRKIIK 1934
            +C + C   G C   ++C C  GY G++CE   C P C  GG C   ++C+CPEG  G +CE   C  +C+NGG CI K+KC C + + G  CE   C   C N G+C+G N+C+CP G  G  C+      G K R I K
Sbjct:  282 ECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCE-----IGRKQRSICK 417          

HSP 4 Score: 63.929 bits (154), Expect = 2.325e-10
Identity = 78/297 (26.26%), Postives = 118/297 (39.73%), Query Frame = 3
Query:  777 NSLIVSISITHDAIINIKSGDGNNSSKFSLEKLQALKNEDLSFNVF-INDSGIFVE---TFCIFRMFTIYNEKIRKFFSG-SVQKLHLKVSKNVIIRVSTDSLETFKNTVCSNVFYD-HSSNVLNASKIQQLSIPLSTVSPRSSWSTCSVTCGIGWQKRYRPCQD----DECLEKEN-IKSEIRSC---FIQKRCPNESCNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE---KLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKR 1613
            N L++   + +   +N     G     +  ++LQ +    L      I  SG   +    F IF   T  +     F  G  +Q  H K      IR++      FK        YD  +SN  + + +Q+ S+        +    C   C +G+  +Y  C+      +CL   N     + +C   +   +C    C   C N G+C+ K KC C  GY G  C+   C   CKN G+CIG N+C+C  G  G  CE   K +    C N G C+    C C  G+ G+ C  R
Sbjct:  161 NFLVIPSEVNY---VNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLN------FKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICK--CNVGYTGQY--CETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRN-GTCVSHKHCKCHPGFYGRHCNGR 443          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Fly
Match: Ten-m (gene:FBgn0004449 transcript:FBtr0306107)

HSP 1 Score: 112.849 bits (281), Expect = 4.389e-25
Identity = 66/210 (31.43%), Postives = 92/210 (43.81%), Query Frame = 3
Query: 1305 IQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFC--EKLKCDIT-CENGGQCLRPNLCTCAFGYIGKFCEKRIC-NPPCQKGGICQKGNICSCPEGTVGNRC-----EKYECYPQCMNGGTC-IGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            + + CPN      C  NGQC+   C C  G+ G  C   +C   C   G+      C C+ G++G  C     +C++  C   G C+    C C  GY GKFCE+  C +P C   G C  G  C C +G  G  C     +  +C P C   GT  +    C C   +SG  C   +C   C   G+C G+ C C   + G  C +R+C
Sbjct: 1067 MTQNCPN-----GCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGE-CICNPGWKGKECSLRHDECEVADCSGHGHCVSGK-CQCMRGYKGKFCEEVDCPHPNCSGHGFCADGT-CICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLC 1268          

HSP 2 Score: 102.834 bits (255), Expect = 5.670e-22
Identity = 61/206 (29.61%), Postives = 84/206 (40.78%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWKCFCPTGYQGKFC--QNPICN-EKCKNGGKCIGPNICQCSEGFEGLFCEKLKC-DITCENGGQCLRPNLCTCAFGYIGKFC-----EKRICNPPCQKGGICQ-KGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C    C + C  +G+    +C C  G++GK C  ++  C    C   G C+    CQC  G++G FCE++ C    C   G C     C C  G+ G  C     +   C P C   G        C+C     G+ C K  C   C   G C G + C C   + G +C   +C  RC   G+C    C C TG+ G  C    C
Sbjct: 1097 CSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGK-CQCMRGYKGKFCEEVDCPHPNCSGHGFC-ADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEG-DACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGC 1299          

HSP 3 Score: 97.8265 bits (242), Expect = 1.775e-20
Identity = 72/248 (29.03%), Postives = 106/248 (42.74%), Query Frame = 3
Query: 1188 SWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNIT-CQNNGQCVKWKCFCPTGYQGKFCQNPIC-NEKCKNGGKCIGPNICQCSEGFEGLFC-----EKLKCDITCENGGQC-LRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKN-KCHCPQSFSGSFCENHIC-TRCYNGGKCVGN-----MCQCPTGFFGPEC 1886
            S S C V C      ++    + EC+     K   + C ++    ++ C +  C  +G CV  KC C  GY+GKFC+   C +  C   G C     C C +G++G  C     + L+C   C   G   L    CTC   + G  C K +C+  C + G C+ G+ C+C     G  C    C  +C   G C  KN  C C   ++G  C    C   C   G+C  +      C+C  G+ GP+C
Sbjct: 1098 SESVCPVLC-----SQHGEYTNGECICNPGWKG--KECSLR----HDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFC-ADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCE-GDACACDPEWGGEYCNTRLCDVRCNEHGQC--KNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDC 1330          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-30e9.7 (si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-540])

HSP 1 Score: 188.348 bits (477), Expect = 3.066e-49
Identity = 88/203 (43.35%), Postives = 123/203 (60.59%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            +  + C    C+  CQ+ G+C+ +  C CP GY G  C+  +CN  C+NGG+C+ P++C+C  G+ G  C    C   C NGG CL+PN+C C  G+ G  C+  +CNPPC+  G C + N+CSCPEG  G RC+K  C P C+N G C+G N C CP  + G  C   +C  +C NGG+CVG N C CP G+ G +C++ IC
Sbjct: 1487 YSGQTCEEAICDPPCQHGGRCLSRNHCTCPYGYVGPRCETMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIALCNPPCKNRGQCMRNNVCSCPEGYTGKRCQKSVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCLQKCRNGGECVGPNTCHCPAGWEGWQCQTPIC 1689          

HSP 2 Score: 163.31 bits (412), Expect = 3.954e-41
Identity = 82/194 (42.27%), Postives = 113/194 (58.25%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            C   C+N G+CVK   C CP GY G+ C+  IC+  C++GG+C+  N C C  G+ G  CE + C+  CENGG+C+ P++C C  G+ G  C    C P C  GG C K N+C CP G  G++C+   C P C N G C+  N C CP+ ++G  C+  +C   C N GKCVG N C CP+G+ G  C   +C+
Sbjct: 1465 CRPDCKNKGKCVKPSVCECPLGYSGQTCEEAICDPPCQHGGRCLSRNHCTCPYGYVGPRCETMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIALCNPPCKNRGQCMRNNVCSCPEGYTGKRCQKSVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCL 1658          

HSP 3 Score: 145.591 bits (366), Expect = 2.117e-35
Identity = 81/208 (38.94%), Postives = 111/208 (53.37%), Query Frame = 3
Query: 1383 CPTGYQGKFCQ-NPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCV-GNMCQCPTGFFGPECKSRICITGLKFR-KIIKPVIVQFPVIVSNKMCIESTC 1994
            CP GY+G      P C   C    +C  PN C C EG+ G  C    C   C+N G+C++P++C C  GY G+ CE+ IC+PPCQ GG C   N C+CP G VG RCE   C   C NGG C+  + C C   + G  C +  C   C NGG C+  N+C CP+GF+G +C+  +C    K R + ++  +   P   + K C +S C
Sbjct: 1418 CPNGYEGNGITCKPTCRYPCGQNMECSQPNTCTCKEGYTGYNCHIAVCRPDCKNKGKCVKPSVCECPLGYSGQTCEEAICDPPCQHGGRCLSRNHCTCPYGYVGPRCETMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIALCNPPCKNRGQCMRNNVCSCPEGYTGKRCQKSVC 1625          

HSP 4 Score: 129.798 bits (325), Expect = 2.210e-30
Identity = 67/161 (41.61%), Postives = 89/161 (55.28%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            C +  C   C N G C+K   C CP+G+ G  CQ  +CN  CKN G+C+  N+C C EG+ G  C+K  CD  C N G+C+ PN C+C  G+ G  C   +C   C+ GG C   N C CP G  G +C+   C   C+NGG C+  N CHC Q ++G  C
Sbjct: 1556 CNSADCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIALCNPPCKNRGQCMRNNVCSCPEGYTGKRCQKSVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCLQKCRNGGECVGPNTCHCPAGWEGWQCQTPICKQTCLNGGRCVFPNFCHCRQGYTGPSC 1716          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-246m6.5 (si:ch211-246m6.5 [Source:ZFIN;Acc:ZDB-GENE-050208-577])

HSP 1 Score: 152.91 bits (385), Expect = 1.621e-41
Identity = 88/191 (46.07%), Postives = 113/191 (59.16%), Query Frame = 3
Query: 1338 ITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            + C + G CV +  C CP G+ G      +CN  C+NGGKC  P+ C+C  G+ G  CE   CD  C NGG C+RPN CTC  G+ G  C+  +CNPPC+ GG C + N+CSC EG  G RCEK  C P C+NGG CIG + C C   + G  C+  +C  +C NGG+CVG N C C  G+ G  C+  IC
Sbjct:   32 LPCLHGGTCVGRDTCSCPYGFVGP---RLVCNHHCQNGGKCTSPDECECLAGWTGPSCETALCDPVCLNGGTCVRPNSCTCQHGFYGARCQNAVCNPPCKNGGHCVRNNVCSCVEGYSGQRCEKSVCEPVCVNGGRCIGPDVCDCASGWRGKRCDKPVCVQKCVNGGECVGPNSCLCSPGWRGTICQIPIC 219          

HSP 2 Score: 112.079 bits (279), Expect = 3.399e-27
Identity = 66/170 (38.82%), Postives = 89/170 (52.35%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKW-KCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI 1808
            +    C    C+  C N G CV+   C C  G+ G  CQN +CN  CKNGG C+  N+C C EG+ G  CEK  C+  C NGG+C+ P++C CA G+ GK C+K +C   C  GG C   N C C  G  G  C+   C  +C+ G  C+  N C C   + G+ C   +
Sbjct:   81 WTGPSCETALCDPVCLNGGTCVRPNSCTCQHGFYGARCQNAVCNPPCKNGGHCVRNNVCSCVEGYSGQRCEKSVCEPVCVNGGRCIGPDVCDCASGWRGKRCDKPVCVQKCVNGGECVGPNSCLCSPGWRGTICQIPICEQRCLFGSRCVRPNVCACRSGYMGTLCSRKL 250          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-235d18.5 (si:dkey-235d18.5 [Source:ZFIN;Acc:ZDB-GENE-041014-243])

HSP 1 Score: 136.346 bits (342), Expect = 7.445e-33
Identity = 83/215 (38.60%), Postives = 109/215 (50.70%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC--EKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCY----NGGKCVG-NMCQCPTGFFGPECKSRICITGLKFRKIIKPVIVQF 1952
            C+  CQN+G CV    C CP GY G  C + +C+  C +GG C+  N+C CS G+ G  C    C++ C NGG+C+ PN C C   Y G  C    C+PPC  GG C   N CSC +G  G RC  E   C P C NGG C+G N+C C + ++G  CE  + T C     +G  C   N C CP G  G  C+  +C        + + V   F
Sbjct:  503 CDPACQNSGVCVAPNTCDCPAGYPGAGC-SAMCSPPCAHGGSCMRWNVCLCSPGWTGEGCHTAVCELPCANGGRCIAPNTCQCPSDYSGPQCLTPQCSPPCVNGGRCVAINTCSCLDGWRGARCQIEPVRCVPACNNGGVCVGLNRCQCVEGYTGKHCETALVTPCVPPCQHGAVCAPLNSCVCPKGTSGIRCEKLVCPVVCTVVSMARAVRKGF 716          

HSP 2 Score: 122.479 bits (306), Expect = 2.408e-28
Identity = 91/305 (29.84%), Postives = 135/305 (44.26%), Query Frame = 3
Query: 1200 CSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCP--NESCNITCQNNGQCVKWKCFCPTGYQGKF-----CQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE---NHICTRCYNGGKCVG-NMCQCPTGFFGPECKSRI---CITGLKFRKIIKPV-----IVQFPVIVSNKMCIESTCTFIQPQRSVVVNKVVFKPYID 2057
            C   C +G + R        C     + ++ R+C     C   N  C   C N+     + C C  G++ +      CQ P+C+  C+N G C+ PN C C  G+ G  C  + C   C +GG C+R N+C C+ G+ G+ C   +C  PC  GG C   N C CP    G +C   +C P C+NGG C+  N C C   + G+ C+         C NGG CVG N CQC  G+ G  C++ +   C+   +   +  P+           I   K+     CT +   R+  V K   + Y+D
Sbjct:  428 CDHICSLGAESRIHC----SCRAGWELSADQRTCIDVDECVSVNGGCEQVCVNHAG--GFNCSCRAGFELRKDHPTKCQ-PLCDPACQNSGVCVAPNTCDCPAGYPGAGCSAM-CSPPCAHGGSCMRWNVCLCSPGWTGEGCHTAVCELPCANGGRCIAPNTCQCPSDYSGPQCLTPQCSPPCVNGGRCVAINTCSCLDGWRGARCQIEPVRCVPACNNGGVCVGLNRCQCVEGYTGKHCETALVTPCVPPCQHGAVCAPLNSCVCPKGTSGIRCEKLVCPVVCTVVSMARA--VRKGFRESYVD 722          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-30e9.7 (si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-540])

HSP 1 Score: 121.709 bits (304), Expect = 1.148e-31
Identity = 69/157 (43.95%), Postives = 88/157 (56.05%), Query Frame = 3
Query: 1422 ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCV-GNMCQCPTGFFGPEC 1886
            IC+  C++GG+C+  N C C  G+ G  CE   C   C NGG CL+PN+C C  G+ G  C+  +C+P C   G C   N CSCP G  G  C    C  +C NGG C+G N CHCP  + G  C+  IC + C NGG+CV  N C C  G+ GP C
Sbjct:    2 ICDPPCQHGGRCLSRNHCTCPYGYVGPRCETTDCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIGVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCLQKCRNGGECVGPNTCHCPAGWEGWQCQTPICKQTCLNGGRCVFPNFCHCRQGYTGPSC 158          

HSP 2 Score: 112.079 bits (279), Expect = 3.239e-28
Identity = 60/129 (46.51%), Postives = 79/129 (61.24%), Query Frame = 3
Query: 1521 CDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            CD  C++GG+CL  N CTC +GY+G  CE   C P C  GG C K N+C CP G  G++C+   C P C+N G C+G N C CP  + G  C   +C  +C NGG+CVG N C CP G+ G +C++ IC
Sbjct:    3 CDPPCQHGGRCLSRNHCTCPYGYVGPRCETTDCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIGVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCLQKCRNGGECVGPNTCHCPAGWEGWQCQTPIC 131          

HSP 3 Score: 108.997 bits (271), Expect = 3.589e-27
Identity = 64/156 (41.03%), Postives = 85/156 (54.49%), Query Frame = 3
Query: 1332 CNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            C+  CQ+ G+C+ +  C CP GY G  C+   C   C NGG C+ PN+C C  GF G  C+   CD  C N G+C+ PN C+C  G+ G  C   +C   C+ GG C   N C CP G  G +C+   C   C+NGG C+  N CHC Q ++G  C
Sbjct:    3 CDPPCQHGGRCLSRNHCTCPYGYVGPRCETTDCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIGVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCLQKCRNGGECVGPNTCHCPAGWEGWQCQTPICKQTCLNGGRCVFPNFCHCRQGYTGPSC 158          

HSP 4 Score: 92.8189 bits (229), Expect = 1.463e-21
Identity = 59/155 (38.06%), Postives = 75/155 (48.39%), Query Frame = 3
Query: 1242 PCQDD-ECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC 1700
            PCQ    CL + +        ++  RC    C   C N G C+K   C CP+G+ G  CQ  +C+  C N GKC+GPN C C  G+ G  C    C   C NGG+C+ PN C C  G+ G  C+  IC   C  GG C   N C C +G  G  C
Sbjct:    6 PCQHGGRCLSRNHCTCPYG--YVGPRCETTDCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIGVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCLQKCRNGGECVGPNTCHCPAGWEGWQCQTPICKQTCLNGGRCVFPNFCHCRQGYTGPSC 158          

HSP 5 Score: 88.1965 bits (217), Expect = 5.643e-20
Identity = 51/99 (51.52%), Postives = 62/99 (62.63%), Query Frame = 3
Query: 1614 ICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            IC+PPCQ GG C   N C+CP G VG RCE  +C P C+NGGTC+  N C CP  F GS C+  +C   C N GKCVG N C CP+G+ G  C   +C+
Sbjct:    2 ICDPPCQHGGRCLSRNHCTCPYGYVGPRCETTDCKPVCLNGGTCLKPNVCVCPSGFYGSQCQIGVCDPMCLNNGKCVGPNTCSCPSGWRGGICNIPVCL 100          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Zebrafish
Match: vwde (von Willebrand factor D and EGF domains [Source:ZFIN;Acc:ZDB-GENE-060929-1226])

HSP 1 Score: 122.094 bits (305), Expect = 3.520e-31
Identity = 69/166 (41.57%), Postives = 91/166 (54.82%), Query Frame = 3
Query: 1320 PNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPN---LCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENH 1805
            P  +C+  C++ G C++   CFC  GY+G+ CQ   C  KCKNGG+C+ P  C+C  GF G FC ++ CD  C NGG+C   N    C C   + G  C+  IC   C+ GGIC    ICSCP+G +G  C    C   C+NGG C+  N C C   F+G  CE  
Sbjct:   43 PKATCDPPCKHAGICIRNNTCFCSRGYEGETCQFANCYPKCKNGGECLRPGKCRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAPGICSCPDGWIGGACHTAVCKKPCVNGGKCVSPNTCRCRGLFTGPQCEER 208          

HSP 2 Score: 114.775 bits (286), Expect = 1.326e-28
Identity = 73/177 (41.24%), Postives = 93/177 (52.54%), Query Frame = 3
Query: 1386 PTGYQGKFCQNP--ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGN---ICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSR 1895
            P G    F  +P   C+  CK+ G CI  N C CS G+EG  C+   C   C+NGG+CLRP  C C  G+ GKFC + +C+  C  GG C   N    C CP    G+RC+   C   C NGG C+    C CP  + G  C   +C + C NGGKCV  N C+C   F GP+C+ R
Sbjct:   32 PRGVALPFVFDPKATCDPPCKHAGICIRNNTCFCSRGYEGETCQFANCYPKCKNGGECLRPGKCRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAPGICSCPDGWIGGACHTAVCKKPCVNGGKCVSPNTCRCRGLFTGPQCEER 208          

HSP 3 Score: 92.0485 bits (227), Expect = 1.150e-20
Identity = 57/139 (41.01%), Postives = 77/139 (55.40%), Query Frame = 3
Query: 1500 LFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCI---GKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            +F  K  CD  C++ G C+R N C C+ GY G+ C+   C P C+ GG C +   C CP G  G  C +  C   C NGG C    G+ KC CP S++GS C++ IC + C NGG CV   +C CP G+ G  C + +C
Sbjct:   40 VFDPKATCDPPCKHAGICIRNNTCFCSRGYEGETCQFANCYPKCKNGGECLRPGKCRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAPGICSCPDGWIGGACHTAVC 178          

HSP 4 Score: 86.6557 bits (213), Expect = 8.122e-19
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 3
Query: 1296 SCFIQKRCPNESCNIT-----CQNNGQCVK-WKCFCPTGYQGKFCQNPICNEKCKNGGKCI---GPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYE 1712
            +CF  +    E+C        C+N G+C++  KC CP+G+ GKFC   +C+  C NGG+C    G   C C   + G  C+   C   C+NGG C+ P +C+C  G+IG  C   +C  PC  GG C   N C C     G +CE+ +
Sbjct:   62 TCFCSRGYEGETCQFANCYPKCKNGGECLRPGKCRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAPGICSCPDGWIGGACHTAVCKKPCVNGGKCVSPNTCRCRGLFTGPQCEERK 209          

HSP 5 Score: 85.1149 bits (209), Expect = 2.368e-18
Identity = 52/138 (37.68%), Postives = 66/138 (47.83%), Query Frame = 3
Query: 1599 FCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG----NMCQCPTGFFGPECKSRICITGLKFRKI-IKPVIVQFPVIVSNKMCIESTC 1994
            F  K  C+PPC+  GIC + N C C  G  G  C+   CYP+C NGG C+   KC CP  F G FC   +C   C+NGG+C        C CP+ + G  C+  IC  G K   I + P I   P       C  + C
Sbjct:   41 FDPKATCDPPCKHAGICIRNNTCFCSRGYEGETCQFANCYPKCKNGGECLRPGKCRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAPGICSCPDGWIGGACHTAVC 178          

HSP 6 Score: 81.2629 bits (199), Expect = 5.689e-17
Identity = 49/123 (39.84%), Postives = 63/123 (51.22%), Query Frame = 3
Query: 1257 ECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCV----KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKR 1613
            ECL     K    S F  K C    C+  C N G+C     + KC CP+ + G  CQ+ IC + CKNGG C+ P IC C +G+ G  C    C   C NGG+C+ PN C C   + G  CE+R
Sbjct:   88 ECLRPG--KCRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAPGICSCPDGWIGGACHTAVCKKPCVNGGKCVSPNTCRCRGLFTGPQCEER 208          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Xenopus
Match: hif1an (hypoxia inducible factor 1 subunit alpha inhibitor [Source:Xenbase;Acc:XB-GENE-966944])

HSP 1 Score: 124.79 bits (312), Expect = 1.978e-30
Identity = 68/180 (37.78%), Postives = 91/180 (50.56%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCVGN 1847
            K C    C   C+N G C  +  C CP G+ G  C+  +C  +C NGG C+ P +C C  G+ G+ C+K+ C   C NGG C  P  C C  GY G+ CE   C  PC+ GG C   N C C +G  G+ C K  C P C + GTCI  NKC C + ++G +C         N  +  G+
Sbjct:  167 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNKRYGANAMNALRPTGS 346          

HSP 2 Score: 116.701 bits (291), Expect = 1.237e-27
Identity = 69/166 (41.57%), Postives = 85/166 (51.20%), Query Frame = 3
Query: 1404 KFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSR 1895
            K CQ   C   C+NGG C   ++C+C +GF G  CEK  C   C NGG C+ P LC C  GY G  C+K  C   C  GG C     C CP G  G +CE  +C   C NGG C G+NKC C + + G  C   +C   C + G C+  N CQC  G+ G  C  R
Sbjct:  167 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNKR 332          

HSP 3 Score: 94.3597 bits (233), Expect = 3.354e-20
Identity = 57/136 (41.91%), Postives = 62/136 (45.59%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK 1706
            F    C    C   C N G CV    C CP GY G  C    C   C NGG C  P  C C  G+EG  CE  KC   C NGG+C   N C C+ GY G  C K +C P C   G C + N C C EG  G  C K
Sbjct:  196 FYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNK 331          

HSP 4 Score: 77.0258 bits (188), Expect = 2.277e-14
Identity = 42/104 (40.38%), Postives = 57/104 (54.81%), Query Frame = 3
Query: 1596 KFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKC-VGNMCQCPTGFFGPECKSRIC 1901
            K C++  C   C+ GG C   ++C CP+G  G  CEK  C P+CMNGG C+    C CP  + G  C+   CT  C NGG C     C CP+G+ G +C++  C
Sbjct:  167 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKC 270          

HSP 5 Score: 54.299 bits (129), Expect = 3.792e-7
Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 3
Query: 1698 CEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCV-GNMCQCPTGFFGPECKSRICIT 1907
            C++ +C   C NGG C  ++ C CP  F G  CE  +C  RC NGG CV   +C CP G++G  C    C T
Sbjct:  169 CQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTT 240          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Xenopus
Match: hif1an (hypoxia inducible factor 1 subunit alpha inhibitor [Source:Xenbase;Acc:XB-GENE-966944])

HSP 1 Score: 124.79 bits (312), Expect = 2.449e-30
Identity = 68/180 (37.78%), Postives = 91/180 (50.56%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCVGN 1847
            K C    C   C+N G C  +  C CP G+ G  C+  +C  +C NGG C+ P +C C  G+ G+ C+K+ C   C NGG C  P  C C  GY G+ CE   C  PC+ GG C   N C C +G  G+ C K  C P C + GTCI  NKC C + ++G +C         N  +  G+
Sbjct:  170 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNKRYGANAMNALRPTGS 349          

HSP 2 Score: 116.316 bits (290), Expect = 1.552e-27
Identity = 69/166 (41.57%), Postives = 85/166 (51.20%), Query Frame = 3
Query: 1404 KFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSR 1895
            K CQ   C   C+NGG C   ++C+C +GF G  CEK  C   C NGG C+ P LC C  GY G  C+K  C   C  GG C     C CP G  G +CE  +C   C NGG C G+NKC C + + G  C   +C   C + G C+  N CQC  G+ G  C  R
Sbjct:  170 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNKR 335          

HSP 3 Score: 94.3597 bits (233), Expect = 4.141e-20
Identity = 57/136 (41.91%), Postives = 62/136 (45.59%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK 1706
            F    C    C   C N G CV    C CP GY G  C    C   C NGG C  P  C C  G+EG  CE  KC   C NGG+C   N C C+ GY G  C K +C P C   G C + N C C EG  G  C K
Sbjct:  199 FYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNK 334          

HSP 4 Score: 76.6406 bits (187), Expect = 2.484e-14
Identity = 42/104 (40.38%), Postives = 57/104 (54.81%), Query Frame = 3
Query: 1596 KFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKC-VGNMCQCPTGFFGPECKSRIC 1901
            K C++  C   C+ GG C   ++C CP+G  G  CEK  C P+CMNGG C+    C CP  + G  C+   CT  C NGG C     C CP+G+ G +C++  C
Sbjct:  170 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKC 273          

HSP 5 Score: 54.299 bits (129), Expect = 4.074e-7
Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 3
Query: 1698 CEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCV-GNMCQCPTGFFGPECKSRICIT 1907
            C++ +C   C NGG C  ++ C CP  F G  CE  +C  RC NGG CV   +C CP G++G  C    C T
Sbjct:  172 CQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTT 243          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Xenopus
Match: hif1an (hypoxia inducible factor 1 subunit alpha inhibitor [Source:Xenbase;Acc:XB-GENE-966944])

HSP 1 Score: 124.02 bits (310), Expect = 5.625e-30
Identity = 66/163 (40.49%), Postives = 87/163 (53.37%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            K C    C   C+N G C  +  C CP G+ G  C+  +C  +C NGG C+ P +C C  G+ G+ C+K+ C   C NGG C  P  C C  GY G+ CE   C  PC+ GG C   N C C +G  G+ C K  C P C + GTCI  NKC C + ++G +C
Sbjct:  170 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYC 332          

HSP 2 Score: 114.005 bits (284), Expect = 1.240e-26
Identity = 68/163 (41.72%), Postives = 84/163 (51.53%), Query Frame = 3
Query: 1404 KFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPEC 1886
            K CQ   C   C+NGG C   ++C+C +GF G  CEK  C   C NGG C+ P LC C  GY G  C+K  C   C  GG C     C CP G  G +CE  +C   C NGG C G+NKC C + + G  C   +C   C + G C+  N CQC  G+ G  C
Sbjct:  170 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYC 332          

HSP 3 Score: 95.1301 bits (235), Expect = 3.128e-20
Identity = 58/141 (41.13%), Postives = 63/141 (44.68%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYP 1721
            F    C    C   C N G CV    C CP GY G  C    C   C NGG C  P  C C  G+EG  CE  KC   C NGG+C   N C C+ GY G  C K +C P C   G C + N C C EG  G  C K    P
Sbjct:  199 FYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLCSKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNKTSITP 339          

HSP 4 Score: 77.0258 bits (188), Expect = 2.366e-14
Identity = 42/104 (40.38%), Postives = 57/104 (54.81%), Query Frame = 3
Query: 1596 KFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKC-VGNMCQCPTGFFGPECKSRIC 1901
            K C++  C   C+ GG C   ++C CP+G  G  CEK  C P+CMNGG C+    C CP  + G  C+   CT  C NGG C     C CP+G+ G +C++  C
Sbjct:  170 KTCQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKC 273          

HSP 5 Score: 54.299 bits (129), Expect = 4.928e-7
Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 3
Query: 1698 CEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVG-NMCQCPTGFFGPECKSRICIT 1907
            C++ +C   C NGG C  ++ C CP  F G  CE  +C  RC NGG CV   +C CP G++G  C    C T
Sbjct:  172 CQQAKCPGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTT 243          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Xenopus
Match: tenm4 (teneurin transmembrane protein 4 [Source:NCBI gene;Acc:100124701])

HSP 1 Score: 123.635 bits (309), Expect = 3.397e-28
Identity = 70/208 (33.65%), Postives = 95/208 (45.67%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPIC---NEKCKNGGKCIGPNICQCSEGFEGLFCEKLKC-DITCENGGQCLRPNLCTCAFGYIGKFCE--KRICNPPCQKGGICQ-KGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            F+   C   SC + C  NGQ +K +C C +G++G  C  P     +  C N G CI    C C+ G++G  CE++ C D TC   G C+R   C CA G+ G  CE  +  C   C   G  Q +  +CSC     G+ C    C   C   G CIG   C C + + G+ C+   C  RC   G C    C+C  G+ G  C    C
Sbjct:  352 FLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTSQCIDITCSNHGTCI-MGTCICNPGYKGENCEEVDCIDPTCSGRGVCVRGE-CHCAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIG-GSCRCDEGWMGTACDQRACHPRCNEHGTCRDGKCECSPGWNGEHCTIEGC 556          

HSP 2 Score: 114.39 bits (285), Expect = 2.195e-25
Identity = 68/200 (34.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query: 1326 ESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE--KLKC-DITCENGGQCLRPNLCTCAFGYIGKFCEKRIC-NPPCQKGGICQKGNICSCPEGTVGNRCE--KYECYPQCMNGGTCIGKNK-CHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            + C   C  NG+CV   C C  G+ G  C    C   C   G+ +    C C  G++G  C+    +C DITC N G C+    C C  GY G+ CE+  C +P C   G+C +G  C C  G  G  CE  +  C  QC   GT   +   C C  +++G  C   IC   C   G C+G  C+C  G+ G  C  R C
Sbjct:  329 DDCPSNCYGNGECVAGNCHCFLGFLGPDCGRASCPVLCSGNGQYMKGR-CLCHSGWKGAECDVPTSQCIDITCSNHGTCIM-GTCICNPGYKGENCEEVDCIDPTCSGRGVCVRGE-CHCAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIGGSCRCDEGWMGTACDQRAC 525          

HSP 3 Score: 110.153 bits (274), Expect = 4.569e-24
Identity = 65/199 (32.66%), Postives = 91/199 (45.73%), Query Frame = 3
Query: 1320 PNESC-NITCQNNGQCVKWKCFCPTGYQGKFCQNPIC-NEKCKNGGKCIGPNICQCSEGFEGLFCE--KLKCDITCE-NGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNG-GKCV----GNMCQCPTGFFGPEC 1886
            P   C +ITC N+G C+   C C  GY+G+ C+   C +  C   G C+    C C+ G+ G  CE  +  C   C  +G       +C+C   + G  C   IC   C   G+C  G+ C C EG +G  C++  C+P+C   GTC    KC C   ++G  C    C    NG G+C     G  C C  G+ G  C
Sbjct:  391 PTSQCIDITCSNHGTCIMGTCICNPGYKGENCEEVDCIDPTCSGRGVCVRGE-CHCAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIGGS-CRCDEGWMGTACDQRACHPRCNEHGTC-RDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLDLNGWHCVCQVGWRGSGC 586          

HSP 4 Score: 66.2402 bits (160), Expect = 1.829e-10
Identity = 47/182 (25.82%), Postives = 65/182 (35.71%), Query Frame = 3
Query: 1212 CGIGWQ----KRYRPCQDDECLEKENIKSEIRSC-----FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQC---LRPNLCTCAFGYIGKFCE---KRICN---------------PPCQKGGICQKGNIC 1667
            C IGW     +  R    D+C      ++E   C     +    C  E C   C  +G C+   C C  G+ G  C    C+ +C   G C     C+CS G+ G  C    C   C   G+C   L    C C  G+ G  C+   +  CN               P C     CQ  ++C
Sbjct:  445 CAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIGGSCRCDEGWMGTACDQRACHPRCNEHGTCRDGK-CECSPGWNGEHCTIEGCPGLCNGNGRCTLDLNGWHCVCQVGWRGSGCDISMETACNDGKDNDADGLVDCMDPDCCLQHSCQTSSLC 625          

HSP 5 Score: 50.8322 bits (120), Expect = 9.106e-6
Identity = 31/100 (31.00%), Postives = 41/100 (41.00%), Query Frame = 3
Query: 1617 CNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE----NHICTRCYNGGKCVGNMCQCPTGFFGPECKSRICI 1904
            C   C   G C  GN C C  G +G  C +  C   C   G  + K +C C   + G+ C+      I   C N G C+   C C  G+ G  C+   CI
Sbjct:  331 CPSNCYGNGECVAGN-CHCFLGFLGPDCGRASCPVLCSGNGQYM-KGRCLCHSGWKGAECDVPTSQCIDITCSNHGTCIMGTCICNPGYKGENCEEVDCI 428          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Xenopus
Match: tenm4 (teneurin transmembrane protein 4 [Source:NCBI gene;Acc:100124701])

HSP 1 Score: 123.635 bits (309), Expect = 3.411e-28
Identity = 70/208 (33.65%), Postives = 95/208 (45.67%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPIC---NEKCKNGGKCIGPNICQCSEGFEGLFCEKLKC-DITCENGGQCLRPNLCTCAFGYIGKFCE--KRICNPPCQKGGICQ-KGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            F+   C   SC + C  NGQ +K +C C +G++G  C  P     +  C N G CI    C C+ G++G  CE++ C D TC   G C+R   C CA G+ G  CE  +  C   C   G  Q +  +CSC     G+ C    C   C   G CIG   C C + + G+ C+   C  RC   G C    C+C  G+ G  C    C
Sbjct:  304 FLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTSQCIDITCSNHGTCI-MGTCICNPGYKGENCEEVDCIDPTCSGRGVCVRGE-CHCAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIG-GSCRCDEGWMGTACDQRACHPRCNEHGTCRDGKCECSPGWNGEHCTIEGC 508          

HSP 2 Score: 114.39 bits (285), Expect = 2.186e-25
Identity = 68/200 (34.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query: 1326 ESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE--KLKC-DITCENGGQCLRPNLCTCAFGYIGKFCEKRIC-NPPCQKGGICQKGNICSCPEGTVGNRCE--KYECYPQCMNGGTCIGKNK-CHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            + C   C  NG+CV   C C  G+ G  C    C   C   G+ +    C C  G++G  C+    +C DITC N G C+    C C  GY G+ CE+  C +P C   G+C +G  C C  G  G  CE  +  C  QC   GT   +   C C  +++G  C   IC   C   G C+G  C+C  G+ G  C  R C
Sbjct:  281 DDCPSNCYGNGECVAGNCHCFLGFLGPDCGRASCPVLCSGNGQYMKGR-CLCHSGWKGAECDVPTSQCIDITCSNHGTCIM-GTCICNPGYKGENCEEVDCIDPTCSGRGVCVRGE-CHCAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIGGSCRCDEGWMGTACDQRAC 477          

HSP 3 Score: 110.153 bits (274), Expect = 4.630e-24
Identity = 65/199 (32.66%), Postives = 91/199 (45.73%), Query Frame = 3
Query: 1320 PNESC-NITCQNNGQCVKWKCFCPTGYQGKFCQNPIC-NEKCKNGGKCIGPNICQCSEGFEGLFCE--KLKCDITCE-NGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNG-GKCV----GNMCQCPTGFFGPEC 1886
            P   C +ITC N+G C+   C C  GY+G+ C+   C +  C   G C+    C C+ G+ G  CE  +  C   C  +G       +C+C   + G  C   IC   C   G+C  G+ C C EG +G  C++  C+P+C   GTC    KC C   ++G  C    C    NG G+C     G  C C  G+ G  C
Sbjct:  343 PTSQCIDITCSNHGTCIMGTCICNPGYKGENCEEVDCIDPTCSGRGVCVRGE-CHCAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIGGS-CRCDEGWMGTACDQRACHPRCNEHGTC-RDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLDLNGWHCVCQVGWRGSGC 538          

HSP 4 Score: 66.2402 bits (160), Expect = 1.841e-10
Identity = 47/182 (25.82%), Postives = 65/182 (35.71%), Query Frame = 3
Query: 1212 CGIGWQ----KRYRPCQDDECLEKENIKSEIRSC-----FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQC---LRPNLCTCAFGYIGKFCE---KRICN---------------PPCQKGGICQKGNIC 1667
            C IGW     +  R    D+C      ++E   C     +    C  E C   C  +G C+   C C  G+ G  C    C+ +C   G C     C+CS G+ G  C    C   C   G+C   L    C C  G+ G  C+   +  CN               P C     CQ  ++C
Sbjct:  397 CAIGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIGGSCRCDEGWMGTACDQRACHPRCNEHGTCRDGK-CECSPGWNGEHCTIEGCPGLCNGNGRCTLDLNGWHCVCQVGWRGSGCDISMETACNDGKDNDADGLVDCMDPDCCLQHSCQTSSLC 577          

HSP 5 Score: 50.8322 bits (120), Expect = 9.169e-6
Identity = 31/100 (31.00%), Postives = 41/100 (41.00%), Query Frame = 3
Query: 1617 CNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE----NHICTRCYNGGKCVGNMCQCPTGFFGPECKSRICI 1904
            C   C   G C  GN C C  G +G  C +  C   C   G  + K +C C   + G+ C+      I   C N G C+   C C  G+ G  C+   CI
Sbjct:  283 CPSNCYGNGECVAGN-CHCFLGFLGPDCGRASCPVLCSGNGQYM-KGRCLCHSGWKGAECDVPTSQCIDITCSNHGTCIMGTCICNPGYKGENCEEVDCI 380          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Mouse
Match: Vwde (von Willebrand factor D and EGF domains [Source:MGI Symbol;Acc:MGI:2685313])

HSP 1 Score: 184.111 bits (466), Expect = 7.918e-48
Identity = 87/198 (43.94%), Postives = 119/198 (60.10%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            C  E C+  C++ G C+    C CP G+ G  C+  +CN  C+NGG+C+ P+ICQC  G+ G  C    CD  C NGG C +PN C C  G+ G  C+  +C+PPC+ GG+C + N+CSCP G  G RC+   C P CMNGG C+G N C C   +SG  C   IC  +C NGG+C+  +MC CP+ + G +C+  IC
Sbjct: 1545 CDEEHCSPPCEHGGTCLSGNLCTCPYGFVGPRCETLVCNRHCENGGECVAPDICQCKSGWYGPTCSTALCDPICLNGGSCYKPNTCLCPGGFFGTQCQNAVCHPPCKNGGLCMRNNVCSCPGGYTGKRCQTSICEPMCMNGGKCVGPNICSCASGWSGKQCNTPICLQKCKNGGECIAPSMCHCPSTWEGVQCQKPIC 1742          

HSP 2 Score: 168.703 bits (426), Expect = 8.720e-43
Identity = 91/236 (38.56%), Postives = 127/236 (53.81%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICITGLK-FRKIIKPVIVQFPVIVSNKMCIESTCT 1997
            +    C    C+  C+ +G+C+K   C CP G+ G  C    C+  C++GG C+  N+C C  GF G  CE L C+  CENGG+C+ P++C C  G+ G  C   +C+P C  GG C K N C CP G  G +C+   C+P C NGG C+  N C CP  ++G  C+  IC   C NGGKCVG N+C C +G+ G +C + IC+   K   + I P +   P       C +  CT
Sbjct: 1508 YTGSNCQTAICHPVCKKHGKCIKPNICACPPGHGGATCDEEHCSPPCEHGGTCLSGNLCTCPYGFVGPRCETLVCNRHCENGGECVAPDICQCKSGWYGPTCSTALCDPICLNGGSCYKPNTCLCPGGFFGTQCQNAVCHPPCKNGGLCMRNNVCSCPGGYTGKRCQTSICEPMCMNGGKCVGPNICSCASGWSGKQCNTPICLQKCKNGGECIAPSMCHCPSTWEGVQCQKPICT 1743          

HSP 3 Score: 160.999 bits (406), Expect = 2.216e-40
Identity = 86/202 (42.57%), Postives = 112/202 (55.45%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCV-GNMCQCPTGFFGPECKSRI 1898
            F+  RC    CN  C+N G+CV    C C +G+ G  C   +C+  C NGG C  PN C C  GF G  C+   C   C+NGG C+R N+C+C  GY GK C+  IC P C  GG C   NICSC  G  G +C    C  +C NGG CI  + CHCP ++ G  C+  ICT +C  GG+C    +C C TG+ G +C+ +I
Sbjct: 1572 FVGPRCETLVCNRHCENGGECVAPDICQCKSGWYGPTCSTALCDPICLNGGSCYKPNTCLCPGGFFGTQCQNAVCHPPCKNGGLCMRNNVCSCPGGYTGKRCQTSICEPMCMNGGKCVGPNICSCASGWSGKQCNTPICLQKCKNGGECIAPSMCHCPSTWEGVQCQKPICTQKCLYGGRCAFPGVCSCRTGYSGAKCEKKI 1773          

HSP 4 Score: 160.614 bits (405), Expect = 3.829e-40
Identity = 86/193 (44.56%), Postives = 108/193 (55.96%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRIC 1901
            C  +C  N +CV    C C  GY G  CQ  IC+  CK  GKCI PNIC C  G  G  C++  C   CE+GG CL  NLCTC +G++G  CE  +CN  C+ GG C   +IC C  G  G  C    C P C+NGG+C   N C CP  F G+ C+N +C   C NGG C+  N+C CP G+ G  C++ IC
Sbjct: 1486 CRHSCGRNRECVAPNTCKCKPGYTGSNCQTAICHPVCKKHGKCIKPNICACPPGHGGATCDEEHCSPPCEHGGTCLSGNLCTCPYGFVGPRCETLVCNRHCENGGECVAPDICQCKSGWYGPTCSTALCDPICLNGGSCYKPNTCLCPGGFFGTQCQNAVCHPPCKNGGLCMRNNVCSCPGGYTGKRCQTSIC 1678          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Mouse
Match: Tnxb (tenascin XB [Source:MGI Symbol;Acc:MGI:1932137])

HSP 1 Score: 138.658 bits (348), Expect = 5.271e-33
Identity = 75/237 (31.65%), Postives = 103/237 (43.46%), Query Frame = 3
Query: 1194 STCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            S C+ +C  GW           C +  + K+   S       P++SC   C + G+CV+ +C C  GY G  C  P C   C+  G+C+   +C C  GF G  C +  C   C   G+C     C C  GY G+ C  R C   C + G C+ G +C C  G  G  C    C   C   G C    +C C   +SG  C    C   C +GG+CV   C C  G+ G +C +R C
Sbjct:  141 SRCACSCEPGWG-------GPTCSDPTDTKTPTSSP------PSKSCPEDCNDQGRCVRGRCVCFPGYSGPSCSWPSCPGDCQGRGRCV-KGVCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENG-LCVCNPGYSGEDCGVRNCPRGCSQRGRC-EDGRCVCDPGYSGEDCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTC 360          

HSP 2 Score: 129.413 bits (324), Expect = 3.607e-30
Identity = 72/229 (31.44%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1212 CGIGWQKRYRPCQDDECLEKENIKSEIRSC---FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            CG+      R C  D C  + N +S    C   +  + C   +C   C+  G+CV  +C C  G+ G+ C +  C   C+  G C    +C C+ G+ G  C    C   C   GQCL   LC C  GY G+ C  R C   C + G+CQ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV  +C C  G+ G +C
Sbjct:  448 CGV------RSCPGD-CRGRGNCESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGHCEN-GVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVCQDG-LCMCHAGYAGEDCSIRTCPADCRRRGRC-EDGRCVCNPGYTGPACATRTCPADCRGRGRCVQGVCMCYVGYSGEDC 665          

HSP 3 Score: 126.331 bits (316), Expect = 3.464e-29
Identity = 77/248 (31.05%), Postives = 97/248 (39.11%), Query Frame = 3
Query: 1164 LSTVSPRSSWSTCSV-TCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            L   +P  S   C V  C  G  +R R C+D  C+       E         C   +C   C + G+CV  +C C  GY G+ C    C   C+  G+C     C C  G+ G  C    C   C   G C     C C  GY G  C  R C   C+  G C+ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV   C C  GF G +C SR C
Sbjct:  281 LCVCNPGYSGEDCGVRNCPRGCSQRGR-CEDGRCVCDPGYSGE--------DCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTCPRDCRGRGRCEDGE-CICDAGYSGDDCGVRSCPGDCNQRGHC-EDGRCVCWPGYTGADCSTRACPRDCRGRGRCEDG-VCVCHAGYSGEDCGVRSCPGDCRGRGNC-ESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC 515          

HSP 4 Score: 122.479 bits (306), Expect = 5.248e-28
Identity = 65/206 (31.55%), Postives = 87/206 (42.23%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC--ENHICTRCYNGGK----CVGNMCQCPTGFFGPECKSRIC 1901
            F  + C +  C   C+ +G C    C C  GY G  C    C   C+  G+C+   +C+C EG+ G  C   +C   C   G C +  LC C  GY G+ C  R C   C++ G C+ G  C C  G  G  C    C   C   G C+ +  C C   +SG  C  E    + C  G      C    C C  GF GP+C  + C
Sbjct:  505 FTGEDCGSRRCPGDCRGHGHCENGVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVC-QDGLCMCHAGYAGEDCSIRTCPADCRRRGRCEDGR-CVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC 706          

HSP 5 Score: 85.1149 bits (209), Expect = 2.108e-16
Identity = 57/194 (29.38%), Postives = 74/194 (38.14%), Query Frame = 3
Query: 1383 CPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE-------------KLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFR 1922
            CPT  Q    Q  + +    +G   +    C C  G+ G  C                 C   C + G+C+R   C C  GY G  C    C   CQ  G C KG +C C  G  G  C +  C   C   G C  + +C C   +SG  C    C R C   G+C   +C C  G+ G +C  R C  G   R
Sbjct:  115 CPTAAQAGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPEDCNDQGRCVRGR-CVCFPGYSGPSCSWPSCPGDCQGRGRCVKG-VCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENGLCVCNPGYSGEDCGVRNCPRGCSQR 305          

HSP 6 Score: 78.9518 bits (193), Expect = 1.777e-14
Identity = 43/156 (27.56%), Postives = 65/156 (41.67%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGG----QCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC 1700
            CQD  C+          + +  + C   +C   C+  G+C   +C C  GY G  C    C   C+  G+C+   +C C  G+ G  C + +   +   GG    +  R   C C  G+ G  C  + C   C+  G C +G  C C EG  G+ C
Sbjct:  587 CQDGLCM--------CHAGYAGEDCSIRTCPADCRRRGRCEDGRCVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGR-CVCQEGYAGDDC 732          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Mouse
Match: Tnxb (tenascin XB [Source:MGI Symbol;Acc:MGI:1932137])

HSP 1 Score: 137.887 bits (346), Expect = 7.771e-33
Identity = 75/237 (31.65%), Postives = 103/237 (43.46%), Query Frame = 3
Query: 1194 STCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            S C+ +C  GW           C +  + K+   S       P++SC   C + G+CV+ +C C  GY G  C  P C   C+  G+C+   +C C  GF G  C +  C   C   G+C     C C  GY G+ C  R C   C + G C+ G +C C  G  G  C    C   C   G C    +C C   +SG  C    C   C +GG+CV   C C  G+ G +C +R C
Sbjct:  141 SRCACSCEPGWG-------GPTCSDPTDTKTPTSSP------PSKSCPEDCNDQGRCVRGRCVCFPGYSGPSCSWPSCPGDCQGRGRCV-KGVCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENG-LCVCNPGYSGEDCGVRNCPRGCSQRGRC-EDGRCVCDPGYSGEDCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTC 360          

HSP 2 Score: 129.028 bits (323), Expect = 5.352e-30
Identity = 72/229 (31.44%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1212 CGIGWQKRYRPCQDDECLEKENIKSEIRSC---FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            CG+      R C  D C  + N +S    C   +  + C   +C   C+  G+CV  +C C  G+ G+ C +  C   C+  G C    +C C+ G+ G  C    C   C   GQCL   LC C  GY G+ C  R C   C + G+CQ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV  +C C  G+ G +C
Sbjct:  448 CGV------RSCPGD-CRGRGNCESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGHCEN-GVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVCQDG-LCMCHAGYAGEDCSIRTCPADCRRRGRC-EDGRCVCNPGYTGPACATRTCPADCRGRGRCVQGVCMCYVGYSGEDC 665          

HSP 3 Score: 125.946 bits (315), Expect = 4.873e-29
Identity = 77/248 (31.05%), Postives = 97/248 (39.11%), Query Frame = 3
Query: 1164 LSTVSPRSSWSTCSV-TCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            L   +P  S   C V  C  G  +R R C+D  C+       E         C   +C   C + G+CV  +C C  GY G+ C    C   C+  G+C     C C  G+ G  C    C   C   G C     C C  GY G  C  R C   C+  G C+ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV   C C  GF G +C SR C
Sbjct:  281 LCVCNPGYSGEDCGVRNCPRGCSQRGR-CEDGRCVCDPGYSGE--------DCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTCPRDCRGRGRCEDGE-CICDAGYSGDDCGVRSCPGDCNQRGHC-EDGRCVCWPGYTGADCSTRACPRDCRGRGRCEDG-VCVCHAGYSGEDCGVRSCPGDCRGRGNC-ESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC 515          

HSP 4 Score: 122.094 bits (305), Expect = 7.378e-28
Identity = 65/206 (31.55%), Postives = 87/206 (42.23%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC--ENHICTRCYNGGK----CVGNMCQCPTGFFGPECKSRIC 1901
            F  + C +  C   C+ +G C    C C  GY G  C    C   C+  G+C+   +C+C EG+ G  C   +C   C   G C +  LC C  GY G+ C  R C   C++ G C+ G  C C  G  G  C    C   C   G C+ +  C C   +SG  C  E    + C  G      C    C C  GF GP+C  + C
Sbjct:  505 FTGEDCGSRRCPGDCRGHGHCENGVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVC-QDGLCMCHAGYAGEDCSIRTCPADCRRRGRCEDGR-CVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC 706          

HSP 5 Score: 84.7297 bits (208), Expect = 2.804e-16
Identity = 57/194 (29.38%), Postives = 74/194 (38.14%), Query Frame = 3
Query: 1383 CPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE-------------KLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFR 1922
            CPT  Q    Q  + +    +G   +    C C  G+ G  C                 C   C + G+C+R   C C  GY G  C    C   CQ  G C KG +C C  G  G  C +  C   C   G C  + +C C   +SG  C    C R C   G+C   +C C  G+ G +C  R C  G   R
Sbjct:  115 CPTAAQAGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPEDCNDQGRCVRGR-CVCFPGYSGPSCSWPSCPGDCQGRGRCVKG-VCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENGLCVCNPGYSGEDCGVRNCPRGCSQR 305          

HSP 6 Score: 78.5666 bits (192), Expect = 2.207e-14
Identity = 43/156 (27.56%), Postives = 65/156 (41.67%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGG----QCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC 1700
            CQD  C+          + +  + C   +C   C+  G+C   +C C  GY G  C    C   C+  G+C+   +C C  G+ G  C + +   +   GG    +  R   C C  G+ G  C  + C   C+  G C +G  C C EG  G+ C
Sbjct:  587 CQDGLCM--------CHAGYAGEDCSIRTCPADCRRRGRCEDGRCVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGR-CVCQEGYAGDDC 732          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Mouse
Match: Tnxb (tenascin XB [Source:MGI Symbol;Acc:MGI:1932137])

HSP 1 Score: 137.117 bits (344), Expect = 1.301e-32
Identity = 75/237 (31.65%), Postives = 103/237 (43.46%), Query Frame = 3
Query: 1194 STCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            S C+ +C  GW           C +  + K+   S       P++SC   C + G+CV+ +C C  GY G  C  P C   C+  G+C+   +C C  GF G  C +  C   C   G+C     C C  GY G+ C  R C   C + G C+ G +C C  G  G  C    C   C   G C    +C C   +SG  C    C   C +GG+CV   C C  G+ G +C +R C
Sbjct:  141 SRCACSCEPGWG-------GPTCSDPTDTKTPTSSP------PSKSCPEDCNDQGRCVRGRCVCFPGYSGPSCSWPSCPGDCQGRGRCV-KGVCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENG-LCVCNPGYSGEDCGVRNCPRGCSQRGRC-EDGRCVCDPGYSGEDCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTC 360          

HSP 2 Score: 128.257 bits (321), Expect = 8.622e-30
Identity = 72/229 (31.44%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1212 CGIGWQKRYRPCQDDECLEKENIKSEIRSC---FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            CG+      R C  D C  + N +S    C   +  + C   +C   C+  G+CV  +C C  G+ G+ C +  C   C+  G C    +C C+ G+ G  C    C   C   GQCL   LC C  GY G+ C  R C   C + G+CQ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV  +C C  G+ G +C
Sbjct:  448 CGV------RSCPGD-CRGRGNCESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGHCEN-GVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVCQDG-LCMCHAGYAGEDCSIRTCPADCRRRGRC-EDGRCVCNPGYTGPACATRTCPADCRGRGRCVQGVCMCYVGYSGEDC 665          

HSP 3 Score: 125.176 bits (313), Expect = 7.981e-29
Identity = 77/248 (31.05%), Postives = 97/248 (39.11%), Query Frame = 3
Query: 1164 LSTVSPRSSWSTCSV-TCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            L   +P  S   C V  C  G  +R R C+D  C+       E         C   +C   C + G+CV  +C C  GY G+ C    C   C+  G+C     C C  G+ G  C    C   C   G C     C C  GY G  C  R C   C+  G C+ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV   C C  GF G +C SR C
Sbjct:  281 LCVCNPGYSGEDCGVRNCPRGCSQRGR-CEDGRCVCDPGYSGE--------DCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTCPRDCRGRGRCEDGE-CICDAGYSGDDCGVRSCPGDCNQRGHC-EDGRCVCWPGYTGADCSTRACPRDCRGRGRCEDG-VCVCHAGYSGEDCGVRSCPGDCRGRGNC-ESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC 515          

HSP 4 Score: 121.709 bits (304), Expect = 1.155e-27
Identity = 65/206 (31.55%), Postives = 87/206 (42.23%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC--ENHICTRCYNGGK----CVGNMCQCPTGFFGPECKSRIC 1901
            F  + C +  C   C+ +G C    C C  GY G  C    C   C+  G+C+   +C+C EG+ G  C   +C   C   G C +  LC C  GY G+ C  R C   C++ G C+ G  C C  G  G  C    C   C   G C+ +  C C   +SG  C  E    + C  G      C    C C  GF GP+C  + C
Sbjct:  505 FTGEDCGSRRCPGDCRGHGHCENGVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVC-QDGLCMCHAGYAGEDCSIRTCPADCRRRGRCEDGR-CVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC 706          

HSP 5 Score: 84.3445 bits (207), Expect = 4.141e-16
Identity = 57/194 (29.38%), Postives = 74/194 (38.14%), Query Frame = 3
Query: 1383 CPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE-------------KLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFR 1922
            CPT  Q    Q  + +    +G   +    C C  G+ G  C                 C   C + G+C+R   C C  GY G  C    C   CQ  G C KG +C C  G  G  C +  C   C   G C  + +C C   +SG  C    C R C   G+C   +C C  G+ G +C  R C  G   R
Sbjct:  115 CPTAAQAGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPEDCNDQGRCVRGR-CVCFPGYSGPSCSWPSCPGDCQGRGRCVKG-VCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENGLCVCNPGYSGEDCGVRNCPRGCSQR 305          

HSP 6 Score: 78.1814 bits (191), Expect = 2.843e-14
Identity = 43/156 (27.56%), Postives = 65/156 (41.67%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGG----QCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC 1700
            CQD  C+          + +  + C   +C   C+  G+C   +C C  GY G  C    C   C+  G+C+   +C C  G+ G  C + +   +   GG    +  R   C C  G+ G  C  + C   C+  G C +G  C C EG  G+ C
Sbjct:  587 CQDGLCM--------CHAGYAGEDCSIRTCPADCRRRGRCEDGRCVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGR-CVCQEGYAGDDC 732          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Mouse
Match: Tnxb (tenascin XB [Source:MGI Symbol;Acc:MGI:1932137])

HSP 1 Score: 134.42 bits (337), Expect = 9.170e-32
Identity = 75/237 (31.65%), Postives = 103/237 (43.46%), Query Frame = 3
Query: 1194 STCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            S C+ +C  GW           C +  + K+   S       P++SC   C + G+CV+ +C C  GY G  C  P C   C+  G+C+   +C C  GF G  C +  C   C   G+C     C C  GY G+ C  R C   C + G C+ G +C C  G  G  C    C   C   G C    +C C   +SG  C    C   C +GG+CV   C C  G+ G +C +R C
Sbjct:  141 SRCACSCEPGWG-------GPTCSDPTDTKTPTSSP------PSKSCPEDCNDQGRCVRGRCVCFPGYSGPSCSWPSCPGDCQGRGRCV-KGVCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENG-LCVCNPGYSGEDCGVRNCPRGCSQRGRC-EDGRCVCDPGYSGEDCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTC 360          

HSP 2 Score: 125.561 bits (314), Expect = 5.506e-29
Identity = 72/229 (31.44%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1212 CGIGWQKRYRPCQDDECLEKENIKSEIRSC---FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            CG+      R C  D C  + N +S    C   +  + C   +C   C+  G+CV  +C C  G+ G+ C +  C   C+  G C    +C C+ G+ G  C    C   C   GQCL   LC C  GY G+ C  R C   C + G+CQ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV  +C C  G+ G +C
Sbjct:  448 CGV------RSCPGD-CRGRGNCESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGHCEN-GVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVCQDG-LCMCHAGYAGEDCSIRTCPADCRRRGRC-EDGRCVCNPGYTGPACATRTCPADCRGRGRCVQGVCMCYVGYSGEDC 665          

HSP 3 Score: 122.479 bits (306), Expect = 5.079e-28
Identity = 77/248 (31.05%), Postives = 97/248 (39.11%), Query Frame = 3
Query: 1164 LSTVSPRSSWSTCSV-TCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            L   +P  S   C V  C  G  +R R C+D  C+       E         C   +C   C + G+CV  +C C  GY G+ C    C   C+  G+C     C C  G+ G  C    C   C   G C     C C  GY G  C  R C   C+  G C+ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV   C C  GF G +C SR C
Sbjct:  281 LCVCNPGYSGEDCGVRNCPRGCSQRGR-CEDGRCVCDPGYSGE--------DCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTCPRDCRGRGRCEDGE-CICDAGYSGDDCGVRSCPGDCNQRGHC-EDGRCVCWPGYTGADCSTRACPRDCRGRGRCEDG-VCVCHAGYSGEDCGVRSCPGDCRGRGNC-ESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC 515          

HSP 4 Score: 119.398 bits (298), Expect = 5.998e-27
Identity = 65/206 (31.55%), Postives = 87/206 (42.23%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC--ENHICTRCYNGGK----CVGNMCQCPTGFFGPECKSRIC 1901
            F  + C +  C   C+ +G C    C C  GY G  C    C   C+  G+C+   +C+C EG+ G  C   +C   C   G C +  LC C  GY G+ C  R C   C++ G C+ G  C C  G  G  C    C   C   G C+ +  C C   +SG  C  E    + C  G      C    C C  GF GP+C  + C
Sbjct:  505 FTGEDCGSRRCPGDCRGHGHCENGVCVCAVGYSGDDCSTRSCPSDCRGRGQCLN-GLCECDEGYSGEDCGIRRCPRDCSQHGVC-QDGLCMCHAGYAGEDCSIRTCPADCRRRGRCEDGR-CVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC 706          

HSP 5 Score: 82.8037 bits (203), Expect = 1.287e-15
Identity = 57/194 (29.38%), Postives = 74/194 (38.14%), Query Frame = 3
Query: 1383 CPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE-------------KLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFR 1922
            CPT  Q    Q  + +    +G   +    C C  G+ G  C                 C   C + G+C+R   C C  GY G  C    C   CQ  G C KG +C C  G  G  C +  C   C   G C  + +C C   +SG  C    C R C   G+C   +C C  G+ G +C  R C  G   R
Sbjct:  115 CPTAAQAGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPEDCNDQGRCVRGR-CVCFPGYSGPSCSWPSCPGDCQGRGRCVKG-VCVCRAGFSGPDCSQRSCPRNCNQRGRC-EEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENGLCVCNPGYSGEDCGVRNCPRGCSQR 305          

HSP 6 Score: 76.6406 bits (187), Expect = 8.190e-14
Identity = 43/156 (27.56%), Postives = 65/156 (41.67%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGG----QCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC 1700
            CQD  C+          + +  + C   +C   C+  G+C   +C C  GY G  C    C   C+  G+C+   +C C  G+ G  C + +   +   GG    +  R   C C  G+ G  C  + C   C+  G C +G  C C EG  G+ C
Sbjct:  587 CQDGLCM--------CHAGYAGEDCSIRTCPADCRRRGRCEDGRCVCNPGYTGPACATRTCPADCRGRGRCV-QGVCMCYVGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGR-CVCQEGYAGDDC 732          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N2E2|VWDE_HUMAN (von Willebrand factor D and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWDE PE=2 SV=4)

HSP 1 Score: 179.104 bits (453), Expect = 1.999e-45
Identity = 87/198 (43.94%), Postives = 117/198 (59.09%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            C  E CN  CQ+ G C+    C CP G+ G  C+  +CN  C+NGG+C+ P+ICQC  G+ G  C    CD  C NGG C +PN C C  G+ G+ C+   C+PPC+ GG C + N+C C EG  G R +K  C P CMNGG C+G + C CP  +SG  C   IC  +C NGG+C+  ++C CP+ + G  C+  IC
Sbjct: 1357 CDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPICLQKCKNGGECIAPSICHCPSSWEGVRCQIPIC 1554          

HSP 2 Score: 164.851 bits (416), Expect = 8.219e-41
Identity = 85/204 (41.67%), Postives = 115/204 (56.37%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            +I   C    C+  C+N+G+C+K   C C  G+ G  C    CN  C++GG C+  N+C C  GF G  CE + C+  CENGGQCL P++C C  G+ G  C   +C+P C  GG C K N C CP G  G  C+   C+P C NGG C+  N C C + ++G   +  IC   C NGGKCVG + C CP+G+ G  C + IC+
Sbjct: 1320 YIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPICL 1523          

HSP 3 Score: 153.68 bits (387), Expect = 4.152e-37
Identity = 91/225 (40.44%), Postives = 115/225 (51.11%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRIC-ITGLKFRKIIKPVIVQFPVIVSNKMCIESTC 1994
            C   C  + +CV    C C  GY G  CQ  +C+  CKN GKCI PNICQC  G  G  C++  C+  C++GG CL  NLCTC +G++G  CE  +CN  C+ GG C   +IC C  G  G  C    C P C+NGG+C   N C CP  F G  C+N  C   C NGG C+  N+C C  G+ G   +  IC  T +   K + P     P   S K C    C
Sbjct: 1298 CKYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPIC 1522          

HSP 4 Score: 144.821 bits (364), Expect = 2.529e-34
Identity = 71/162 (43.83%), Postives = 92/162 (56.79%), Query Frame = 3
Query: 1422 ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKC-VGNMCQCPTGFFGPECKSRIC 1901
            IC   C    +C+ PNIC+C  G+ G  C+   CD  C+N G+C++PN+C C  G+ G  C++  CNPPCQ GG C  GN+C+CP G VG RCE   C   C NGG C+  + C C   + G  C   +C   C NGG C   N C CP GFFG  C++  C
Sbjct: 1297 ICKYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFC 1458          

HSP 5 Score: 133.65 bits (335), Expect = 1.024e-30
Identity = 73/168 (43.45%), Postives = 92/168 (54.76%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR 1817
            C    C+  C N G C K   C CP G+ G+ CQN  C+  CKNGG C+  N+C C EG+ G   +K  CD TC NGG+C+ P+ C+C  G+ GK C   IC   C+ GG C   +IC CP    G RC+   C P+C+ GG CI  N C C   +SG  CE  I  R
Sbjct: 1421 CSTALCDPVCLNGGSCNKPNTCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKCVGPSTCSCPSGWSGKRCNTPICLQKCKNGGECIAPSICHCPSSWEGVRCQIPICNPKCLYGGRCIFPNVCSCRTEYSGVKCEKKIQIR 1588          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. UniProt/SwissProt
Match: sp|P24821|TENA_HUMAN (Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3)

HSP 1 Score: 130.568 bits (327), Expect = 9.843e-30
Identity = 71/220 (32.27%), Postives = 100/220 (45.45%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C++ +C+  E       S   +KRCP +     C N G+CV  +C C  G+ G  C    C   C   G+C+    C C EG+ G  C +L+C   C + G+C+    C C  G+ G  C    C   C + G C  G +C C +G  G  C   +C   C N G C+   +C C   F+G  C    C   C+  G+CV   C C  GF G +CK + C
Sbjct:  356 CEEGQCVCDEGFAGVDCS---EKRCPAD-----CHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQ-CVCDEGYTGEDCSQLRCPNDCHSRGRCVEGK-CVCEQGFKGYDCSDMSCPNDCHQHGRCVNG-MCVCDDGYTGEDCRDRQCPRDCSNRGLCV-DGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRC 563          

HSP 2 Score: 129.413 bits (324), Expect = 2.534e-29
Identity = 83/256 (32.42%), Postives = 111/256 (43.36%), Query Frame = 3
Query: 1176 SPRSSWST--CSVTCGIGWQKRYRPCQDDECLEKENIKSEI-------RSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKC-KNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRICITG 1910
            S R ++ST  C   C  GW+     C + EC    +++             F  + C   +C   C + G+CV   C C  GY G  C   IC   C +  G C+   +C C +GF G  C K  C   C N G+C+  N C C  G+ G+ C + IC   C   G C  G  C C EG  G  C K  C   C   G C  + +C C + F+G  C    C   C+N G+CV   C+C  GF G +C    C  G
Sbjct:  162 SGRGNFSTEGCGCVCEPGWKGP--NCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVD-GLCVCHDGFAGDDCNKPLCLNNCYNRGRCVE-NECVCDEGFTGEDCSELICPNDCFDRGRCINGT-CYCEEGFTGEDCGKPTCPHACHTQGRC-EEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNG 411          

HSP 3 Score: 128.642 bits (322), Expect = 4.676e-29
Identity = 71/215 (33.02%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            C + +C+  E    E  S   Q RCPN+     C + G+CV+ KC C  G++G  C +  C   C   G+C+   +C C +G+ G  C   +C   C N G C+    C C  G+ G  C +  C   C   G C  G  C C EG +G  C++  C   C   G C+   +C C + F+G  C  H C + C N G+CV   C C  G+ G +C
Sbjct:  418 CVNGQCVCDEGYTGEDCS---QLRCPND-----CHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCVNGQ-CVCHEGFMGKDCKEQRCPSDCHGQGRCV-DGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDC 620          

HSP 4 Score: 128.257 bits (321), Expect = 4.842e-29
Identity = 66/208 (31.73%), Postives = 92/208 (44.23%), Query Frame = 3
Query: 1281 KSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            + E    F    C    C   C  +G+CV  +C C  GY G+ C    C   C + G+C+    C C +GF+G  C  + C   C   G+C+   +C C  GY G+ C  R C   C   G+C  G  C C +G  G  C +  C   C   G C+   +C C + F G  C+   C + C+  G+CV   C C  GF G +C    C
Sbjct:  391 RCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCV-EGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVN-GMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQ-CVCEDGFTGPDCAELSCPNDCHGQGRCV-NGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSC 594          

HSP 5 Score: 54.6842 bits (130), Expect = 3.698e-6
Identity = 24/72 (33.33%), Postives = 35/72 (48.61%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL 1517
            F+ K C  + C   C   G+CV  +C C  G+ G  C    C   C N G+C+    C C+EG+ G  C ++
Sbjct:  553 FMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGR-CICNEGYSGEDCSEV 623          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W6F8|WIF1_XENLA (Wnt inhibitory factor 1 OS=Xenopus laevis OX=8355 GN=wif1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.024e-29
Identity = 68/180 (37.78%), Postives = 91/180 (50.56%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCVGN 1847
            K C    C   C+N G C  +  C CP G+ G  C+  +C  +C NGG C+ P +C C  G+ G+ C+K+ C   C NGG C  P  C C  GY G+ CE   C  PC+ GG C   N C C +G  G+ C K  C P C   GTCI  NKC C + ++G +C     +   N  +  G+
Sbjct:  170 KTCQQAKCTGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGKNKCKCSKGYQGDLCSKPVCEPSCGAHGTCIEPNKCQCKEGWNGRYCNKKYGSNLMNALRPTGS 349          

HSP 2 Score: 116.316 bits (290), Expect = 8.070e-27
Identity = 71/181 (39.23%), Postives = 88/181 (48.62%), Query Frame = 3
Query: 1404 KFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRICITGLKFRKIIKPV 1940
            K CQ   C   C+NGG C   ++C+C +GF G  CEK  C   C NGG C+ P LC C  GY G  C+K  C   C  GG C     C CP G  G +CE  +C   C NGG C GKNKC C + + G  C   +C   C   G C+  N CQC  G+ G  C  +    G      ++P 
Sbjct:  170 KTCQQAKCTGGCRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGKNKCKCSKGYQGDLCSKPVCEPSCGAHGTCIEPNKCQCKEGWNGRYCNKKY---GSNLMNALRPT 347          

HSP 3 Score: 95.1301 bits (235), Expect = 1.184e-19
Identity = 57/136 (41.91%), Postives = 62/136 (45.59%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK 1706
            F    C    C   C N G CV    C CP GY G  C    C   C NGG C  P  C C  G+EG  CE  KC   C NGG+C   N C C+ GY G  C K +C P C   G C + N C C EG  G  C K
Sbjct:  199 FYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGKNKCKCSKGYQGDLCSKPVCEPSCGAHGTCIEPNKCQCKEGWNGRYCNK 334          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W6F9|WIF1_DANRE (Wnt inhibitory factor 1 OS=Danio rerio OX=7955 GN=wif1 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 5.734e-29
Identity = 73/198 (36.87%), Postives = 96/198 (48.48%), Query Frame = 3
Query: 1404 KFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRICITGLKFRKIIKPVIVQFPVIVSNKMCIEST 1991
            K CQ   C   C+NGG C    +C+C +GF G+ CEK  C   C NGG C+ P +C C  GY G  CE+  C+  C  GG C     C C     G RCE  +C   C NGG C G+NKC C + + G  C   +C   C   G CV  N CQC  G+ G  C  R    G+   + + P   + P + + K   E++
Sbjct:  173 KTCQRAKCPGGCRNGGYCNERQVCECQDGFYGVHCEKALCSPRCLNGGLCMSPGVCICPPGYFGSSCERANCSTTCLNGGTCFHPGKCICAVSFEGVRCELSKCRQPCRNGGKCTGRNKCKCSKGYHGDLCSKAVCEPSCGAHGTCVEPNRCQCREGWHGRHCNKRF-RGGVSNSQRVSPSKHKSPSVAAAKEAPETS 369          

HSP 2 Score: 119.013 bits (297), Expect = 1.407e-27
Identity = 63/163 (38.65%), Postives = 83/163 (50.92%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            K C    C   C+N G C + + C C  G+ G  C+  +C+ +C NGG C+ P +C C  G+ G  CE+  C  TC NGG C  P  C CA  + G  CE   C  PC+ GG C   N C C +G  G+ C K  C P C   GTC+  N+C C + + G  C
Sbjct:  173 KTCQRAKCPGGCRNGGYCNERQVCECQDGFYGVHCEKALCSPRCLNGGLCMSPGVCICPPGYFGSSCERANCSTTCLNGGTCFHPGKCICAVSFEGVRCELSKCRQPCRNGGKCTGRNKCKCSKGYHGDLCSKAVCEPSCGAHGTCVEPNRCQCREGWHGRHC 335          

HSP 3 Score: 98.5969 bits (244), Expect = 7.764e-21
Identity = 57/141 (40.43%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 1287 EIRSCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK 1706
            E +  F    C    C+  C N G C+    C CP GY G  C+   C+  C NGG C  P  C C+  FEG+ CE  KC   C NGG+C   N C C+ GY G  C K +C P C   G C + N C C EG  G  C K
Sbjct:  197 ECQDGFYGVHCEKALCSPRCLNGGLCMSPGVCICPPGYFGSSCERANCSTTCLNGGTCFHPGKCICAVSFEGVRCELSKCRQPCRNGGKCTGRNKCKCSKGYHGDLCSKAVCEPSCGAHGTCVEPNRCQCREGWHGRHCNK 337          

HSP 4 Score: 82.8037 bits (203), Expect = 1.404e-15
Identity = 41/106 (38.68%), Postives = 57/106 (53.77%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVK-WKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRI 1616
            +    C   +C+ TC N G C    KC C   ++G  C+   C + C+NGGKC G N C+CS+G+ G  C K  C+ +C   G C+ PN C C  G+ G+ C KR 
Sbjct:  234 YFGSSCERANCSTTCLNGGTCFHPGKCICAVSFEGVRCELSKCRQPCRNGGKCTGRNKCKCSKGYHGDLCSKAVCEPSCGAHGTCVEPNRCQCREGWHGRHCNKRF 339          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. UniProt/SwissProt
Match: sp|P22105|TENX_HUMAN (Tenascin-X OS=Homo sapiens OX=9606 GN=TNXB PE=1 SV=5)

HSP 1 Score: 126.716 bits (317), Expect = 1.779e-28
Identity = 63/196 (32.14%), Postives = 88/196 (44.90%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPEC 1886
            +  + C   +C   C+  G+CV  +C C  G+ G+ C +  C   C+  G C    +C C  G+ G  C    C   C   GQCL    C C  GY G+ C  R C   C + G+CQ G +C C EG V   C    C   C   G C  + +C C   ++G  C   +C   C   G+CV  +C C  G+ G +C
Sbjct:  487 YTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLC-EDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCL-DGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDG-VCICWEGYVSEDCSIRTCPSNCHGRGRC-EEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDC 678          

HSP 2 Score: 126.716 bits (317), Expect = 2.175e-28
Identity = 63/187 (33.69%), Postives = 82/187 (43.85%), Query Frame = 3
Query: 1344 CQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C + G+CV+ +C C  GY G  C  P C   C+  G+C+   +C C  GF G  C +  C   C   G+C     C C  GY G  C  R C   C + G C+ G  C C  G  G  C    C   C   G C    +C C   ++G  C    C   C  GG+CV   C C  G+ G +C +R C
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV-QGVCVCRAGFSGPDCSQRSCPRGCSQRGRC-EGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGR-CVCNPGYTGEDCGVRSCPRGCSQRGRC-KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTC 373          

HSP 3 Score: 125.561 bits (314), Expect = 3.970e-28
Identity = 76/244 (31.15%), Postives = 97/244 (39.75%), Query Frame = 3
Query: 1176 SPRSSWSTCSV-TCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            +P  +   C V +C  G  +R R C+D  C+       E         C   SC   C   G+CV  +C C  GY G+ C    C   C+  G+C     C C  G+ G  C    C   C   G+C     C C  GY G  C  R C   C+  G C+ G +C C  G  G  C    C   C   G C    +C C   ++G  C    C   C   G+CV   C C  GF G +C SR C
Sbjct:  298 NPGYTGEDCGVRSCPRGCSQRGR-CKDGRCVCDPGYTGE--------DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-CICDTGYSGDDCGVRSCPGDCNQRGRC-EDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENG-VCVCNAGYSGEDCGVRSCPGDCRGRGRC-ESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC 528          

HSP 4 Score: 124.405 bits (311), Expect = 9.658e-28
Identity = 66/196 (33.67%), Postives = 82/196 (41.84%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C   SC   CQ  G+CV+  C C  G+ G  C    C   C   G+C G   C C  G+ G  C    C   C   G+C     C C  GY G+ C  R C   C + G C+ G  C C  G  G  C    C   C  GG C+   +C C   ++G  C    C R C   G+C    C C TG+ G +C  R C
Sbjct:  213 CGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGR-CVCDPGYTGDDCGMRSCPRGCSQRGRC-ENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDGR-CVCDPGYTGEDCGTRSCPWDCGEGGRCV-DGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSC 404          

HSP 5 Score: 119.398 bits (298), Expect = 3.660e-26
Identity = 75/242 (30.99%), Postives = 92/242 (38.02%), Query Frame = 3
Query: 1179 PRSSWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            P   W +C   C    Q R R C    C+         R+ F    C   SC   C   G+C   +C C  GY G  C    C   C   G+C     C C+ G+ G  C    C   C   G+C +   C C  GY G+ C  R C   C +GG C  G  C C  G  G  C    C   C   G C    +C C   +SG  C    C   C   G+C    C C  G+ G +C SR C
Sbjct:  211 PSCGWPSCPGDC----QGRGR-CVQGVCV--------CRAGFSGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGR-CVCNPGYTGEDCGVRSCPRGCSQRGRC-KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGR-CVCWPGYTGEDCSTRTCPRDCRGRGRC-EDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC 435          

HSP 6 Score: 108.997 bits (271), Expect = 6.618e-23
Identity = 61/206 (29.61%), Postives = 84/206 (40.78%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC--ENHICTRCYNGGK----CVGNMCQCPTGFFGPECKSRIC 1901
            F  + C +  C   C+ +G C    C C  GY G+ C    C   C+  G+C+    C C +G+ G  C   +C   C   G C +  +C C  GY+ + C  R C   C   G C++G  C C  G  G  C    C   C   G C+ +  C C   + G  C  E    + C  G      C    C C  GF GP+C  + C
Sbjct:  518 FTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGR-CVCEDGYSGEDCGVRQCPNDCSQHGVC-QDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGR-CLCDPGYTGPTCATRMCPADCRGRGRCV-QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC 719          

HSP 7 Score: 104.375 bits (259), Expect = 1.687e-21
Identity = 66/230 (28.70%), Postives = 88/230 (38.26%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGG----TCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRI-CITGLK 1916
            C+D  C+       E         C   SC   C+  GQC+  +C C  GY G+ C    C   C   G C    +C C EG+    C    C   C   G+C     C C  GY G  C  R+C   C+  G C +G +C C  G  G  C + E       GG          +C C + F G  C    C   C   G+C    C C  G+ G +C   +  I G++
Sbjct:  538 CEDGVCVCDAGYSGE--------DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC-QDGVCICWEGYVSEDCSIRTCPSNCHGRGRC-EEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQG-VCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMR 756          

HSP 8 Score: 78.5666 bits (192), Expect = 1.496e-13
Identity = 44/131 (33.59%), Postives = 56/131 (42.75%), Query Frame = 3
Query: 1533 CENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFR 1922
            C + G+C+R   C C  GY G  C    C   CQ  G C +G +C C  G  G  C +  C   C   G C G  +C C   ++G  C    C R C   G+C    C C  G+ G +C  R C  G   R
Sbjct:  191 CNDQGRCVRGR-CVCFPGYTGPSCGWPSCPGDCQGRGRCVQG-VCVCRAGFSGPDCSQRSCPRGCSQRGRCEG-GRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQR 318          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. TrEMBL
Match: A0A2C9LKC8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106074349 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.888e-74
Identity = 195/700 (27.86%), Postives = 299/700 (42.71%), Query Frame = 3
Query:   48 NFSLCCIELLNAQWSQMSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKPDEENGWITRKSI-----RIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCD-YSWTYQYKFCNWQSCDNTILSHVGLLEKEIIDIKKTQIAIMRTILISILF--KNQTQINSKIKDFFSLELIDENSLIVSISITH----DAIINIKSGDGNNSSKFSLEK---LQALKN-------------EDLSFNVFINDSGIFVETFCIFR--------------MFTI--YNEKIRKFFSGSVQKLHLKVSKNVIIRVSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSPRSSWSTCSVTCGIGWQKRYRPCQ-----DDECLEKENIKSEIRSCFIQK----------------------------RCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFC--EKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICI 1904
            + +L C+ LL   W+ +S+ ER  R EI  +  V++  +        Y+AE  +  V KG     +        +TR         I  FG+   C ++    E Y+ F +      L A Y   FGA  + +    E  ++ LG +HW  WS C+  C  G Q+R+R C    S D      + + CN  SC+   +SH  L    ++ +++  I + ++   S  +    Q +++  I   +        SL+  + + H         I    G       L K    Q L N               ++ +V      ++ +   + R              M +I  Y  +    F G V++L L  S + + +     +   +N V  N FY+  +     +     + P+   S  S+WS CS TCG G Q R   CQ      D C+    + ++ R C+                                C N  C+  C + G C    KC C   Y G FCQ P+CN  C+NGG C+ P++C C   + G  C  +K+ C   C NGG+C+ PN+C+C  G+ GK C+K +C P CQ GG+C    +C CP+G  G+RC+K +C   CMNGGTC+  N+C CP  F G  C+  +C   C+NGG+C  N C CP GF G  C+ R CI
Sbjct:   20 HIALSCVLLLQG-WTPLSVRERAARGEIAALGTVLRTFKDQRTEDGTYTAEFRLDTVYKGHDLLSK--------VTRSVAPGNVYNISNFGNKTQCFADVEAGERYILF-LTVYSGQLSAQYEDLFGAASDFDESDEEEVINYLGWNHWTPWSPCNAGCSGGQQIRRRTCSRANSSDCIGVEAEVRTCNLFSCE---VSHDLL---TLMRVRELPIGVTKSSNQSETYTISKQAKLSLPISQIYQKTFPPTFSLLTKVKVGHRRTRSYFFVISDVQGKQQVALFLGKNIKFQYLGNNYVFKMDIAENVWHSIALSVDATTVTLYADCHNVIRKRLRSREEFLGTNLMMSIGPYFSQYGGQFEGEVEQLVLS-SDSEVAKSQCGLILLDQNAV--NNFYEMKTPFQYTT-----AKPIVYGSQWSAWSACSATCGQGMQTRALFCQANIVSGDSCVPVSPLPTQTRICYFGSCQVCSPACENGGTCIHGICSCAHNYTGTYCQNRLCDAPCLHEGICTANGKCSCTISYTGTFCQYPVCNPPCQNGGSCVQPDVCSCPTEWTGPTCAEKKITCPKGCYNGGKCVAPNVCSCPVGFYGKRCQKVLCEPRCQNGGVCVSPELCICPQGYHGSRCQKVKCNVHCMNGGTCLPPNQCRCPPLFYGKLCQREVCRLICFNGGRCNNNRCTCPPGFEGKHCERRSCI 695          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. TrEMBL
Match: A0A2B4SXK5 (von Willebrand factor D and EGF domain-containing protein OS=Stylophora pistillata OX=50429 GN=VWDE PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 4.389e-68
Identity = 187/678 (27.58%), Postives = 301/678 (44.40%), Query Frame = 3
Query:   51 FSLCCIELLNAQWSQMSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKPDEENGWITRKSIRIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSN-LWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCDYSWTYQYKFCNWQSCDNTILSHVGLLEKEIIDIK-----KTQIAIMRTILISILFKNQTQINSKIKDFFSLELIDENSLIVSISITHDAIINIKSGDGNNSSKFSLEK--LQALKNEDLSFNVFINDS-----GIFVE--------------TFCIFRMFTIYNEKIRKFFSG------SVQKLHLKVSKNVIIRVSTDSLETFKNTVCSNVFYDH---SSNVLNASKI---QQLSIPLSTVSPR-------SSWSTCSVTCGIGWQKRY--------------RPCQDDECLEKENIKSEIRSCFIQKRCPNE-------------------------------SCNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI 1808
            FS  CI+LL+  W Q+S  ER +  ++V + +V+     S      ++A+ E+  +LKG +  +   + ++  +    ++++GFG  ++C S     E+++ F ++  +S  L A Y   FGA       + E  L  LG   W +WS C+K C+ G Q R R CV    CD S + + + CN   C         + E +I  +      K +  ++++I +S +F+            F   ++   ++ +     +   +++      +   F  EK  L   +   L F V +        GI ++              +  +   FT+  + + K   G      S+++  +++S+   +     S +     +   VF+ H    S  ++AS+I   +    P     P        S WS CS TCG G + R               +P   DEC +      E + C++Q  CP +                                C I C+N G CV  +KC CP+GY G  C+  +CN  C+ GG+C+ PN+C C  GF G +C +L C   C NGG C+ PN C CA G+ G+ C + ICNPPC   G+C K N CSCP G  G RCEK +CYP C NGGTC  +N C CPQ + G++CE+ +
Sbjct:   22 FSKPCIQLLDG-WKQLSPGERAKLVKVVFIGKVVNLY--SYDATSTHAADFEVWKILKGSKFVEEVLETQSSPL----VKVYGFGEKMNCFSPVNPGEVHMVFMVYANESRALIARYDDIFGATAPATAKNEEEVLLALGWKTWSSWSRCNKNCDGGEQFRTRVCV-NKECDGS-SRESRKCNEFECYGLKDIARHIREDQIPPLSRHDNIKVENGVIKSIPVSKVFRYYNYFPDDFSMLFRFRVVALTNIYLVAMYDYRKSLSLGVRITPDLVSFGFEKSSLFQFRGWSLDFPVRVKTDYWHTLGISIQERNVTAYWDCARIGSKTLREKFTLAMDAMDKISIGEPVLVSSIERYEIEISELYFVPDPGASRQQCDPPIFKPVFHTHEIEGSGGVSASEIYGKEGSGTPNYVDDPENEVEISWSEWSPCSKTCGKGKRMRVMMCDMENRFFDDKGQPTLKDECFKAIQTFEE-KECYLQD-CPAQCDRSCLNGGFCSGRNICRCQPGYHGDVCEKVECKIHCRNGGTCVGPYKCKCPSGYGGTQCEKVLCNPPCQYGGRCVKPNVCDCLPGFVGPYC-RLSCSPHCYNGGVCVGPNKCRCAKGFTGESCLQAICNPPCMNFGVCYKPNTCSCPYGWHGKRCEKAQCYPHCRNGGTCWRRNTCRCPQGYYGNYCEHSL 687          

HSP 2 Score: 107.457 bits (267), Expect = 2.378e-20
Identity = 65/161 (40.37%), Postives = 76/161 (47.20%), Query Frame = 3
Query: 1518 KCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCVG-NMCQCPTGFFGPECKSRICITG-LKFRKIIKPVIVQFPVIVSNKMCIESTC 1994
            +CD +C NGG C   N+C C  GY G  CEK  C   C+ GG C     C CP G  G +CEK  C P C  GG C+  N C C   F G +C       CYNGG CVG N C+C  GF G  C   IC    + F    KP     P     K C ++ C
Sbjct:  496 QCDRSCLNGGFCSGRNICRCQPGYHGDVCEKVECKIHCRNGGTCVGPYKCKCPSGYGGTQCEKVLCNPPCQYGGRCVKPNVCDCLPGFVGPYCRLSCSPHCYNGGVCVGPNKCRCAKGFTGESCLQAICNPPCMNFGVCYKPNTCSCPYGWHGKRCEKAQC 656          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. TrEMBL
Match: A0A2C9LK57 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106074349 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.871e-67
Identity = 184/660 (27.88%), Postives = 281/660 (42.58%), Query Frame = 3
Query:   48 NFSLCCIELLNAQWSQMSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKPDEENGWITRKSI-----RIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCD-YSWTYQYKFCNWQSCDNTILSHVGLLEKEIIDIKKTQIAIMRTILISILF--KNQTQINSKIKDFFSLELIDENSLIVSISITH----DAIINIKSGDGNNSSKFSLEK---LQALKN-------------EDLSFNVFINDSGIFVETFCIFRMFTIYNEK---------IRKFFSGSVQKLHLKVSKNVIIRVSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSPRSSWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFC--EKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICI 1904
            + +L C+ LL   W+ +S+ ER  R EI  +  V++  +        Y+AE  +  V KG     +        +TR         I  FG+   C ++    E Y+ F +      L A Y   FGA  + +    E  ++ LG +HW  WS C+  C  G Q+R+R C    S D      + + CN  SC+   +SH  L    ++ +++  I + ++   S  +    Q +++  I   +        SL+  + + H         I    G       L K    Q L N               ++ +V      ++ +   + R      E+         I  +FS    +   +V + V+   S+DS      + C  +  D   N +N     +     +T  P      CS  C  G       C    C    N        +    C N  C+  C + G C    KC C   Y G FCQ P+CN  C+NGG C+ P++C C   + G  C  +K+ C   C NGG+C+ PN+C+C  G+ GK C+K +C P CQ GG+C    +C CP+G  G+RC+K +C   CMNGGTC+  N+C CP  F G  C+  +C   C+NGG+C  N C CP GF G  C+ R CI
Sbjct:   20 HIALSCVLLLQG-WTPLSVRERAARGEIAALGTVLRTFKDQRTEDGTYTAEFRLDTVYKGHDLLSK--------VTRSVAPGNVYNISNFGNKTQCFADVEAGERYILF-LTVYSGQLSAQYEDLFGAASDFDESDEEEVINYLGWNHWTPWSPCNAGCSGGQQIRRRTCSRANSSDCIGVEAEVRTCNLFSCE---VSHDLL---TLMRVRELPIGVTKSSNQSETYTISKQAKLSLPISQIYQKTFPPTFSLLTKVKVGHRRTRSYFFVISDVQGKQQVALFLGKNIKFQYLGNNYVFKMDIAENVWHSIALSVDATTVTLYADCHNVIRKRLRSREEFLGTNLMMSIGPYFSQYGGQFEGEVEQLVL---SSDS--EVAKSQCGLILLDQ--NAVNNFYEMKTPFQYTTAKP----IVCSPACENGGT-----CIHGICSCAHN--------YTGTYCQNRLCDAPCLHEGICTANGKCSCTISYTGTFCQYPVCNPPCQNGGSCVQPDVCSCPTEWTGPTCAEKKITCPKGCYNGGKCVAPNVCSCPVGFYGKRCQKVLCEPRCQNGGVCVSPELCICPQGYHGSRCQKVKCNVHCMNGGTCLPPNQCRCPPLFYGKLCQREVCRLICFNGGRCNNNRCTCPPGFEGKHCERRSCI 639          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. TrEMBL
Match: A0A210PVU8 (von Willebrand factor D and EGF domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04488 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.411e-60
Identity = 200/752 (26.60%), Postives = 314/752 (41.76%), Query Frame = 3
Query:   63 CIELLNAQWSQMSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKPDEENGWITRKSIRIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLIT-SCDYSWTYQYKFCNWQSCDNTILSHVGLLEKEIIDIKKTQIAIMRTIL----------------ISILFKNQTQINSKIKDFFSLELIDENSLIVSISITHDAIINIKSGDGNNSSKFSLEKLQALKN------------EDLSFNVFINDSGIFVETFCIFR---------------MFTI--YNEKIRKFFSGSVQKL-------------HLKVSKNVIIRVSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSPRSSWSTCSVTCGIGWQKRYRPCQDD-----ECLEKENIKSEIRSCFIQK------------------------------RCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGP-------------------------------NICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFRKIIKP 1937
            CI LLN  W+ +S+ ER   A+ V    V++  +        YSAE +I+ + KG +  +      NG +      I  FG    C ++  E+E Y+FF +      L A Y   FGA  +   ++ +  +  LG   W +WS C+  C+ G+Q+R+R C     +CD +   Q + CN  SC  T          EI +I+   + I R ++                +S LF+    I+  I     L +  E  L     I     ++IK GD      +    L   K+               +F+V  +   ++++   +                 M +I  Y  +  + F G +++L              L+  + +    S D  +        +V     +   +  ++++L+   +  +  SSWS+CS TCG G Q R   C ++     EC+  +   S+ R C+I++                              RC +  C   CQN G C    +C CP GY G+ C+  +C+ KC+NGG C+ P                               N C+C +G+ G  C K  C   C NGG+C+ PN C+C  GY G+ C+K +C PPCQ  G+C    +C C  G  G+ C+++ C   C NGG CIG NKC C   +SG +C+   C + C NGGKC  N C+CP G+ G  C+ RI   G K+ K + P
Sbjct:   30 CILLLNG-WTPLSVYERTGLADAVASGFVMRTFKDVRTDAHTYSAEVKILQIYKGVEKIREV--AANGSLG-NIYNISNFGDKKMCYADIDENESYIFF-LTVYRGRLSAQYDDIFGAAVDFTEENEDEVIQQLGWDFWSSWSSCTASCDVGVQVRRRACQKKEGTCDGNEVDQ-RQCNTFSCKGT------RNVMEIFNIQSLPVGITRDVIRPSSFNITQRANLYSPLSSLFRTGFPIDFSIIVTARLPVDSEGYLFTLSDIMGKQRLSIKYGDVTKLEYYDQNDLPGFKSPSFDVSLTNGEWHQFAFSVKGHSIKMYIDCIHVLSKTLSRSEHPSVGVNLMASIGPYFARYGRPFEGQLEQLTISSDPTAAAHQCFLQTGEVIQEPASKDDGDVRPKPTPPSVL---KTTTTDKDELKELATAQTMPTEWSSWSSCSTTCGSGMQTRSLYCLNNEISVVECVSGQPETSQSRVCYIRECQELCQESCLNGGSCGQDRQCHCPSGYYGHRCQSARCPRPCQNGGNCSTSGRCSCPQGYFGRTCEKAVCSPKCRNGGSCVSPGVCSCPFGYVQPVCKPFCTKVCHNGGRCVRHNTCKCRKGYTGKDCSKPICRKGCYNGGKCVAPNKCSCPRGYKGRRCQKAVCTPPCQNSGVCIYPYVCRCRPGYYGSYCQEFTCRRSCKNGGKCIGHNKCECLPGYSGKWCQRGKCAQPCQNGGKCRRNKCRCPKGYGGLTCE-RI---GCKYEKYVVP 762          

HSP 2 Score: 108.227 bits (269), Expect = 1.660e-20
Identity = 62/166 (37.35%), Postives = 82/166 (49.40%), Query Frame = 3
Query: 1506 CEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCV-GNMCQCPTGFFGPECKSRICITG-LKFRKIIKPVIVQFPVIVSNKMCIESTCT 1997
            C++L C  +C NGG C +   C C  GY G  C+   C  PCQ GG C     CSCP+G  G  CEK  C P+C NGG+C+    C CP  +    C+      C+NGG+CV  N C+C  G+ G +C   IC  G     K + P     P     + C ++ CT
Sbjct:  496 CQEL-CQESCLNGGSCGQDRQCHCPSGYYGHRCQSARCPRPCQNGGNCSTSGRCSCPQGYFGRTCEKAVCSPKCRNGGSCVSPGVCSCPFGYVQPVCKPFCTKVCHNGGRCVRHNTCKCRKGYTGKDCSKPICRKGCYNGGKCVAPNKCSCPRGYKGRRCQKAVCT 660          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. TrEMBL
Match: K1P6L3 (von Willebrand factor D and EGF domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10009105 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 2.906e-59
Identity = 193/674 (28.64%), Postives = 289/674 (42.88%), Query Frame = 3
Query:   96 MSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKPDEENGWITRKSIRIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCDYSWTYQYKFCNWQSCDNT--ILSHVGLLE---KEIIDIKKTQIAIMRT-----ILISILFKNQTQINSKIKDFFSLELIDENSLIVSISITHDAIINIKSGDGNNSSKFSLEKLQALKN-------------------EDLSFNVFINDSGIFVETFC----------IFRMFTIYNEKIRKFFSGSVQKLHLKVSKNVIIRVSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQ--LSIPLSTVSPR----------------------SSWSTCSVTCGIGWQKRYRPCQD---DECLEKENIKSEIRSCFIQKRCPNES----CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            MS+  R   A++V+   V +  +        YSA+ E++ V KG +            + + +  I  FG    C ++  E+E+Y+ F +      L A Y   FGA   L     E  L+ LG + W  W  CS  C  G Q+R+R C    +   S   + + CN  SC  T  +L  +GL +       ++ +T   I+ +     I +S L++ +   +  I     L    +  L+    I     + IK G+G     +    L   K+                   ED    +F++   +  + F           +      Y  +    F GS+Q+L +    +   +  +  L+   N           S V  A +  Q   S P  T S                        S WSTCS +CG+G+Q R R C +   D CLEKEN   + R C   K C + +    C+  C+N G+C++   C CP GY+   C+   CN KC+NGG+C   N C+C +G++G  C    C   C NGG+C+ PN C+C   Y G+ C+K IC P C+ GG C   N+C C  G  G  CE+Y+C  +C NGG C+G NKC C   +SG +C+   C   C NGGKC  N C+C  G+ G  C  R C
Sbjct:    1 MSVYNRTLLADVVVSGFVHETYKDFRSQDLTYSAKIELVTVYKGQELVDNLTS-----VAKNTFVISNFGDKKMCYADIQENEMYILF-LTVYKRRLSAKYDDIFGAATELTKPREEEILTHLGWNFWSPWESCSATCGGGTQVRRRGCSTPATSCSSEASENRACNGFSCKGTTDVLQALGLPKFPHGVSTNLNRTSAYIVNSEANLYIPLSDLYRGKFPKDFSILITAKLNTSSDGYLLTFSDIMGQQKMAIKYGEGLTLEYYDQNGLPGPKSPGFRESLSDSTWHQFAFSVEDQLVTLFVDCEKVKSQFFGRAKDPYVGVNLMLALGPYFARYGSPFEGSIQQLVVAQDPSAAEQQCSTKLQNGGNRSVREQAVKDDSQVSTAQRQTQSEQSQPDKTDSKPAVKNATTSTLNTQANQYVYVDWSEWSTCSASCGMGFQSRTRYCGNNDLDNCLEKENQLIQTRPCG-GKTCSDNAVKAICSPRCKNGGKCIRPGVCSCPPGYRKPTCKGG-CNIKCQNGGECWRKNKCKCKKGYKGKDCSIPVCRRKCSNGGKCVAPNKCSCRRDYKGRRCQKAICKPKCKNGGSCIFPNVCKCNAGFYGPHCEQYKCRRRCKNGGFCVGPNKCRCQPGYSGKWCQIGRCNHPCLNGGKCRNNKCRCTAGWKGERCTVRGC 666          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-30e9.7 (si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-540])

HSP 1 Score: 177.178 bits (448), Expect = 1.079e-45
Identity = 84/198 (42.42%), Postives = 118/198 (59.60%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            C   +C+  CQN G C+    C CP GY G  C+  +CN  C+NGG+C+ P++C+C  G+ G  C    C   C NGG C++PN+C C  G+ G  C+  +C+PPC+  G C + N+CSCPEG  G +C+   C P C+N G C+G N C C   + G  C   +C  +C NGG+CVG N C CP G+ G +C++ IC
Sbjct: 1478 CEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIPVCLQKCKNGGECVGPNTCHCPAGWDGLQCQNPIC 1675          

HSP 2 Score: 164.081 bits (414), Expect = 1.895e-41
Identity = 84/193 (43.52%), Postives = 111/193 (57.51%), Query Frame = 3
Query: 1332 CNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCV-GNMCQCPTGFFGPECKSRIC 1901
            C   C  N +C +   C C  GY G  C   +C   CKN GKC+ PN+C+C  G+ G  CE+  CD  C+NGG CL  NLCTC +GY+G  CE  +CN  C+ GG C   ++C C  G  G  C   +C P C+NGGTCI  N C CP  F GS C+  +C+  C N G+C+  N+C CP G+ G +C+  +C
Sbjct: 1419 CRYLCGQNMECTLPNTCTCKEGYTGYNCHIAVCRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVC 1611          

HSP 3 Score: 158.303 bits (399), Expect = 1.342e-39
Identity = 82/194 (42.27%), Postives = 111/194 (57.22%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            C   C+N G+CVK   C CP GY G  C+   C+  C+NGG C+  N+C C  G+ G  CE + C+  CENGG+C+ P++C C  G+ G  C    C P C  GG C K NIC+CP G  G++C+   C P C N G C+  N C CP+ ++G  C+  +C   C N GKCVG N C C +G+ G  C   +C+
Sbjct: 1451 CRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIPVCL 1644          

HSP 4 Score: 140.198 bits (352), Expect = 8.933e-34
Identity = 80/208 (38.46%), Postives = 109/208 (52.40%), Query Frame = 3
Query: 1383 CPTGYQGKFCQ-NPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCV-GNMCQCPTGFFGPECKSRICITGLKFR-KIIKPVIVQFPVIVSNKMCIESTC 1994
            CP GY+G       +C   C    +C  PN C C EG+ G  C    C   C+N G+C++PN+C C  GY G  CE+  C+PPCQ GG C   N+C+CP G VG +CE   C   C NGG C+  + C C   + G  C +  C   C NGG C+  N+C CPTGF+G +C+  +C    K R + ++  +   P   + K C  S C
Sbjct: 1404 CPNGYRGDGITCKAVCRYLCGQNMECTLPNTCTCKEGYTGYNCHIAVCRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVC 1611          

HSP 5 Score: 128.257 bits (321), Expect = 5.726e-30
Identity = 67/165 (40.61%), Postives = 90/165 (54.55%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI 1808
            C +  C   C N G C+K   C CPTG+ G  CQ  +C+  CKN G+C+  N+C C EG+ G  C+   CD  C N G+C+ PN C+CA G+ G  C   +C   C+ GG C   N C CP G  G +C+   C  +C+NGG C+  + CHC   +SG  C   I
Sbjct: 1542 CNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIPVCLQKCKNGGECVGPNTCHCPAGWDGLQCQNPICRNKCLNGGRCVLPDYCHCRPGYSGPTCATRI 1706          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-30e9.7 (si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-540])

HSP 1 Score: 177.178 bits (448), Expect = 1.107e-45
Identity = 84/198 (42.42%), Postives = 118/198 (59.60%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            C   +C+  CQN G C+    C CP GY G  C+  +CN  C+NGG+C+ P++C+C  G+ G  C    C   C NGG C++PN+C C  G+ G  C+  +C+PPC+  G C + N+CSCPEG  G +C+   C P C+N G C+G N C C   + G  C   +C  +C NGG+CVG N C CP G+ G +C++ IC
Sbjct: 1478 CEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIPVCLQKCKNGGECVGPNTCHCPAGWDGLQCQNPIC 1675          

HSP 2 Score: 164.081 bits (414), Expect = 1.824e-41
Identity = 84/193 (43.52%), Postives = 111/193 (57.51%), Query Frame = 3
Query: 1332 CNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCV-GNMCQCPTGFFGPECKSRIC 1901
            C   C  N +C +   C C  GY G  C   +C   CKN GKC+ PN+C+C  G+ G  CE+  CD  C+NGG CL  NLCTC +GY+G  CE  +CN  C+ GG C   ++C C  G  G  C   +C P C+NGGTCI  N C CP  F GS C+  +C+  C N G+C+  N+C CP G+ G +C+  +C
Sbjct: 1419 CRYLCGQNMECTLPNTCTCKEGYTGYNCHIAVCRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVC 1611          

HSP 3 Score: 158.303 bits (399), Expect = 1.315e-39
Identity = 82/194 (42.27%), Postives = 111/194 (57.22%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            C   C+N G+CVK   C CP GY G  C+   C+  C+NGG C+  N+C C  G+ G  CE + C+  CENGG+C+ P++C C  G+ G  C    C P C  GG C K NIC+CP G  G++C+   C P C N G C+  N C CP+ ++G  C+  +C   C N GKCVG N C C +G+ G  C   +C+
Sbjct: 1451 CRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIPVCL 1644          

HSP 4 Score: 140.198 bits (352), Expect = 9.311e-34
Identity = 75/183 (40.98%), Postives = 99/183 (54.10%), Query Frame = 3
Query: 1383 CPTGYQGKFCQ-NPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCV-GNMCQCPTGFFGPECKSRICITGLKFR 1922
            CP GY+G       +C   C    +C  PN C C EG+ G  C    C   C+N G+C++PN+C C  GY G  CE+  C+PPCQ GG C   N+C+CP G VG +CE   C   C NGG C+  + C C   + G  C +  C   C NGG C+  N+C CPTGF+G +C+  +C    K R
Sbjct: 1404 CPNGYRGDGITCKAVCRYLCGQNMECTLPNTCTCKEGYTGYNCHIAVCRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNR 1586          

HSP 5 Score: 127.872 bits (320), Expect = 7.960e-30
Identity = 66/165 (40.00%), Postives = 90/165 (54.55%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI 1808
            C +  C   C N G C+K   C CPTG+ G  CQ  +C+  CKN G+C+  N+C C EG+ G  C+   CD  C N G+C+ PN C+CA G+ G  C   +C   C+ GG C   N C CP G  G +C+   C  +C+NGG C+  + CHC   +SG  C   +
Sbjct: 1542 CNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIPVCLQKCKNGGECVGPNTCHCPAGWDGLQCQNPICRNKCLNGGRCVLPDYCHCRPGYSGPTCATRV 1706          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-30e9.7 (si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-540])

HSP 1 Score: 164.851 bits (416), Expect = 1.222e-41
Identity = 84/193 (43.52%), Postives = 111/193 (57.51%), Query Frame = 3
Query: 1332 CNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCV-GNMCQCPTGFFGPECKSRIC 1901
            C   C  N +C +   C C  GY G  C   +C   CKN GKC+ PN+C+C  G+ G  CE+  CD  C+NGG CL  NLCTC +GY+G  CE  +CN  C+ GG C   ++C C  G  G  C   +C P C+NGGTCI  N C CP  F GS C+  +C+  C N G+C+  N+C CP G+ G +C+  +C
Sbjct: 1419 CRYLCGQNMECTLPNTCTCKEGYTGYNCHIAVCRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVC 1611          

HSP 2 Score: 155.992 bits (393), Expect = 8.875e-39
Identity = 81/188 (43.09%), Postives = 108/188 (57.45%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPEC 1886
            C   C+N G+CVK   C CP GY G  C+   C+  C+NGG C+  N+C C  G+ G  CE + C+  CENGG+C+ P++C C  G+ G  C    C P C  GG C K NIC+CP G  G++C+   C P C N G C+  N C CP+ ++G  C+  +C   C N GKCVG N C C +G+ G  C
Sbjct: 1451 CRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVC 1638          

HSP 3 Score: 151.754 bits (382), Expect = 1.876e-37
Identity = 68/164 (41.46%), Postives = 95/164 (57.93%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENH 1805
            C   +C+  CQN G C+    C CP GY G  C+  +CN  C+NGG+C+ P++C+C  G+ G  C    C   C NGG C++PN+C C  G+ G  C+  +C+PPC+  G C + N+CSCPEG  G +C+   C P C+N G C+G N C C   + G  C  H
Sbjct: 1478 CEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIH 1641          

HSP 4 Score: 140.584 bits (353), Expect = 7.314e-34
Identity = 75/183 (40.98%), Postives = 99/183 (54.10%), Query Frame = 3
Query: 1383 CPTGYQGKFCQ-NPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCV-GNMCQCPTGFFGPECKSRICITGLKFR 1922
            CP GY+G       +C   C    +C  PN C C EG+ G  C    C   C+N G+C++PN+C C  GY G  CE+  C+PPCQ GG C   N+C+CP G VG +CE   C   C NGG C+  + C C   + G  C +  C   C NGG C+  N+C CPTGF+G +C+  +C    K R
Sbjct: 1404 CPNGYRGDGITCKAVCRYLCGQNMECTLPNTCTCKEGYTGYNCHIAVCRPDCKNRGKCVKPNVCECPAGYSGPTCEEANCDPPCQNGGSCLSRNLCTCPYGYVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNR 1586          

HSP 5 Score: 103.99 bits (258), Expect = 2.430e-22
Identity = 56/138 (40.58%), Postives = 74/138 (53.62%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYE 1712
            ++  +C    CN  C+N G+CV    C C  G+ G  C +  C   C NGG CI PNIC C  GF G  C+   C   C+N GQC+R N+C+C  GY GK C+  +C+P C   G C   N CSC  G  G+ C  ++
Sbjct: 1505 YVGPQCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSADCKPVCLNGGTCIKPNICACPTGFYGSQCQIAVCSPPCKNRGQCMRNNVCSCPEGYTGKKCQYSVCDPMCLNKGKCVGPNTCSCASGWRGDVCSIHQ 1642          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Cavefish
Match: wif1 (WNT inhibitory factor 1 [Source:NCBI gene;Acc:103030211])

HSP 1 Score: 122.479 bits (306), Expect = 1.055e-29
Identity = 68/175 (38.86%), Postives = 86/175 (49.14%), Query Frame = 3
Query: 1311 KRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGG 1832
            K C    C   C+N G C + + C C  G+ G  C+  +C+ +C+NGG C+ P +C C  G+ G  CEK  C  TC NGG C  P  C C   + G  CE   C  PC+ GG C   N C C +G  G+ C K  C P C   GTCI  N+CHC   + G  C        Y GG
Sbjct:  174 KTCQRAKCPGGCRNGGYCNERQVCECQDGFYGTHCEKALCSPRCQNGGLCMSPGVCICPPGYFGAGCEKANCSTTCLNGGTCFHPGKCICPAAFEGSRCEISKCRQPCRNGGKCMGRNKCKCSKGYHGDLCSKAVCEPSCGAHGTCIEPNRCHCRDGWHGRHCNKR-----YRGG 343          

HSP 2 Score: 114.775 bits (286), Expect = 4.046e-27
Identity = 61/134 (45.52%), Postives = 76/134 (56.72%), Query Frame = 3
Query: 1506 CEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            C++ KC   C NGG C    +C C  G+ G  CEK +C+P CQ GG+C    +C CP G  G  CEK  C   C+NGGTC    KC CP +F GS CE   C + C NGGKC+G N C+C  G+ G  C   +C
Sbjct:  176 CQRAKCPGGCRNGGYCNERQVCECQDGFYGTHCEKALCSPRCQNGGLCMSPGVCICPPGYFGAGCEKANCSTTCLNGGTCFHPGKCICPAAFEGSRCEISKCRQPCRNGGKCMGRNKCKCSKGYHGDLCSKAVC 309          

HSP 3 Score: 99.7525 bits (247), Expect = 4.131e-22
Identity = 57/141 (40.43%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 1287 EIRSCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK 1706
            E +  F    C    C+  CQN G C+    C CP GY G  C+   C+  C NGG C  P  C C   FEG  CE  KC   C NGG+C+  N C C+ GY G  C K +C P C   G C + N C C +G  G  C K
Sbjct:  198 ECQDGFYGTHCEKALCSPRCQNGGLCMSPGVCICPPGYFGAGCEKANCSTTCLNGGTCFHPGKCICPAAFEGSRCEISKCRQPCRNGGKCMGRNKCKCSKGYHGDLCSKAVCEPSCGAHGTCIEPNRCHCRDGWHGRHCNK 338          

HSP 4 Score: 52.373 bits (124), Expect = 9.832e-7
Identity = 29/72 (40.28%), Postives = 40/72 (55.56%), Query Frame = 3
Query: 1698 CEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVG-NMCQCPTGFFGPECKSRICIT 1907
            C++ +C   C NGG C  +  C C   F G+ CE  +C+ RC NGG C+   +C CP G+FG  C+   C T
Sbjct:  176 CQRAKCPGGCRNGGYCNERQVCECQDGFYGTHCEKALCSPRCQNGGLCMSPGVCICPPGYFGAGCEKANCST 247          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Cavefish
Match: vwde (von Willebrand factor D and EGF domain-containing protein-like [Source:NCBI gene;Acc:103030898])

HSP 1 Score: 117.472 bits (293), Expect = 1.468e-29
Identity = 67/163 (41.10%), Postives = 92/163 (56.44%), Query Frame = 3
Query: 1422 ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGN---ICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSR 1895
            +C+  C + G CI  N C CS+G+EG  C+   C   C+NGG+CLRP  C C  G+ GK+C K +C+  C  GG C   N    C CP    G+RC+   C   C NGG+C+    C CP+ + G  C   +C + C NGGKCV  + C+C + F GP+C+ R
Sbjct:   48 VCDPPCNHAGLCIRNNTCYCSQGYEGETCQYANCYPKCKNGGECLRPGKCRCPPGFGGKYCHKVMCDGGCWNGGDCTAVNGVAKCICPSSWTGSRCQDAICPQGCRNGGSCVAPGICSCPEGWLGGACHTAVCKKPCRNGGKCVSPDTCRCRSPFSGPQCEER 210          

HSP 2 Score: 115.931 bits (289), Expect = 5.207e-29
Identity = 67/162 (41.36%), Postives = 85/162 (52.47%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPN---LCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENH 1805
            C+  C + G C++   C+C  GY+G+ CQ   C  KCKNGG+C+ P  C+C  GF G +C K+ CD  C NGG C   N    C C   + G  C+  IC   C+ GG C    ICSCPEG +G  C    C   C NGG C+  + C C   FSG  CE  
Sbjct:   49 CDPPCNHAGLCIRNNTCYCSQGYEGETCQYANCYPKCKNGGECLRPGKCRCPPGFGGKYCHKVMCDGGCWNGGDCTAVNGVAKCICPSSWTGSRCQDAICPQGCRNGGSCVAPGICSCPEGWLGGACHTAVCKKPCRNGGKCVSPDTCRCRSPFSGPQCEER 210          

HSP 3 Score: 93.2041 bits (230), Expect = 3.880e-21
Identity = 58/139 (41.73%), Postives = 75/139 (53.96%), Query Frame = 3
Query: 1500 LFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKN---KCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            +F  K  CD  C + G C+R N C C+ GY G+ C+   C P C+ GG C +   C CP G  G  C K  C   C NGG C   N   KC CP S++GS C++ IC + C NGG CV   +C CP G+ G  C + +C
Sbjct:   42 VFDVKAVCDPPCNHAGLCIRNNTCYCSQGYEGETCQYANCYPKCKNGGECLRPGKCRCPPGFGGKYCHKVMCDGGCWNGGDCTAVNGVAKCICPSSWTGSRCQDAICPQGCRNGGSCVAPGICSCPEGWLGGACHTAVC 180          

HSP 4 Score: 84.3445 bits (207), Expect = 4.764e-18
Identity = 48/139 (34.53%), Postives = 71/139 (51.08%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVK-WKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPN---ICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK 1706
            +  + C   +C   C+N G+C++  KC CP G+ GK+C   +C+  C NGG C   N    C C   + G  C+   C   C NGG C+ P +C+C  G++G  C   +C  PC+ GG C   + C C     G +CE+
Sbjct:   71 YEGETCQYANCYPKCKNGGECLRPGKCRCPPGFGGKYCHKVMCDGGCWNGGDCTAVNGVAKCICPSSWTGSRCQDAICPQGCRNGGSCVAPGICSCPEGWLGGACHTAVCKKPCRNGGKCVSPDTCRCRSPFSGPQCEE 209          

HSP 5 Score: 82.4185 bits (202), Expect = 2.193e-17
Identity = 47/135 (34.81%), Postives = 64/135 (47.41%), Query Frame = 3
Query: 1608 KRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVG----NMCQCPTGFFGPECKSRICITGLK-FRKIIKPVIVQFPVIVSNKMCIESTC 1994
            K +C+PPC   G+C + N C C +G  G  C+   CYP+C NGG C+   KC CP  F G +C   +C   C+NGG C        C CP+ + G  C+  IC  G +     + P I   P       C  + C
Sbjct:   46 KAVCDPPCNHAGLCIRNNTCYCSQGYEGETCQYANCYPKCKNGGECLRPGKCRCPPGFGGKYCHKVMCDGGCWNGGDCTAVNGVAKCICPSSWTGSRCQDAICPQGCRNGGSCVAPGICSCPEGWLGGACHTAVC 180          

HSP 6 Score: 80.8777 bits (198), Expect = 6.141e-17
Identity = 43/108 (39.81%), Postives = 56/108 (51.85%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVK----WKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKR 1613
            F  K C    C+  C N G C       KC CP+ + G  CQ+ IC + C+NGG C+ P IC C EG+ G  C    C   C NGG+C+ P+ C C   + G  CE+R
Sbjct:  103 FGGKYCHKVMCDGGCWNGGDCTAVNGVAKCICPSSWTGSRCQDAICPQGCRNGGSCVAPGICSCPEGWLGGACHTAVCKKPCRNGGKCVSPDTCRCRSPFSGPQCEER 210          

HSP 7 Score: 57.3806 bits (137), Expect = 6.493e-9
Identity = 30/76 (39.47%), Postives = 41/76 (53.95%), Query Frame = 3
Query: 1296 SCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLK 1520
            S +   RC +  C   C+N G CV    C CP G+ G  C   +C + C+NGGKC+ P+ C+C   F G  CE+ K
Sbjct:  136 SSWTGSRCQDAICPQGCRNGGSCVAPGICSCPEGWLGGACHTAVCKKPCRNGGKCVSPDTCRCRSPFSGPQCEERK 211          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Sea Lamprey
Match: VWDE (von Willebrand factor D and EGF domains [Source:HGNC Symbol;Acc:HGNC:21897])

HSP 1 Score: 186.808 bits (473), Expect = 1.555e-49
Identity = 92/204 (45.10%), Postives = 119/204 (58.33%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICITGLKF 1919
            C    C  TCQN G C+    C CP GY G  C+  +CN  C+NGG+C+ P++C+CS G++G  C    C   C NGG C+RP +C C  G+ G  C   IC+PPC+ GG C + NICS  EG  G RC+K  C P CMN G C+G N C CP  F G  C   +C  +C NGG+C+G N C CP G+ G  C++ +C    KF
Sbjct: 1367 CEEVECTPTCQNAGACIARNLCSCPYGYLGPRCETMVCNRHCENGGECVSPDVCRCSPGWDGPTCGSAVCSPVCLNGGACVRPGVCLCPHGFFGAQCHNAICSPPCKNGGHCMRNNICSKGEGYTGRRCQKSVCEPTCMNSGKCVGPNVCSCPSGFKGKRCNRPVCLQKCKNGGECIGPNSCHCPEGWEGMHCQNPVCQQTCKF 1570          

HSP 2 Score: 127.487 bits (319), Expect = 1.765e-30
Identity = 70/168 (41.67%), Postives = 89/168 (52.98%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR 1817
            C +  C+  C N G CV+   C CP G+ G  C N IC+  CKNGG C+  NIC   EG+ G  C+K  C+ TC N G+C+ PN+C+C  G+ GK C + +C   C+ GG C   N C CPEG  G  C+   C   C  GG C   N C C   FSG  C   +  R
Sbjct: 1431 CGSAVCSPVCLNGGACVRPGVCLCPHGFFGAQCHNAICSPPCKNGGHCMRNNICSKGEGYTGRRCQKSVCEPTCMNSGKCVGPNVCSCPSGFKGKRCNRPVCLQKCKNGGECIGPNSCHCPEGWEGMHCQNPVCQQTCKFGGRCTAPNACSCRPGFSGFACGRRVRER 1598          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009276.1 (pep scaffold:Pmarinus_7.0:GL476916:212692:218299:-1 gene:ENSPMAG00000008391.1 transcript:ENSPMAT00000009276.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 1.907e-34
Identity = 72/163 (44.17%), Postives = 97/163 (59.51%), Query Frame = 3
Query: 1422 ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLK--CDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRI 1898
             C+  C NGG C+ P++C C +GF G +C+     C   C+NGG C+R N+C+C  GY+GK C++ +C+P C  GG C   NICSCP G  G +C K  C  +C NGG CI  N C CP  + G+ C+N  C T+C  G KCV  N+C C  GF G  C  ++
Sbjct:    3 ACHPVCLNGGTCVRPHVCACPQGFFGPYCQNATAICSPACKNGGHCMRNNVCSCPEGYMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQKCKNGGECIRPNTCLCPPGWEGAQCQNPTCHTKCQFGSKCVQPNLCACRPGFAGLVCHRKV 165          

HSP 2 Score: 119.398 bits (298), Expect = 1.693e-31
Identity = 68/165 (41.21%), Postives = 95/165 (57.58%), Query Frame = 3
Query: 1323 NESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNP--ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI 1808
            + +C+  C N G CV+   C CP G+ G +CQN   IC+  CKNGG C+  N+C C EG+ G  C++  CD TC NGG+C+ PN+C+C  G+ GK C K +C   C+ GG C + N C CP G  G +C+   C+ +C  G  C+  N C C   F+G  C   +
Sbjct:    1 SAACHPVCLNGGTCVRPHVCACPQGFFGPYCQNATAICSPACKNGGHCMRNNVCSCPEGYMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQKCKNGGECIRPNTCLCPPGWEGAQCQNPTCHTKCQFGSKCVQPNLCACRPGFAGLVCHRKV 165          

HSP 3 Score: 115.161 bits (287), Expect = 4.477e-30
Identity = 62/146 (42.47%), Postives = 90/146 (61.64%), Query Frame = 3
Query: 1521 CDITCENGGQCLRPNLCTCAFGYIGKFCEKR--ICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPECKSRICITGLKF-RKIIKPVI 1943
            C   C NGG C+RP++C C  G+ G +C+    IC+P C+ GG C + N+CSCPEG +G RC++  C P C+NGG C+G N C CP  + G  C   +C  +C NGG+C+  N C CP G+ G +C++  C T  +F  K ++P +
Sbjct:    4 CHPVCLNGGTCVRPHVCACPQGFFGPYCQNATAICSPACKNGGHCMRNNVCSCPEGYMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQKCKNGGECIRPNTCLCPPGWEGAQCQNPTCHTKCQFGSKCVQPNL 149          

HSP 4 Score: 95.1301 bits (235), Expect = 5.044e-23
Identity = 47/106 (44.34%), Postives = 67/106 (63.21%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRI 1616
            ++ KRC    C+ TC N G+CV    C CP+G++GK C  P+C +KCKNGG+CI PN C C  G+EG  C+   C   C+ G +C++PNLC C  G+ G  C +++
Sbjct:   60 YMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQKCKNGGECIRPNTCLCPPGWEGAQCQNPTCHTKCQFGSKCVQPNLCACRPGFAGLVCHRKV 165          

HSP 5 Score: 77.7962 bits (190), Expect = 6.255e-17
Identity = 49/132 (37.12%), Postives = 69/132 (52.27%), Query Frame = 3
Query: 1614 ICNPPCQKGGICQKGNICSCPEGTVGNRCEKYE--CYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICITGLK-FRKIIKPVIVQFPVIVSNKMCIESTC 1994
             C+P C  GG C + ++C+CP+G  G  C+     C P C NGG C+  N C CP+ + G  C+  +C   C NGGKCVG N+C CP+G+ G +C   +C+   K   + I+P     P       C   TC
Sbjct:    3 ACHPVCLNGGTCVRPHVCACPQGFFGPYCQNATAICSPACKNGGHCMRNNVCSCPEGYMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQKCKNGGECIRPNTCLCPPGWEGAQCQNPTC 134          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Sea Lamprey
Match: vwde (von Willebrand factor D and EGF domains [Source:ZFIN;Acc:ZDB-GENE-060929-1226])

HSP 1 Score: 114.775 bits (286), Expect = 2.361e-29
Identity = 67/166 (40.36%), Postives = 94/166 (56.63%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQC---LRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK---YECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI 1808
            C   C+N G CV+   CFC  GYQG+ CQ+  CN +CK+GG+C+  + C+C+ GFEG FC+K  C   C NGGQC   L  + C+C  G+ G  C + +C+  C+ GG+C   +ICSC  G  G  C+     EC   C+NGG C+  + C C   + G  C   +
Sbjct:   46 CEPPCRNYGLCVRNDTCFCLHGYQGERCQHATCNPQCKHGGECLRSDKCRCTVGFEGRFCQKASCSGGCMNGGQCVTVLGVSKCSCLSGWGGARCHQAMCSQGCRNGGVCVVPDICSCLPGWHGGACQHTSPAECQKPCLNGGKCVAPDVCRCRHYYRGPRCATRV 211          

HSP 2 Score: 93.5893 bits (231), Expect = 4.811e-22
Identity = 60/166 (36.14%), Postives = 89/166 (53.61%), Query Frame = 3
Query: 1425 CNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGIC---QKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI---CTR-CYNGGKCVG-NMCQCPTGFFGPECKSRI 1898
            C   C+N G C+  + C C  G++G  C+   C+  C++GG+CLR + C C  G+ G+FC+K  C+  C  GG C      + CSC  G  G RC +  C   C NGG C+  + C C   + G  C++     C + C NGGKCV  ++C+C   + GP C +R+
Sbjct:   46 CEPPCRNYGLCVRNDTCFCLHGYQGERCQHATCNPQCKHGGECLRSDKCRCTVGFEGRFCQKASCSGGCMNGGQCVTVLGVSKCSCLSGWGGARCHQAMCSQGCRNGGVCVVPDICSCLPGWHGGACQHTSPAECQKPCLNGGKCVAPDVCRCRHYYRGPRCATRV 211          

HSP 3 Score: 85.8853 bits (211), Expect = 2.759e-19
Identity = 50/141 (35.46%), Postives = 76/141 (53.90%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKW-KCFCPTGYQGKFCQNPICNEKCKNGGKCI---GPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRI---CNPPCQKGGICQKGNICSCPEGTVGNRCE 1703
            +  +RC + +CN  C++ G+C++  KC C  G++G+FCQ   C+  C NGG+C+   G + C C  G+ G  C +  C   C NGG C+ P++C+C  G+ G  C+      C  PC  GG C   ++C C     G RC 
Sbjct:   68 YQGERCQHATCNPQCKHGGECLRSDKCRCTVGFEGRFCQKASCSGGCMNGGQCVTVLGVSKCSCLSGWGGARCHQAMCSQGCRNGGVCVVPDICSCLPGWHGGACQHTSPAECQKPCLNGGKCVAPDVCRCRHYYRGPRCA 208          

HSP 4 Score: 81.6481 bits (200), Expect = 6.258e-18
Identity = 50/132 (37.88%), Postives = 72/132 (54.55%), Query Frame = 3
Query: 1509 EKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCI---GKNKCHCPQSFSGSFCENHICTR-CYNGGKC-VGNMCQCPTGFFGPECK 1889
             + +C+  C N G C+R + C C  GY G+ C+   CNP C+ GG C + + C C  G  G  C+K  C   CMNGG C+   G +KC C   + G+ C   +C++ C NGG C V ++C C  G+ G  C+
Sbjct:   42 SRARCEPPCRNYGLCVRNDTCFCLHGYQGERCQHATCNPQCKHGGECLRSDKCRCTVGFEGRFCQKASCSGGCMNGGQCVTVLGVSKCSCLSGWGGARCHQAMCSQGCRNGGVCVVPDICSCLPGWHGGACQ 173          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001302.1 (pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 gene:ENSPMAG00000001162.1 transcript:ENSPMAT00000001302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 1.144e-28
Identity = 67/203 (33.00%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNP---ICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKC-DITCENGGQCLRPNLCTCAFGYIGKFCEKR--ICNPPCQKGGI-CQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPEC 1886
            F+   C   SC + C  +GQ V+ +C C +G++G  C  P     N  C   G CI   +C C+ G+ G  CE++ C   TC   G C+    C C  G+ G  CE R  +C   C   G+   + N CSC     G  C    C   C   G CIG   CHC + + G  C+   C R C   G C    C+C  G+ G  C
Sbjct:  157 FLPPHCSRASCPVLCSGHGQYVRGRCLCHSGWKGAECDIPAWQCTNPACGGHGSCI-TGVCVCNSGYTGESCEEVMCPHPTCSGKGVCVH-GTCICLSGWGGPSCETRKPMCAEQCSGHGLYLSELNTCSCDARFTGADCSTELCPVDCGAHGVCIG-GSCHCQEGWGGETCDQKACHRHCAEHGACRDGKCECSQGWNGEHC 356          

HSP 2 Score: 105.145 bits (261), Expect = 2.014e-23
Identity = 62/198 (31.31%), Postives = 86/198 (43.43%), Query Frame = 3
Query: 1332 CNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCE--KLKC-DITCENGGQCLRPNLCTCAFGYIGKFCEKRIC-NPPCQKGGICQKGNICSCPEGTVGNRCE--KYECYPQCMNGGTCIGK-NKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C   C  NG C+   C C  G+    C    C   C   G+ +    C C  G++G  C+    +C +  C   G C+   +C C  GY G+ CE+ +C +P C   G+C  G  C C  G  G  CE  K  C  QC   G  + + N C C   F+G+ C   +C   C   G C+G  C C  G+ G  C  + C
Sbjct:  136 CPGGCHGNGVCLAGICHCNQGFLPPHCSRASCPVLCSGHGQYVRGR-CLCHSGWKGAECDIPAWQCTNPACGGHGSCI-TGVCVCNSGYTGESCEEVMCPHPTCSGKGVCVHGT-CICLSGWGGPSCETRKPMCAEQCSGHGLYLSELNTCSCDARFTGADCSTELCPVDCGAHGVCIGGSCHCQEGWGGETCDQKAC 330          

HSP 3 Score: 104.375 bits (259), Expect = 3.875e-23
Identity = 78/260 (30.00%), Postives = 104/260 (40.00%), Query Frame = 3
Query: 1179 PRSSWSTCSVTC-GIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESC-NITCQNNGQCVKWKCFCPTGYQGKFCQNPIC-NEKCKNGGKCIGPNICQCSEGFEGLFCEKLK--CDITCENGGQCLRP-NLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE-NHICTRCYNGG---KCVGN----------MCQCPTGFFGPECKSRI 1898
            P  S ++C V C G G   R R      CL     K     C I    P   C N  C  +G C+   C C +GY G+ C+  +C +  C   G C+    C C  G+ G  CE  K  C   C   G  L   N C+C   + G  C   +C   C   G+C  G+ C C EG  G  C++  C+  C   G C    KC C Q ++G  C    +   C   G    C GN          +C C  G+ GP C + +
Sbjct:  160 PHCSRASCPVLCSGHGQYVRGR------CLCHSGWKGA--ECDI----PAWQCTNPACGGHGSCITGVCVCNSGYTGESCEEVMCPHPTCSGKGVCVH-GTCICLSGWGGPSCETRKPMCAEQCSGHGLYLSELNTCSCDARFTGADCSTELCPVDCGAHGVCIGGS-CHCQEGWGGETCDQKACHRHCAEHGAC-RDGKCECSQGWNGEHCSVGKVTANCCQKGCPAMCSGNGECRLAQGSWLCVCVPGWRGPGCDTSM 404          

HSP 4 Score: 67.0106 bits (162), Expect = 1.312e-11
Identity = 44/175 (25.14%), Postives = 67/175 (38.29%), Query Frame = 3
Query: 1146 QQLSIPLSTVSPRSSWSTCSVTCGIGWQ----KRYRPCQDDECLEKENIKSEIRSC-----FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLK---------CDITCENGGQCLRPN---LCTCAFGYIGKFCE 1607
            +++  P  T S +      +  C  GW     +  +P   ++C       SE+ +C     F    C  E C + C  +G C+   C C  G+ G+ C    C+  C   G C     C+CS+G+ G  C   K         C   C   G+C       LC C  G+ G  C+
Sbjct:  228 EEVMCPHPTCSGKGVCVHGTCICLSGWGGPSCETRKPMCAEQCSGHGLYLSELNTCSCDARFTGADCSTELCPVDCGAHGVCIGGSCHCQEGWGGETCDQKACHRHCAEHGACRDGK-CECSQGWNGEHCSVGKVTANCCQKGCPAMCSGNGECRLAQGSWLCVCVPGWRGPGCD 401          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Sea Lamprey
Match: vwde (von Willebrand factor D and EGF domains [Source:ZFIN;Acc:ZDB-GENE-060929-1226])

HSP 1 Score: 108.997 bits (271), Expect = 2.826e-27
Identity = 65/167 (38.92%), Postives = 86/167 (51.50%), Query Frame = 3
Query: 1320 PNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNL---CTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHI 1808
            P   C   C++ G C++   CFC  GY+G+ CQ   C  KCKN G+C+ P  C+C  GF G +C K  C+  C NGGQC+  +    C+C  G+ G  C++ +C   C   G C    ICSCP G  G  C    C   C++GG C+  N C C   FSG  C   I
Sbjct:   44 PRAKCEPPCRHYGLCIRNDTCFCGKGYEGERCQFAQCYPKCKNEGECLRPGKCRCQPGFGGRYCHKAVCEGGCLNGGQCVPVHSSVKCSCVSGWAGPRCQEAVCPQGCLNRGSCVSPGICSCPTGWEGGACHIAVCRKPCLHGGKCVAPNICRCRAHFSGLQCATRI 210          

HSP 2 Score: 102.449 bits (254), Expect = 4.939e-25
Identity = 62/163 (38.04%), Postives = 88/163 (53.99%), Query Frame = 3
Query: 1425 CNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGIC---QKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSRI 1898
            C   C++ G CI  + C C +G+EG  C+  +C   C+N G+CLRP  C C  G+ G++C K +C   C  GG C        CSC  G  G RC++  C   C+N G+C+    C CP  + G  C   +C + C +GGKCV  N+C+C   F G +C +RI
Sbjct:   48 CEPPCRHYGLCIRNDTCFCGKGYEGERCQFAQCYPKCKNEGECLRPGKCRCQPGFGGRYCHKAVCEGGCLNGGQCVPVHSSVKCSCVSGWAGPRCQEAVCPQGCLNRGSCVSPGICSCPTGWEGGACHIAVCRKPCLHGGKCVAPNICRCRAHFSGLQCATRI 210          

HSP 3 Score: 76.6406 bits (187), Expect = 3.944e-16
Identity = 46/132 (34.85%), Postives = 64/132 (48.48%), Query Frame = 3
Query: 1617 CNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCV----GNMCQCPTGFFGPECKSRICITG-LKFRKIIKPVIVQFPVIVSNKMCIESTC 1994
            C PPC+  G+C + + C C +G  G RC+  +CYP+C N G C+   KC C   F G +C   +C   C NGG+CV       C C +G+ GP C+  +C  G L     + P I   P       C  + C
Sbjct:   48 CEPPCRHYGLCIRNDTCFCGKGYEGERCQFAQCYPKCKNEGECLRPGKCRCQPGFGGRYCHKAVCEGGCLNGGQCVPVHSSVKCSCVSGWAGPRCQEAVCPQGCLNRGSCVSPGICSCPTGWEGGACHIAVC 179          

HSP 4 Score: 73.9442 bits (180), Expect = 2.963e-15
Identity = 45/126 (35.71%), Postives = 60/126 (47.62%), Query Frame = 3
Query: 1251 DDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCV----KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRI 1616
            + ECL     + +    F  + C    C   C N GQCV      KC C +G+ G  CQ  +C + C N G C+ P IC C  G+EG  C    C   C +GG+C+ PN+C C   + G  C  RI
Sbjct:   87 EGECLRPGKCRCQPG--FGGRYCHKAVCEGGCLNGGQCVPVHSSVKCSCVSGWAGPRCQEAVCPQGCLNRGSCVSPGICSCPTGWEGGACHIAVCRKPCLHGGKCVAPNICRCRAHFSGLQCATRI 210          

HSP 5 Score: 72.7886 bits (177), Expect = 6.709e-15
Identity = 49/139 (35.25%), Postives = 70/139 (50.36%), Query Frame = 3
Query: 1500 LFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKN---KCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            +F  + KC+  C + G C+R + C C  GY G+ C+   C P C+  G C +   C C  G  G  C K  C   C+NGG C+  +   KC C   ++G  C+  +C + C N G CV   +C CPTG+ G  C   +C
Sbjct:   41 VFDPRAKCEPPCRHYGLCIRNDTCFCGKGYEGERCQFAQCYPKCKNEGECLRPGKCRCQPGFGGRYCHKAVCEGGCLNGGQCVPVHSSVKCSCVSGWAGPRCQEAVCPQGCLNRGSCVSPGICSCPTGWEGGACHIAVC 179          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Nematostella
Match: EDO31040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ23])

HSP 1 Score: 94.7449 bits (234), Expect = 3.452e-23
Identity = 47/115 (40.87%), Postives = 65/115 (56.52%), Query Frame = 3
Query: 1455 CIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE 1799
            C+ P  C+C +G+ G+ C +  C   C NGG+C+RP++C C  GY G  C   +C P C  GG C   N C C  G  G RCE  +C   C+NGG+C+G   C+C   ++G  CE
Sbjct:    3 CVAPRTCRCPKGYYGIGCRRAFCRNGCYNGGECVRPDVCKCRAGYEGPLCLTPVCKPSCVNGGYCVGSNTCRCLRGFEGWRCEHMKCMVSCLNGGSCVGPYLCNCLPGYTGHRCE 117          

HSP 2 Score: 87.8113 bits (216), Expect = 1.019e-20
Identity = 46/98 (46.94%), Postives = 56/98 (57.14%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCE 1607
            C    C   C N G+CV+   C C  GY+G  C  P+C   C NGG C+G N C+C  GFEG  CE +KC ++C NGG C+ P LC C  GY G  CE
Sbjct:   20 CRRAFCRNGCYNGGECVRPDVCKCRAGYEGPLCLTPVCKPSCVNGGYCVGSNTCRCLRGFEGWRCEHMKCMVSCLNGGSCVGPYLCNCLPGYTGHRCE 117          

HSP 3 Score: 82.8037 bits (203), Expect = 4.896e-19
Identity = 47/113 (41.59%), Postives = 60/113 (53.10%), Query Frame = 3
Query: 1377 CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYEC 1715
            C CP GY G  C+   C   C NGG+C+ P++C+C  G+EG  C    C  +C NGG C+  N C C  G+ G  CE   C   C  GG C    +C+C  G  G+RCE  EC
Sbjct:    9 CRCPKGYYGIGCRRAFCRNGCYNGGECVRPDVCKCRAGYEGPLCLTPVCKPSCVNGGYCVGSNTCRCLRGFEGWRCEHMKCMVSCLNGGSCVGPYLCNCLPGYTGHRCEIGEC 121          

HSP 4 Score: 73.559 bits (179), Expect = 9.965e-16
Identity = 46/115 (40.00%), Postives = 58/115 (50.43%), Query Frame = 3
Query: 1551 CLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGN-MCQCPTGFFGPECK 1889
            C+ P  C C  GY G  C +  C   C  GG C + ++C C  G  G  C    C P C+NGG C+G N C C + F G  CE+  C   C NGG CVG  +C C  G+ G  C+
Sbjct:    3 CVAPRTCRCPKGYYGIGCRRAFCRNGCYNGGECVRPDVCKCRAGYEGPLCLTPVCKPSCVNGGYCVGSNTCRCLRGFEGWRCEHMKCMVSCLNGGSCVGPYLCNCLPGYTGHRCE 117          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Nematostella
Match: EDO28502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6A3])

HSP 1 Score: 89.7373 bits (221), Expect = 2.366e-21
Identity = 53/125 (42.40%), Postives = 71/125 (56.80%), Query Frame = 3
Query: 1332 CNITCQNNGQCV-KWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGF-EGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC 1700
            C+  C+N G C+ K  C C   + G+ C+ P+C   C NGG+C+ PN+C C   F  G+ C+   C   C +GG+C+RPN C+C  GY GK CEK IC   C  GG C +   C+C  G  G RC
Sbjct:    1 CSPGCRNGGLCIAKNTCKCSQWFVGEQCEFPVCRSTCLNGGRCVKPNVCLCDSRFWTGVRCQLPVCMFPCLHGGRCVRPNQCSCQSGYYGKMCEKAICKDSCFNGGRCIRPGTCACAFGFTGPRC 125          

HSP 2 Score: 89.3521 bits (220), Expect = 2.790e-21
Identity = 55/125 (44.00%), Postives = 69/125 (55.20%), Query Frame = 3
Query: 1425 CNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTC-AFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            C+  C+NGG CI  N C+CS+ F G  CE   C  TC NGG+C++PN+C C +  + G  C+  +C  PC  GG C + N CSC  G  G  CEK  C   C NGG CI    C C   F+G  C
Sbjct:    1 CSPGCRNGGLCIAKNTCKCSQWFVGEQCEFPVCRSTCLNGGRCVKPNVCLCDSRFWTGVRCQLPVCMFPCLHGGRCVRPNQCSCQSGYYGKMCEKAICKDSCFNGGRCIRPGTCACAFGFTGPRC 125          

HSP 3 Score: 79.7221 bits (195), Expect = 6.548e-18
Identity = 45/103 (43.69%), Postives = 60/103 (58.25%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWK-CFCPTG-YQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFC 1604
            F+ ++C    C  TC N G+CVK   C C +  + G  CQ P+C   C +GG+C+ PN C C  G+ G  CEK  C  +C NGG+C+RP  C CAFG+ G  C
Sbjct:   23 FVGEQCEFPVCRSTCLNGGRCVKPNVCLCDSRFWTGVRCQLPVCMFPCLHGGRCVRPNQCSCQSGYYGKMCEKAICKDSCFNGGRCIRPGTCACAFGFTGPRC 125          

HSP 4 Score: 77.411 bits (189), Expect = 4.095e-17
Identity = 49/125 (39.20%), Postives = 65/125 (52.00%), Query Frame = 3
Query: 1521 CDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEG-TVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFFGPEC 1886
            C   C NGG C+  N C C+  ++G+ CE  +C   C  GG C K N+C C      G RC+   C   C++GG C+  N+C C   + G  CE  IC   C+NGG+C+    C C  GF GP C
Sbjct:    1 CSPGCRNGGLCIAKNTCKCSQWFVGEQCEFPVCRSTCLNGGRCVKPNVCLCDSRFWTGVRCQLPVCMFPCLHGGRCVRPNQCSCQSGYYGKMCEKAICKDSCFNGGRCIRPGTCACAFGFTGPRC 125          

HSP 5 Score: 49.2914 bits (116), Expect = 3.427e-7
Identity = 37/98 (37.76%), Postives = 51/98 (52.04%), Query Frame = 3
Query: 1713 CYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCV-GNMCQCPTGFF-GPECKSRICI-TGLKFRKIIKPVIVQFPVIVSNKMCIESTC 1994
            C P C NGG CI KN C C Q F G  CE  +C + C NGG+CV  N+C C + F+ G  C+  +C+   L   + ++P           KMC ++ C
Sbjct:    1 CSPGCRNGGLCIAKNTCKCSQWFVGEQCEFPVCRSTCLNGGRCVKPNVCLCDSRFWTGVRCQLPVCMFPCLHGGRCVRPNQCSCQSGYYGKMCEKAIC 98          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Nematostella
Match: EDO34703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM7])

HSP 1 Score: 91.6633 bits (226), Expect = 4.890e-19
Identity = 82/222 (36.94%), Postives = 99/222 (44.59%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWKCFCPTGYQGKFC---QNPICNEKCKNGGKC---IGPNICQCSEGFEGLFCEKLKCDI---TCENGGQCLR-PN--LCTCAFGYIGKFCE---KRICNPPCQKGGICQKGN---ICSCPEGTVGNRCEKYE--CYPQ-CMNGGTCIGK---NKCHCPQSFSGSFCENHI----CTRCYNGGKCV----GNMCQCPTGFFGPEC 1886
            C +  CN   Q N     ++C C +G+ GK C   ++      C NGG C   I   +C C  GF G FCEK   D     C N G+C+  P    C C+ GY G FCE       + PC  GG C  G     C+CP G  G RCE     C P  C+NG TC      ++C C   FSG+ CE  I     T C N G CV    G  C C  GF G  C
Sbjct:  919 CDSNPCNNGAQCNNMVDGYRCMCKSGFTGKNCEVEEDECTTNPCANGGACVDKINGFVCTCPSGFTGQFCEKATVDCKPGACRNNGKCVEIPGGFQCLCSDGYEGDFCEVNTNECKSSPCLNGGKCTDGVNSFTCNCPAGYSGGRCEDKTNGCRPDSCLNGATCTETSYGHRCACVAGFSGNRCETDINECASTPCANNGLCVDKEGGFTCLCKPGFSGTTC 1140          

HSP 2 Score: 67.0106 bits (162), Expect = 2.267e-11
Identity = 64/183 (34.97%), Postives = 84/183 (45.90%), Query Frame = 3
Query: 1437 CKNGGKC---IGPNICQCSEGFEGLFCEKLKCDIT---CENGGQC---LRPNLCTCAFGYIGKFCEKRI--CNP-PCQKGGICQK---GNICSCPEGTVGNRCE--KYECYPQ-CMNGGTC---IGKNKCHCPQSFSGSFCENHI----CTRCYNGGKCV----GNMCQCPTGFFGPECKSRI 1898
            C NG +C   +    C C  GF G  CE  + + T   C NGG C   +   +CTC  G+ G+FCEK    C P  C+  G C +   G  C C +G  G+ CE    EC    C+NGG C   +    C+CP  +SG  CE+         C NG  C     G+ C C  GF G  C++ I
Sbjct:  924 CNNGAQCNNMVDGYRCMCKSGFTGKNCEVEEDECTTNPCANGGACVDKINGFVCTCPSGFTGQFCEKATVDCKPGACRNNGKCVEIPGGFQCLCSDGYEGDFCEVNTNECKSSPCLNGGKCTDGVNSFTCNCPAGYSGGRCEDKTNGCRPDSCLNGATCTETSYGHRCACVAGFSGNRCETDI 1106          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Nematostella
Match: EDO33048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC0])

HSP 1 Score: 82.8037 bits (203), Expect = 5.487e-17
Identity = 88/265 (33.21%), Postives = 121/265 (45.66%), Query Frame = 3
Query: 1245 CQDDECLE----KENIKSEIRSCFIQKRCPNESCNIT-------CQNNGQCV----KWKCFCPTGYQGKFCQ--NPICNEKCKNGGKCI-GPN--ICQCSEGFEGLFCEKLK-CDIT---CENGGQCLRPN---LCTCAFGYIGKFCEKR-IC-NPPCQKGGICQKGN---ICSCPEGTVGNRCEKYE-CYPQ-CMNGGTCIGKNK---CHCPQSFSGSFCENH---ICTRCYNGGKCVGNM----CQCPTGFFGPECKSRICIT 1907
            CQ + CL      +  ++ + +C +  R     CN+        C N G CV     + C CP  + G  CQ  N   +  C N G C+ G N   C C+EG+ G  CE    C  +   C NGG C       +CTC  GY G  CE R  C   PC  GG C +GN   +C+C  G  G++C   + C P  C+NGGTC+ +     C CP  FSG  C++        C N G CV  +    C C  G+ G  C+S +C++
Sbjct:   92 CQGNPCLNGGTCSQGNQTFVCACAVGWR--GSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQDSNECFSNPCMNAGTCVDGVNSYTCTCAEGWTGSRCESFDYCKASGDPCLNGGSCTNGASNYICTCRPGYRGNRCEARDYCQGSPCLNGGTCSQGNQTFVCACAVGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQDSNECFSNPCMNAGTCVDGVNSYTCTCAEGWTGSRCESSVCLS 354          

HSP 2 Score: 52.373 bits (124), Expect = 4.226e-7
Identity = 71/216 (32.87%), Postives = 93/216 (43.06%), Query Frame = 3
Query: 1344 CQNNGQCVK----WKCFCPTGYQGKFCQ-NPIC-NEKCKNGGKCIGPN---ICQCSEGFEGLFCEKL-KCDIT-CENGGQCLRPNL---CTCAFGYIGKFCEK--RICNPPCQKGGICQKG---NICSCPEGTVGNRCEKYECY-----PQCMNGGTCIGKNK---CHCPQSFSGSFCE-NHIC--TRCYNGGKCV-GN---MCQCPTGFFGPECK 1889
            C N G C      + C C  GY+G  C+    C    C NGG C   N   +C C+ G+ G  C     C  T C NGG C+       CTC   + G  C+      + PC   G C  G     C+C EG  G+RCE ++ Y       C+NGG+C        C C   + G+ CE    C  + C NGG C  GN   +C C  G+ G +C 
Sbjct:   60 CLNGGSCTNGASNYICTCRPGYRGNRCEARDYCQGNPCLNGGTCSQGNQTFVCACAVGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQDSNECFSNPCMNAGTCVDGVNSYTCTCAEGWTGSRCESFD-YCKASGDPCLNGGSCTNGASNYICTCRPGYRGNRCEARDYCQGSPCLNGGTCSQGNQTFVCACAVGWRGSQCN 274          

HSP 3 Score: 51.2174 bits (121), Expect = 9.457e-7
Identity = 60/176 (34.09%), Postives = 76/176 (43.18%), Query Frame = 3
Query: 1344 CQNNGQCVK----WKCFCPTGYQGKFCQ-NPIC-NEKCKNGGKCIGPN---ICQCSEGFEGLFCEKL-KCDIT-CENGGQCLRPNL---CTCAFGYIGKFCEK--RICNPPCQKGGICQKG---NICSCPEGTVGNRCEKYECYPQ-CMNGGTCI---GKNKCHCPQSFSGSFCEN 1802
            C N G C      + C C  GY+G  C+    C    C NGG C   N   +C C+ G+ G  C     C  T C NGG C+       CTC   + G  C+      + PC   G C  G     C+C EG  G+RCE   C    C NGGTC    G   C+C  ++ G  CE+
Sbjct:  210 CLNGGSCTNGASNYICTCRPGYRGNRCEARDYCQGSPCLNGGTCSQGNQTFVCACAVGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQDSNECFSNPCMNAGTCVDGVNSYTCTCAEGWTGSRCESSVCLSNPCQNGGTCRQGNGGYYCNCTSNYGGYNCEH 385          

HSP 4 Score: 50.0618 bits (118), Expect = 1.938e-6
Identity = 55/142 (38.73%), Postives = 64/142 (45.07%), Query Frame = 3
Query: 1533 CENGGQCLRP---NLCTCAFGYIGKFCEKRI----CNPPCQKGGICQKGN---ICSCPEGTVGNRCEKYECYPQ---CMNGGTCIGKNK---CHCPQSFSGSFC--ENHIC-TRCYNGGKCVGNM----CQCPTGFFGPECK 1889
            C NGG C      + C C   YIG  CE +        PC  GG C  G    IC+C  G  GNRCE  + Y Q   C+NGGTC   N+   C C   + GS C   +H   T C NGG CV       C CP  F G  C+
Sbjct:   21 CMNGGTCYSGPWRHACKCPGYYIGSKCESKFTREPSGDPCLNGGSCTNGASNYICTCRPGYRGNRCEARD-YCQGNPCLNGGTCSQGNQTFVCACAVGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQ 161          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Nematostella
Match: EDO30306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T163])

HSP 1 Score: 82.0333 bits (201), Expect = 2.443e-16
Identity = 76/235 (32.34%), Postives = 105/235 (44.68%), Query Frame = 3
Query: 1344 CQNNGQCVK------WKCFCPTGYQGKFCQN---PICNEKCKNGGKCIGPN-----ICQCSEGFEGLFCEKL--KCDIT-CENGGQCLRPN-----LCTCAFGYIGKFCEKRICNP----PCQKGGIC-----QKGNICSCPEGTVGNRCEKY----ECYPQCMNGGTCIGKNK-----CHCPQSFSGSFCENHI----CTRCYNGGKCV------GNMCQCPTGFFGPECKSRI 1898
            C+N+G C        + C C + Y G  C+    P  +  CKNGG C+         C C+ G+ G+ CE     CD + C+NGG C          C CA GY G  CE ++  P    PC+ GG C       G  C+C  G  G  CE      +  P C NGG+C  K       C CP  ++G+ CE  +     + C NGG C       G MC C +G+ G EC++++
Sbjct:  265 CKNDGSCANKPNNTGYTCTCTSEYTGTECETQVQPCDSSPCKNGGACVNKADNSGYTCACASGYTGIECETQVQPCDSSPCKNGGACANKADNSGFTCACASGYTGIECENQV-QPCESSPCKNGGACVNKADNSGYTCACASGYTGIECETQVQPCDSSP-CKNGGSCTNKPDNTGYTCTCPSEYTGTECETQVQPCDSSPCKNGGACANKADNSGYMCACASGYTGIECETQV 497          

HSP 2 Score: 73.9442 bits (180), Expect = 8.509e-14
Identity = 75/233 (32.19%), Postives = 102/233 (43.78%), Query Frame = 3
Query: 1344 CQNNGQCVK------WKCFCPTGYQGKFCQN---PICNEKCKNGGKCIGPN-----ICQCSEGFEGLFCEKL--KCDIT-CENGGQCLRPN-----LCTCAFGYIGKFCEKRI--CNP-PCQKGGIC-----QKGNICSCPEGTVGNRCEKY----ECYPQCMNGGTCIGKNK-----CHCPQSFSGSFCENHI----CTRCYNGGKCV------GNMCQCPTGFFGPECKSR 1895
            C+N G CV       + C C +GY G  C+    P  +  CKNGG C          C C+ G+ G+ CE     C+ + C+NGG C+         C CA GY G  CE ++  C+  PC+ GG C       G  C+CP    G  CE      +  P C NGG C  K       C C   ++G  CE  +     + C NGG C       G  C CP+ + G EC+++
Sbjct:  305 CKNGGACVNKADNSGYTCACASGYTGIECETQVQPCDSSPCKNGGACANKADNSGFTCACASGYTGIECENQVQPCESSPCKNGGACVNKADNSGYTCACASGYTGIECETQVQPCDSSPCKNGGSCTNKPDNTGYTCTCPSEYTGTECETQVQPCDSSP-CKNGGACANKADNSGYMCACASGYTGIECETQVQPCDSSPCKNGGACTNKPDKSGYTCICPSEYTGTECETQ 536          

HSP 3 Score: 65.0846 bits (157), Expect = 4.685e-11
Identity = 74/245 (30.20%), Postives = 98/245 (40.00%), Query Frame = 3
Query: 1344 CQNNGQCVK------WKCFCPTGYQGKFCQN---------------PICNEKCKNGGKCIGPN-----ICQCSEGFEGLFCEKL--KCDIT-CENGGQCLRPN-----LCTCAFGYIGKFCEKRI--CN-PPCQKGGIC-----QKGNICSCPEGTVGNRCEKY----ECYPQCMNGGTCIGKNK-----CHCPQSFSGSFCENHICTR------CYNGGKCV------GNMCQCPTGFFGPECK 1889
            C+N G C        + C CP+ Y G  C+                P  +  CKNGG C+         C C+ G+ G+ CE     CD + C+NGG C          C CA GY G  CE ++  C+  PC+ GG C       G  C+CP    G  CE      +  P C NGG C  K       C C  +++G  CE  +  +      C NG  C       G MC C + F G  C+
Sbjct:   12 CKNGGSCTNKPDNTGYTCTCPSEYTGTECETQDSTIDKFVITFKVQPCDSSPCKNGGACVNKADHSGYTCACASGYTGIECETRVQPCDSSPCKNGGACANKADNSGYTCACASGYTGIECESQVQPCDSSPCKNGGACTNKPDNTGYTCACPSEYTGTECETQVQPCDSSP-CKNGGACANKADNSGYTCACASAYTGIECETVLTVQPCDSSPCKNGATCTNSADNPGYMCTCSSVFTGSTCE 255          

HSP 4 Score: 61.6178 bits (148), Expect = 5.783e-10
Identity = 70/237 (29.54%), Postives = 98/237 (41.35%), Query Frame = 3
Query: 1344 CQNNGQCVK------WKCFCPTGYQGKFCQN---PICNEKCKNGGKCIGPN-----ICQCSEGFEGLFCEKL----KCDIT-CENGGQCLRPN-----LCTCAFGYIGKFCEKRICNP----PCQKGGICQK-----GNICSCPEGTVGNRCEKY----ECYPQCMNGGTCIGKNK-----CHCPQSFSGSFCENHI----CTRCYNGGKCV------GNMCQCPTGFFGPECKSRI 1898
            C+N G C        + C CP+ Y G  C+    P  +  CKNGG C          C C+  + G+ CE +     CD + C+NG  C         +CTC+  + G  CE  I  P    PC+  G C       G  C+C     G  CE      +  P C NGG C+ K       C C   ++G  CE  +     + C NGG C       G  C C +G+ G EC++++
Sbjct:  144 CKNGGACTNKPDNTGYTCACPSEYTGTECETQVQPCDSSPCKNGGACANKADNSGYTCACASAYTGIECETVLTVQPCDSSPCKNGATCTNSADNPGYMCTCSSVFTGSTCE--IVTPCESNPCKNDGSCANKPNNTGYTCTCTSEYTGTECETQVQPCDSSP-CKNGGACVNKADNSGYTCACASGYTGIECETQVQPCDSSPCKNGGACANKADNSGFTCACASGYTGIECENQV 377          

HSP 5 Score: 60.4622 bits (145), Expect = 1.677e-9
Identity = 66/212 (31.13%), Postives = 87/212 (41.04%), Query Frame = 3
Query: 1419 PICNEKCKNGGKCIG-PN----ICQCSEGFEGLFCEKLK--------------CDIT-CENGGQCLRPN-----LCTCAFGYIGKFCEKRI--CNP-PCQKGGIC-----QKGNICSCPEGTVGNRCEKY----ECYPQCMNGGTCIGKNK-----CHCPQSFSGSFCENHI----CTRCYNGGKCV------GNMCQCPTGFFGPECKSRI 1898
            P  +  CKNGG C   P+     C C   + G  CE                 CD + C+NGG C+         C CA GY G  CE R+  C+  PC+ GG C       G  C+C  G  G  CE      +  P C NGG C  K       C CP  ++G+ CE  +     + C NGG C       G  C C + + G EC++ +
Sbjct:    6 PCDSSPCKNGGSCTNKPDNTGYTCTCPSEYTGTECETQDSTIDKFVITFKVQPCDSSPCKNGGACVNKADHSGYTCACASGYTGIECETRVQPCDSSPCKNGGACANKADNSGYTCACASGYTGIECESQVQPCDSSP-CKNGGACTNKPDNTGYTCACPSEYTGTECETQVQPCDSSPCKNGGACANKADNSGYTCACASAYTGIECETVL 216          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Medaka
Match: VWDE (von Willebrand factor D and EGF domains [Source:NCBI gene;Acc:101169390])

HSP 1 Score: 207.994 bits (528), Expect = 6.229e-56
Identity = 94/206 (45.63%), Postives = 124/206 (60.19%), Query Frame = 3
Query: 1293 RSCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            R  +   RC    C   CQN G+CVK   C CP GY G  C+  +CN  C+NGG+CI P++CQC  G+ G  C    CD  C NGG C++P +C C  G+ G  C+  +C+PPC+ GG C + N+CSCPEG  G RC++  C P CMNGG C+G N C C   + G  C   +C  +C NGG+CVG N C CP G+ G +C++ IC
Sbjct: 1283 RDGYTGYRCHIALCRPDCQNQGKCVKPNVCECPAGYSGPTCEEVVCNRHCENGGECISPDVCQCIAGWFGPTCHSALCDPICLNGGTCIKPGVCACPRGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYAGQRCQRSVCEPTCMNGGKCVGANTCSCASGWRGRRCSMPVCLQKCRNGGECVGPNTCHCPVGWGGLQCQTAIC 1488          

HSP 2 Score: 176.792 bits (447), Expect = 1.263e-45
Identity = 85/222 (38.29%), Postives = 120/222 (54.05%), Query Frame = 3
Query: 1278 IKSEIRSCFIQKRCPN----------ESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            +  E  S F   RCP+            C   C  N +C +   C C  GY G  C   +C   C+N GKC+ PN+C+C  G+ G  CE++ C+  CENGG+C+ P++C C  G+ G  C   +C+P C  GG C K  +C+CP G  G++C+   C P C NGG C+  N C CP+ ++G  C+  +C   C NGGKCVG N C C +G+ G  C   +C+
Sbjct: 1236 VSCETSSSFGCGRCPSGYTGDGVTCRAVCRHPCGPNMECSQPNVCTCRDGYTGYRCHIALCRPDCQNQGKCVKPNVCECPAGYSGPTCEEVVCNRHCENGGECISPDVCQCIAGWFGPTCHSALCDPICLNGGTCIKPGVCACPRGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYAGQRCQRSVCEPTCMNGGKCVGANTCSCASGWRGRRCSMPVCL 1457          

HSP 3 Score: 144.436 bits (363), Expect = 3.443e-35
Identity = 66/161 (40.99%), Postives = 94/161 (58.39%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVK-WKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            C +  C+  C N G C+K   C CP G+ G  CQ  +C+  CKNGG+C+  N+C C EG+ G  C++  C+ TC NGG+C+  N C+CA G+ G+ C   +C   C+ GG C   N C CP G  G +C+   C  +C+NGG C+  ++CHC + F G  C
Sbjct: 1355 CHSALCDPICLNGGTCIKPGVCACPRGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYAGQRCQRSVCEPTCMNGGKCVGANTCSCASGWRGRRCSMPVCLQKCRNGGECVGPNTCHCPVGWGGLQCQTAICKQRCLNGGRCVLPDRCHCRRGFQGLTC 1515          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Medaka
Match: VWDE (von Willebrand factor D and EGF domains [Source:NCBI gene;Acc:101169390])

HSP 1 Score: 186.808 bits (473), Expect = 7.984e-49
Identity = 89/198 (44.95%), Postives = 120/198 (60.61%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            C    C+  CQ+ G C  +  C CP GY G  C+  +CN  C+NGG+CI P++CQC  G+ G  C    CD  C NGG C++P +C C  G+ G  C+  +C+PPC+ GG C + N+CSCPEG  G RC++  C P CMNGG C+G N C C   + G  C   +C  +C NGG+CVG N C CP G+ G +C++ IC
Sbjct: 1323 CEEARCDPPCQHGGACQARNLCSCPYGYVGPRCEIMVCNRHCENGGECISPDVCQCIAGWFGPTCHSALCDPICLNGGTCIKPGVCACPRGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYAGQRCQRSVCEPTCMNGGKCVGANTCSCASGWRGRRCSMPVCLQKCRNGGECVGPNTCHCPVGWGGLQCQTAIC 1520          

HSP 2 Score: 169.859 bits (429), Expect = 2.773e-43
Identity = 85/207 (41.06%), Postives = 117/207 (56.52%), Query Frame = 3
Query: 1293 RSCFIQKRCPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVG-NMCQCPTGFFGPECKSRICI 1904
            R  +   RC    C   CQN G+CVK   C CP GY G  C+   C+  C++GG C   N+C C  G+ G  CE + C+  CENGG+C+ P++C C  G+ G  C   +C+P C  GG C K  +C+CP G  G++C+   C P C NGG C+  N C CP+ ++G  C+  +C   C NGGKCVG N C C +G+ G  C   +C+
Sbjct: 1283 RDGYTGYRCHIALCRPDCQNQGKCVKPNVCECPAGYSGPTCEEARCDPPCQHGGACQARNLCSCPYGYVGPRCEIMVCNRHCENGGECISPDVCQCIAGWFGPTCHSALCDPICLNGGTCIKPGVCACPRGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYAGQRCQRSVCEPTCMNGGKCVGANTCSCASGWRGRRCSMPVCL 1489          

HSP 3 Score: 157.147 bits (396), Expect = 3.001e-39
Identity = 86/222 (38.74%), Postives = 118/222 (53.15%), Query Frame = 3
Query: 1275 NIKSEIRSCFIQKRCPN----------ESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCV-GNMCQCPTGFFGPECKSRIC 1901
             +  E  S F   RCP+            C   C  N +C +   C C  GY G  C   +C   C+N GKC+ PN+C+C  G+ G  CE+ +CD  C++GG C   NLC+C +GY+G  CE  +CN  C+ GG C   ++C C  G  G  C    C P C+NGGTCI    C CP+ F GS C+  +C+  C NGG+C+  N+C CP G+ G  C+  +C
Sbjct: 1235 GVSCETSSSFGCGRCPSGYTGDGVTCRAVCRHPCGPNMECSQPNVCTCRDGYTGYRCHIALCRPDCQNQGKCVKPNVCECPAGYSGPTCEEARCDPPCQHGGACQARNLCSCPYGYVGPRCEIMVCNRHCENGGECISPDVCQCIAGWFGPTCHSALCDPICLNGGTCIKPGVCACPRGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYAGQRCQRSVC 1456          

HSP 4 Score: 131.339 bits (329), Expect = 6.156e-31
Identity = 66/161 (40.99%), Postives = 94/161 (58.39%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFC 1796
            C +  C+  C N G C+K   C CP G+ G  CQ  +C+  CKNGG+C+  N+C C EG+ G  C++  C+ TC NGG+C+  N C+CA G+ G+ C   +C   C+ GG C   N C CP G  G +C+   C  +C+NGG C+  ++CHC + F G  C
Sbjct: 1387 CHSALCDPICLNGGTCIKPGVCACPRGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYAGQRCQRSVCEPTCMNGGKCVGANTCSCASGWRGRRCSMPVCLQKCRNGGECVGPNTCHCPVGWGGLQCQTAICKQRCLNGGRCVLPDRCHCRRGFQGLTC 1547          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Medaka
Match: vwde (wnt inhibitory factor 1-like [Source:NCBI gene;Acc:101159380])

HSP 1 Score: 132.88 bits (333), Expect = 6.467e-35
Identity = 73/165 (44.24%), Postives = 92/165 (55.76%), Query Frame = 3
Query: 1320 PNESCNITCQNNGQCVKWK-CFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPN---LCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCEN 1802
            PN  C   C++ G C++   CFC  GY+G+ CQ+  C  KCKNGG C+ P  C+C  GF G +C K+ CD  C NGG+CL  N    C C   + G  C+  IC   C+ GG+C    ICSCP+G +G  C    C   CMNGG CI  NKC C   FSG  C +
Sbjct:   52 PNAKCEPACRHAGLCIRNNTCFCAKGYEGETCQHANCFPKCKNGGACLRPGKCRCPPGFGGRYCHKVTCDGGCWNGGECLAVNGAARCVCPSSWTGSKCQHAICPQGCRNGGVCVAPGICSCPDGWLGGACHTAVCSRACMNGGKCISPNKCRCRPPFSGPRCGD 216          

HSP 2 Score: 112.849 bits (281), Expect = 6.572e-28
Identity = 67/168 (39.88%), Postives = 87/168 (51.79%), Query Frame = 3
Query: 1407 FCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGN---ICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSR 1895
            F  N  C   C++ G CI  N C C++G+EG  C+   C   C+NGG CLRP  C C  G+ G++C K  C+  C  GG C   N    C CP    G++C+   C   C NGG C+    C CP  + G  C   +C+R C NGGKC+  N C+C   F GP C  R
Sbjct:   50 FDPNAKCEPACRHAGLCIRNNTCFCAKGYEGETCQHANCFPKCKNGGACLRPGKCRCPPGFGGRYCHKVTCDGGCWNGGECLAVNGAARCVCPSSWTGSKCQHAICPQGCRNGGVCVAPGICSCPDGWLGGACHTAVCSRACMNGGKCISPNKCRCRPPFSGPRCGDR 217          

HSP 3 Score: 96.6709 bits (239), Expect = 2.767e-22
Identity = 57/139 (41.01%), Postives = 76/139 (54.68%), Query Frame = 3
Query: 1500 LFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCI---GKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG-NMCQCPTGFFGPECKSRIC 1901
            +F    KC+  C + G C+R N C CA GY G+ C+   C P C+ GG C +   C CP G  G  C K  C   C NGG C+   G  +C CP S++GS C++ IC + C NGG CV   +C CP G+ G  C + +C
Sbjct:   49 VFDPNAKCEPACRHAGLCIRNNTCFCAKGYEGETCQHANCFPKCKNGGACLRPGKCRCPPGFGGRYCHKVTCDGGCWNGGECLAVNGAARCVCPSSWTGSKCQHAICPQGCRNGGVCVAPGICSCPDGWLGGACHTAVC 187          

HSP 4 Score: 81.2629 bits (199), Expect = 5.344e-17
Identity = 47/137 (34.31%), Postives = 69/137 (50.36%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVK-WKCFCPTGYQGKFCQNPICNEKCKNGGKCI---GPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRC 1700
            +  + C + +C   C+N G C++  KC CP G+ G++C    C+  C NGG+C+   G   C C   + G  C+   C   C NGG C+ P +C+C  G++G  C   +C+  C  GG C   N C C     G RC
Sbjct:   78 YEGETCQHANCFPKCKNGGACLRPGKCRCPPGFGGRYCHKVTCDGGCWNGGECLAVNGAARCVCPSSWTGSKCQHAICPQGCRNGGVCVAPGICSCPDGWLGGACHTAVCSRACMNGGKCISPNKCRCRPPFSGPRC 214          

HSP 5 Score: 78.1814 bits (191), Expect = 6.642e-16
Identity = 40/108 (37.04%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVK----WKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKR 1613
            F  + C   +C+  C N G+C+      +C CP+ + G  CQ+ IC + C+NGG C+ P IC C +G+ G  C    C   C NGG+C+ PN C C   + G  C  R
Sbjct:  110 FGGRYCHKVTCDGGCWNGGECLAVNGAARCVCPSSWTGSKCQHAICPQGCRNGGVCVAPGICSCPDGWLGGACHTAVCSRACMNGGKCISPNKCRCRPPFSGPRCGDR 217          

HSP 6 Score: 77.7962 bits (190), Expect = 8.423e-16
Identity = 44/133 (33.08%), Postives = 65/133 (48.87%), Query Frame = 3
Query: 1617 CNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVG----NMCQCPTGFFGPECKSRICITGLKFRKI-IKPVIVQFPVIVSNKMCIESTCT 1997
            C P C+  G+C + N C C +G  G  C+   C+P+C NGG C+   KC CP  F G +C    C   C+NGG+C+       C CP+ + G +C+  IC  G +   + + P I   P       C  + C+
Sbjct:   56 CEPACRHAGLCIRNNTCFCAKGYEGETCQHANCFPKCKNGGACLRPGKCRCPPGFGGRYCHKVTCDGGCWNGGECLAVNGAARCVCPSSWTGSKCQHAICPQGCRNGGVCVAPGICSCPDGWLGGACHTAVCS 188          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Medaka
Match: zmp:0000000846 (tenascin [Source:NCBI gene;Acc:101171095])

HSP 1 Score: 138.658 bits (348), Expect = 3.644e-33
Identity = 71/201 (35.32%), Postives = 91/201 (45.27%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            F  + C   SC   C+ NG CV  KC C  GY G+ C  P C   C   G CI   +C C  G++G  C ++ C   C   GQC+    C+C  G+ G  C +  C   C++ G C  G  C C +G  G  C  + C   C   GTC+   +C C   FSG+ C    C   C   G CV   C C  GF G +C  R C
Sbjct:  309 FSGEDCGQHSCPNNCRGNGVCVDGKCICTAGYSGEDCSQPTCLSDCSGRGTCI-KGMCMCDPGYQGDDCSQVACLKNCRGRGQCIN-GRCSCDAGFQGDDCAELSCPNSCRQRGQCVNGQ-CVCDQGFAGEDCSIHTCPSDCYGRGTCV-HGRCVCHAGFSGNDCSELSCPNDCKGRGLCVDGQCICDEGFSGEDCSRRAC 505          

HSP 2 Score: 127.872 bits (320), Expect = 8.241e-30
Identity = 68/203 (33.50%), Postives = 89/203 (43.84%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFR 1922
            C    C   C + G+CV   CFC  G+ G+ C    C   C+  G C+    C C+ G+ G  C +  C   C   G C++  +C C  GY G  C +  C   C+  G C  G  CSC  G  G+ C +  C   C   G C+   +C C Q F+G  C  H C + CY  G CV   C C  GF G +C    C    K R
Sbjct:  283 CSELICPKDCYDRGRCVNGTCFCDEGFSGEDCGQHSCPNNCRGNGVCVDGK-CICTAGYSGEDCSQPTCLSDCSGRGTCIK-GMCMCDPGYQGDDCSQVACLKNCRGRGQCINGR-CSCDAGFQGDDCAELSCPNSCRQRGQCV-NGQCVCDQGFAGEDCSIHTCPSDCYGRGTCVHGRCVCHAGFSGNDCSELSCPNDCKGR 481          

HSP 3 Score: 125.946 bits (315), Expect = 3.137e-29
Identity = 70/227 (30.84%), Postives = 96/227 (42.29%), Query Frame = 3
Query: 1260 CLEKENIKSEIRSCFIQK-----RCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFR 1922
            C  + N  SE   C  +       C    C   CQ+ G+CV  +C C  G+ G  C   +C   C   G+C+G  +C C +GF G  C + +C   C   G C   + C C   + G  C + IC   C   G C  G  C C EG  G  C ++ C   C   G C+   KC C   +SG  C    C + C   G C+  MC C  G+ G +C    C+   + R
Sbjct:  166 CSGRGNYSSETCGCVCEPGWRGPNCSEPECPGGCQDRGRCVDGRCECWRGFAGDDCSLQVCPVSCGTHGRCVG-TVCVCEDGFHGDDCSQSRCLNDCLGRGHCDDGD-CVCDEPWTGYDCSELICPKDCYDRGRCVNGT-CFCDEGFSGEDCGQHSCPNNCRGNGVCV-DGKCICTAGYSGEDCSQPTCLSDCSGRGTCIKGMCMCDPGYQGDDCSQVACLKNCRGR 388          

HSP 4 Score: 125.946 bits (315), Expect = 3.834e-29
Identity = 64/196 (32.65%), Postives = 86/196 (43.88%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            C   +C   C+  GQC+  +C C  G+QG  C    C   C+  G+C+    C C +GF G  C    C   C   G C+    C C  G+ G  C +  C   C+  G+C  G  C C EG  G  C +  C   C+  G C+ + +C C + FSG  C    C   C   G CV   C C +G+ G  C  R C
Sbjct:  376 CSQVACLKNCRGRGQCINGRCSCDAGFQGDDCAELSCPNSCRQRGQCVNGQ-CVCDQGFAGEDCSIHTCPSDCYGRGTCVHGR-CVCHAGFSGNDCSELSCPNDCKGRGLCVDGQ-CICDEGFSGEDCSRRACPNDCLGRGDCL-EGRCVCREGFSGDDCSAVSCPENCSGRGSCVDGRCSCESGYEGDSCAERSC 567          

HSP 5 Score: 124.405 bits (311), Expect = 1.055e-28
Identity = 63/191 (32.98%), Postives = 85/191 (44.50%), Query Frame = 3
Query: 1317 CPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPEC 1886
            C   SC  +C+  GQCV  +C C  G+ G+ C    C   C   G C+    C C  GF G  C +L C   C+  G C+    C C  G+ G+ C +R C   C   G C +G  C C EG  G+ C    C   C   G+C+   +C C   + G  C    C+  C+  G CV   C C  G+ G +C
Sbjct:  407 CAELSCPNSCRQRGQCVNGQCVCDQGFAGEDCSIHTCPSDCYGRGTCVHGR-CVCHAGFSGNDCSELSCPNDCKGRGLCVDGQ-CICDEGFSGEDCSRRACPNDCLGRGDCLEGR-CVCREGFSGDDCSAVSCPENCSGRGSCV-DGRCSCESGYEGDSCAERSCSNSCHQRGSCVNAQCVCDEGYIGEDC 593          

HSP 6 Score: 87.8113 bits (216), Expect = 2.490e-17
Identity = 45/135 (33.33%), Postives = 58/135 (42.96%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEK 1706
            F    C   SC   C+  G CV  +C C  G+ G+ C    C   C   G C+    C C EGF G  C  + C   C   G C+    C+C  GY G  C +R C+  C + G C     C C EG +G  C +
Sbjct:  464 FSGNDCSELSCPNDCKGRGLCVDGQCICDEGFSGEDCSRRACPNDCLGRGDCL-EGRCVCREGFSGDDCSAVSCPENCSGRGSCV-DGRCSCESGYEGDSCAERSCSNSCHQRGSCVNAQ-CVCDEGYIGEDCSE 595          

HSP 7 Score: 75.8702 bits (185), Expect = 1.220e-13
Identity = 41/128 (32.03%), Postives = 58/128 (45.31%), Query Frame = 3
Query: 1245 CQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPP 1628
            C D +C+  E    E  S   ++ CPN+     C   G C++ +C C  G+ G  C    C E C   G C+    C C  G+EG  C +  C  +C   G C+    C C  GYIG+ C +   +PP
Sbjct:  484 CVDGQCICDEGFSGEDCS---RRACPND-----CLGRGDCLEGRCVCREGFSGDDCSAVSCPENCSGRGSCVDGR-CSCESGYEGDSCAERSCSNSCHQRGSCVNAQ-CVCDEGYIGEDCSE--VSPP 599          

HSP 8 Score: 56.9954 bits (136), Expect = 7.667e-8
Identity = 31/98 (31.63%), Postives = 42/98 (42.86%), Query Frame = 3
Query: 1239 RPCQDD-----ECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL 1517
            R C +D     +CLE   +    R  F    C   SC   C   G CV  +C C +GY+G  C    C+  C   G C+    C C EG+ G  C ++
Sbjct:  503 RACPNDCLGRGDCLEGRCV---CREGFSGDDCSAVSCPENCSGRGSCVDGRCSCESGYEGDSCAERSCSNSCHQRGSCVNAQ-CVCDEGYIGEDCSEV 596          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Medaka
Match: tnc (tenascin-like [Source:NCBI gene;Acc:101170815])

HSP 1 Score: 138.272 bits (347), Expect = 3.861e-33
Identity = 73/201 (36.32%), Postives = 90/201 (44.78%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            F  + C   +C   C N GQCV  +C C TGY G+ C    C + C   G C     C C  GFEG  C  L C   C N GQC+    C C  GY G+ C +  C   CQ+ G C  G  C C +G  G  C    C   CM  G C+   KC C   F+G  C    C   C + G+C+   C C  GF G +C  + C
Sbjct:  313 FTGEDCGELTCPANCNNRGQCVDGQCVCQTGYSGEDCSKLTCPKNCHERGHCFNGK-CICDPGFEGEDCSILSCPDNCSNNGQCINGE-CICDIGYQGEDCSELSCPNNCQEKGRCINGQ-CMCEKGYAGEDCSTKTCPRDCMGRGDCV-DGKCVCLVGFTGKDCSELTCPNDCQDQGQCINGQCVCHQGFTGEDCSEKTC 509          

HSP 2 Score: 130.568 bits (327), Expect = 1.027e-30
Identity = 89/279 (31.90%), Postives = 114/279 (40.86%), Query Frame = 3
Query: 1182 RSSWST--CSVTCGIGWQ-------KRYRPCQDD--------ECLEK---ENIKSEI-------------RSC-----FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRIC 1901
            R +WST  CS TC  GW+       +    CQD         EC E    ++   EI              SC     FI + C   +C   C   G CV+ +C C   + G  C + IC   C + G+CI    C C EGF G  C +L C   C N GQC+    C C  GY G+ C K  C   C + G C  G  C C  G  G  C    C   C N G CI   +C C   + G  C    C   C   G+C+   C C  G+ G +C ++ C
Sbjct:  173 RGNWSTDSCSCTCEPGWKGLNCTEPECPNDCQDQGRCVDGQCECFEGFTGDDCSIEICLMDCGDYGHCVEGSCLCEDGFIGEDCSQTNCLNNCLGRGHCVEDECICDHPWTGSDCSDLICPNDCYDRGQCIN-GTCYCEEGFTGEDCGELTCPANCNNRGQCVDGQ-CVCQTGYSGEDCSKLTCPKNCHERGHCFNGK-CICDPGFEGEDCSILSCPDNCSNNGQCI-NGECICDIGYQGEDCSELSCPNNCQEKGRCINGQCMCEKGYAGEDCSTKTC 447          

HSP 3 Score: 129.798 bits (325), Expect = 1.678e-30
Identity = 68/198 (34.34%), Postives = 91/198 (45.96%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKS 1892
            F  + C   SC   C NNGQC+  +C C  GYQG+ C    C   C+  G+CI    C C +G+ G  C    C   C   G C+    C C  G+ GK C +  C   CQ  G C  G  C C +G  G  C +  C   C++ G+C+    C C + F+G+ C    C   C N G C   +C C  GF G +C +
Sbjct:  375 FEGEDCSILSCPDNCSNNGQCINGECICDIGYQGEDCSELSCPNNCQEKGRCINGQ-CMCEKGYAGEDCSTKTCPRDCMGRGDCVDGK-CVCLVGFTGKDCSELTCPNDCQDQGQCINGQ-CVCHQGFTGEDCSEKTCPSNCLDRGSCV-DGSCICYKGFTGTDCSEPTCPGDCQNHGSCENGVCVCDEGFVGDDCSN 568          

HSP 4 Score: 72.7886 bits (177), Expect = 1.020e-12
Identity = 36/109 (33.03%), Postives = 52/109 (47.71%), Query Frame = 3
Query: 1302 FIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPP 1628
            F  K C   +C   CQ+ GQC+  +C C  G+ G+ C    C   C + G C+  + C C +GF G  C +  C   C+N G C    +C C  G++G  C     +PP
Sbjct:  468 FTGKDCSELTCPNDCQDQGQCINGQCVCHQGFTGEDCSEKTCPSNCLDRGSCVDGS-CICYKGFTGTDCSEPTCPGDCQNHGSC-ENGVCVCDEGFVGDDCSN--VSPP 572          

HSP 5 Score: 58.151 bits (139), Expect = 3.448e-8
Identity = 37/120 (30.83%), Postives = 49/120 (40.83%), Query Frame = 3
Query: 1548 QCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHIC-TRCYNGGKCVGNMCQCPTGFFGPECKSRICI 1904
            QC     C  A    G+   K  CN    +G        C+C  G  G  C + EC   C + G C+   +C C + F+G  C   IC   C + G CV   C C  GF G +C    C+
Sbjct:  147 QCSSGAGCCGAQVTAGELSTKPYCN---GRGNWSTDSCSCTCEPGWKGLNCTEPECPNDCQDQGRCV-DGQCECFEGFTGDDCSIEICLMDCGDYGHCVEGSCLCEDGFIGEDCSQTNCL 262          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Planmine SMEST
Match: SMESG000005380.1 (SMESG000005380.1)

HSP 1 Score: 1355.89 bits (3508), Expect = 0.000e+0
Identity = 681/687 (99.13%), Postives = 682/687 (99.27%), Query Frame = 3
Query:    3 MNSTPXXXXXXXXXLNFSLCCIELLNAQWSQMSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKPDEENGWITRKSIRIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCDYSWTYQYKFCNWQSCDNTILSHVGLLEKEIIDIKKTQIAIMRTILISILFKNQTQINSKIKDFFSLELIDENSLIVSISITHDAIINIKSGDGNNSSKFSLEKLQALKNEDLSFNVFINDSGIFVETFCIFRMFTIYNEKIRKFFSGSVQKLHLKVSKNVIIRVSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSPRSSWSTCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFRKIIKPVIVQFPVIVSNKMCIESTCTFIQPQRSVVVNKVVFKPYIDCL 2063
            MNSTPIIIVIFIVVLNFSLCCIELLNAQWSQMSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRK DEENGWI RKSIRIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCDYSWTYQYKFCNWQSCDNTILSHVGLLEKEIIDIKKTQIAIMRTILISI FKNQTQINSKIKDFFSLELIDENSLIVSISITHDAIINIKSGDGNNSSKFSLEKLQALKNEDLSFNVFINDSGIFVETFCIFRMFTIYNEKIRKFFSGSVQKL+LKVSKNVIIRVSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSPRSSWS CSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIG FCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFRKIIKPVIVQFPVIVSNKMCIESTCTFIQPQRSVVVNKVVFKPYIDCL
Sbjct:    1 MNSTPIIIVIFIVVLNFSLCCIELLNAQWSQMSIEERVERAEIVLVIRVIKKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKLDEENGWINRKSIRIHGFGSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERSLSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCDYSWTYQYKFCNWQSCDNTILSHVGLLEKEIIDIKKTQIAIMRTILISISFKNQTQINSKIKDFFSLELIDENSLIVSISITHDAIINIKSGDGNNSSKFSLEKLQALKNEDLSFNVFINDSGIFVETFCIFRMFTIYNEKIRKFFSGSVQKLNLKVSKNVIIRVSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSPRSSWSMCSVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGTFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTRCYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFRKIIKPVIVQFPVIVSNKMCIESTCTFIQPQRSVVVNKVVFKPYIDCL 687          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Planmine SMEST
Match: SMESG000016735.1 (SMESG000016735.1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.195e-18
Identity = 62/177 (35.03%), Postives = 82/177 (46.33%), Query Frame = 3
Query: 1344 CQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDIT------CENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMC 1853
            C  NG CV  +C C  GY GK C   +C   C   G C     C+C +G+E   C KL+ D        C N G+    ++C C  GY G+ CEK++C+  C   G C     C C EG  G +C K  C  +C   G CI K  C C + ++G  C    C + C N G+C  N  
Sbjct:  615 CSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCY-NGYCSGNGTCICNEGFSGKQCGKRICDSRCYKHGRCI-KGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHA 789          

HSP 2 Score: 85.5001 bits (210), Expect = 1.047e-16
Identity = 70/224 (31.25%), Postives = 104/224 (46.43%), Query Frame = 3
Query: 1266 EKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKW-KCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL--KCDI-TCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQ------CMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGN-MCQCPTGFFGPECKSRIC 1901
             +ENI+  + +    K    ++C   C  +G C ++ KC C TG++G+ C      + C   G       C C+  ++G  C+ +  +C+   C   G C+    C C  GY GK C   +C   C + G+CQ+   C C +G     C K     Q      C+N G    ++ C CP  +SG  CE  +C+ +CYNG  C GN  C C  GF G +C  RIC
Sbjct:  527 REENIQFNLNT----KMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYF-QGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGE-CVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCYNG-YCSGNGTCICNEGFSGKQCGKRIC 743          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Planmine SMEST
Match: SMESG000016735.1 (SMESG000016735.1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.269e-18
Identity = 62/177 (35.03%), Postives = 82/177 (46.33%), Query Frame = 3
Query: 1344 CQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDIT------CENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKCVGNMC 1853
            C  NG CV  +C C  GY GK C   +C   C   G C     C+C +G+E   C KL+ D        C N G+    ++C C  GY G+ CEK++C+  C   G C     C C EG  G +C K  C  +C   G CI K  C C + ++G  C    C + C N G+C  N  
Sbjct:  635 CSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCY-NGYCSGNGTCICNEGFSGKQCGKRICDSRCYKHGRCI-KGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHA 809          

HSP 2 Score: 85.5001 bits (210), Expect = 1.111e-16
Identity = 70/224 (31.25%), Postives = 104/224 (46.43%), Query Frame = 3
Query: 1266 EKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKW-KCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL--KCDI-TCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQ------CMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGN-MCQCPTGFFGPECKSRIC 1901
             +ENI+  + +    K    ++C   C  +G C ++ KC C TG++G+ C      + C   G       C C+  ++G  C+ +  +C+   C   G C+    C C  GY GK C   +C   C + G+CQ+   C C +G     C K     Q      C+N G    ++ C CP  +SG  CE  +C+ +CYNG  C GN  C C  GF G +C  RIC
Sbjct:  547 REENIQFNLNT----KMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYF-QGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGE-CVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCYNG-YCSGNGTCICNEGFSGKQCGKRIC 763          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Planmine SMEST
Match: SMESG000016735.1 (SMESG000016735.1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.348e-18
Identity = 62/178 (34.83%), Postives = 81/178 (45.51%), Query Frame = 3
Query: 1344 CQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDIT------CENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCE--NHICTRCYNGGKCVGNMC 1853
            C  NG CV  +C C  GY GK C   +C   C   G C     C+C +G+E   C KL+ D        C N G+    ++C C  GY G+ CEK++C+  C   G C     C C EG  G +C K  C  +C   G CI K  C C + ++G  C   N     C N G+C  N  
Sbjct:  635 CSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCY-NGYCSGNGTCICNEGFSGKQCGKRICDSRCYKHGRCI-KGNCICRKGWNGKHCTLGNGCPKNCNNNGQCKLNHA 810          

HSP 2 Score: 85.5001 bits (210), Expect = 1.131e-16
Identity = 70/224 (31.25%), Postives = 104/224 (46.43%), Query Frame = 3
Query: 1266 EKENIKSEIRSCFIQKRCPNESCNITCQNNGQCVKW-KCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL--KCDI-TCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQ------CMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGN-MCQCPTGFFGPECKSRIC 1901
             +ENI+  + +    K    ++C   C  +G C ++ KC C TG++G+ C      + C   G       C C+  ++G  C+ +  +C+   C   G C+    C C  GY GK C   +C   C + G+CQ+   C C +G     C K     Q      C+N G    ++ C CP  +SG  CE  +C+ +CYNG  C GN  C C  GF G +C  RIC
Sbjct:  547 REENIQFNLNT----KMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYF-QGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGE-CVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCYNG-YCSGNGTCICNEGFSGKQCGKRIC 763          
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Planmine SMEST
Match: SMESG000063217.1 (SMESG000063217.1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.418e-17
Identity = 74/206 (35.92%), Postives = 100/206 (48.54%), Query Frame = 3
Query: 1380 FCPTGYQGKFCQNPICNEKCKNGGKCI----GPNICQCSEGFEGLFCE-KLKCDIT-CENGGQC---LRPNLCTCAFGYIGKFCE--KRICNPPCQKGGICQKGNI----CSCPEGTVGNRCE-KYECYPQ--CMNGGTCI----GKNKCHCPQSFSGSFCENHI-------CTRCYNGGKCVGNM----CQCPTGFFGPECKSRI 1898
            FCP      FC+N     KCKNG  C     G  +C+C+ G++G +CE K  C IT C+NGG C       +C C   ++G+FCE      + PC+ GGIC+   I    C CP+  +G  CE    C  Q  C   G CI    G+ KCHC + ++G  C N I          C NGG C+  +    C+C  GF G  C++ I
Sbjct:   14 FCPIAISLNFCEN----HKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGDTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDI 215          

HSP 2 Score: 62.003 bits (149), Expect = 1.818e-9
Identity = 82/270 (30.37%), Postives = 115/270 (42.59%), Query Frame = 3
Query: 1281 KSEIRSCFIQKRCPNESC-NITCQNNGQCVK------WKCFCPTGYQGKFCQNPI---CNEKCKNGGKC---IGPNICQCSEGFEGLFCE--KLKCDITCENGGQCLRP--NL-CTCAFGYIGKFCEKRI--CNP-PCQKGGICQK--GNI-CSCPEGTVGNRCE------KYECYPQCMN-----GGTCI-----------GKNKCHCPQSFSGSFCENHI--CTR--------CYNGGKCVGNM-----------CQCPTGFFGPECK 1889
            K+E    +  ++  NES  N  C+++G C        +KC C +GY G FC+  I    ++ C NGG+C    G   C+C  GF+G+ C+    +C     N G+C+    N  C C  G  G+FCE  +  C    CQ GGIC+   G+  C+CP+G  G  CE      KY       N      G C            G   C C + F+G +CE  I  C +        C+N G C+              C CP G+ G  CK
Sbjct:  893 KTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCK 1162          

HSP 3 Score: 58.5362 bits (140), Expect = 1.744e-8
Identity = 78/227 (34.36%), Postives = 96/227 (42.29%), Query Frame = 3
Query: 1344 CQNNGQC-----VKWKCFCPTGYQGKFCQNPICN---EKCKNGGKCIG---PNICQCSEGFEGLFCE--KLKCD-ITCENGGQCLRPN---LCTCAFGYIGKFCEKRI--CNP-PCQKGGICQK---GNICSCPEGTVGNRCE-KYECYPQ---------CMNGGTCIGKNKCHCPQSFSG-----SFCENHICTRCYNGGKCVG----NMCQCPTGFFGPECKSRI 1898
            C+NNG C       +KC C  G++GK C+  I N     C NGG CI       C C  GFEG  CE    +C+   C+N  +C+  N    C C  G  GK CE  I  C P PC  G  C+    G  C C +G VG RCE K +   Q         C+N        KC CP          S C+N +C      G+CV       C C  GF G  C+  I
Sbjct:  299 CKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCVN----GQCVDVNNEEKCICIPGFEGRTCEIEI 521          

HSP 4 Score: 57.7658 bits (138), Expect = 3.109e-8
Identity = 70/207 (33.82%), Postives = 90/207 (43.48%), Query Frame = 3
Query: 1329 SCNIT-CQNNGQCV----KWKCFCPTGYQGKFCQ--NPICNEKCKNGGKCIGPNI----CQCSEGFEGLFCE---KLKCDITCENGGQCLRPN----LCTCAFGYIGKFCEKRIC------NPPCQKGGICQK---GNICSCPEGTVGNRCEK--YECY-PQCMNGGTC---IGKNKCHCPQSFSGSFCENH--ICT--RCYNGGKC 1838
            +C IT CQN G C      + C C   + G+FC+  +   +  C+NGG C    I    CQC + + G+ CE          C   G+C+  N     C C  GY G  C   I        P C+ GG C        C C  G  G RCE    +C    C NGGTC   IG  +C CP ++ G+ CEN   +C    C NGG C
Sbjct:   61 NCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGDTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGIC 267          

HSP 5 Score: 56.9954 bits (136), Expect = 5.540e-8
Identity = 50/129 (38.76%), Postives = 61/129 (47.29%), Query Frame = 3
Query: 1569 CTCAFGYIGKFCEKRI---CNPPCQKGGICQKGN---ICSCPEGTVGNRCE--KYECYPQCMNGGTCIGK---NKCHCPQSFSGSFCENHI--CTR--CYNGGKC---VGNM-CQCPTGFFGPECKSRI 1898
            C+C  GY G FCE  I    + PC  GG C  G     C C  G  G  C+    ECY    N G CI +     C CP+  SG FCE  +  C +  C NGG C   +G+  C CP GF G  C++ I
Sbjct:  932 CSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDI 1060          

HSP 6 Score: 52.373 bits (124), Expect = 1.600e-6
Identity = 92/337 (27.30%), Postives = 127/337 (37.69%), Query Frame = 3
Query: 1323 NESCNITCQNNGQCV----KWKCFCPTGYQGKFCQ---NPICNEKCKNGGKC---IGPNICQCSEGFEGLFCEKLKCDI-------------------------TCENG------------------GQCLRPN---LCTCAFGYIGKFCEKRI---CNPPCQKGGICQK---GNICSCPEGTVGNRCE--KYEC-YPQCMNGGTCIGKN---KCHCPQSFSGSFCENHI----CTRCYNGGKCV-GN-----MCQCPTG---FFGPEC----------KSRICITGLKFRKIIKPVIVQFPVIVSNKMCIESTCTFIQPQRSVVVNKVVFKPYIDC 2060
            NE  N  CQNN +C+     + C CP G  GK C+   +      C NG +C   +G   CQC +GF GL CE  K DI                          C +G                  GQC+  N    C C  G+ G+ CE  I    N PCQ G  CQ      +C C  G  G +CE    EC +  C   G CI +    +C C   +SG  C N +       CYN   C+ GN      C C T    + G +C          ++++ + GL    +      Q    +++  CI +  +FI    S    +   KP  +C
Sbjct:  369 NECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCE-TKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCVNGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSN---SQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNC 701          

HSP 7 Score: 49.6766 bits (117), Expect = 8.522e-6
Identity = 76/277 (27.44%), Postives = 112/277 (40.43%), Query Frame = 3
Query: 1227 QKRYRPCQDDECLEK---ENIKSEIR----SCFIQKRCP---NESCNITCQNNGQCVK----WKCFCPTGYQGKFCQ---NPICNEKCKNGGKCIGPN---ICQCSEGFEGLFCEKLK--CDIT-CENGGQCLRPN--------LCTCAFGYIGKFCEKRIC---NPPCQKGGICQ---KGNICSCPEGTVGNRCE--KYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR---CYNGGKCVGNMCQCPTGFFG-------PECKSRICITG 1910
            +K    C++D C      +N+    R    + F  +RC    NE  +  C N+ +C+     ++C C +G+ GK C+   N      C   G+C+       C+C+E + G  CE LK  CD   C N G C+           LC C  G+ G  CE ++      PC   G+C+       C C    +G RCE  K E         TC    K +  + F      N IC     C+N  +  G  C C +G+ G        +C S+ CI G
Sbjct:  695 EKPLNNCRNDPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE---------TC----KSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCING 958          
The following BLAST results are available for this feature:
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VWDE4.163e-4643.94von Willebrand factor D and EGF domains [Source:HG... [more]
VWDE1.509e-3642.93von Willebrand factor D and EGF domains [Source:HG... [more]
TNC2.050e-3032.27tenascin C [Source:HGNC Symbol;Acc:HGNC:5318][more]
TNC6.799e-3031.36tenascin C [Source:HGNC Symbol;Acc:HGNC:5318][more]
TNC1.122e-2931.36tenascin C [Source:HGNC Symbol;Acc:HGNC:5318][more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apx-17.206e-2134.69Anterior pharynx in excess protein 1 [Source:UniP... [more]
crb-11.352e-1836.28Drosophila CRumBs homolog [Source:UniProtKB/TrEMB... [more]
glp-18.565e-1834.69pep chromosome:WBcel235:III:9092241:9099698:1 gene... [more]
ten-12.940e-1727.15Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-13.315e-1727.15Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shf1.291e-2728.35gene:FBgn0003390 transcript:FBtr0340089[more]
shf1.616e-2728.10gene:FBgn0003390 transcript:FBtr0340090[more]
shf6.514e-2727.14gene:FBgn0003390 transcript:FBtr0340088[more]
shf7.351e-2638.51gene:FBgn0003390 transcript:FBtr0070978[more]
Ten-m4.389e-2531.43gene:FBgn0004449 transcript:FBtr0306107[more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-30e9.73.066e-4943.35si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-54... [more]
si:ch211-246m6.51.621e-4146.07si:ch211-246m6.5 [Source:ZFIN;Acc:ZDB-GENE-050208-... [more]
si:dkey-235d18.57.445e-3338.60si:dkey-235d18.5 [Source:ZFIN;Acc:ZDB-GENE-041014-... [more]
si:dkey-30e9.71.148e-3143.95si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-54... [more]
vwde3.520e-3141.57von Willebrand factor D and EGF domains [Source:ZF... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hif1an1.978e-3037.78hypoxia inducible factor 1 subunit alpha inhibitor... [more]
hif1an2.449e-3037.78hypoxia inducible factor 1 subunit alpha inhibitor... [more]
hif1an5.625e-3040.49hypoxia inducible factor 1 subunit alpha inhibitor... [more]
tenm43.397e-2833.65teneurin transmembrane protein 4 [Source:NCBI gene... [more]
tenm43.411e-2833.65teneurin transmembrane protein 4 [Source:NCBI gene... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vwde7.918e-4843.94von Willebrand factor D and EGF domains [Source:MG... [more]
Tnxb5.271e-3331.65tenascin XB [Source:MGI Symbol;Acc:MGI:1932137][more]
Tnxb7.771e-3331.65tenascin XB [Source:MGI Symbol;Acc:MGI:1932137][more]
Tnxb1.301e-3231.65tenascin XB [Source:MGI Symbol;Acc:MGI:1932137][more]
Tnxb9.170e-3231.65tenascin XB [Source:MGI Symbol;Acc:MGI:1932137][more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N2E2|VWDE_HUMAN1.999e-4543.94von Willebrand factor D and EGF domain-containing ... [more]
sp|P24821|TENA_HUMAN9.843e-3032.27Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3[more]
sp|Q9W6F8|WIF1_XENLA1.024e-2937.78Wnt inhibitory factor 1 OS=Xenopus laevis OX=8355 ... [more]
sp|Q9W6F9|WIF1_DANRE5.734e-2936.87Wnt inhibitory factor 1 OS=Danio rerio OX=7955 GN=... [more]
sp|P22105|TENX_HUMAN1.779e-2832.14Tenascin-X OS=Homo sapiens OX=9606 GN=TNXB PE=1 SV... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9LKC82.888e-7427.86Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2B4SXK54.389e-6827.58von Willebrand factor D and EGF domain-containing ... [more]
A0A2C9LK572.871e-6727.88Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210PVU81.411e-6026.60von Willebrand factor D and EGF domain-containing ... [more]
K1P6L32.906e-5928.64von Willebrand factor D and EGF domain-containing ... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-30e9.71.079e-4542.42si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-54... [more]
si:dkey-30e9.71.107e-4542.42si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-54... [more]
si:dkey-30e9.71.222e-4143.52si:dkey-30e9.7 [Source:ZFIN;Acc:ZDB-GENE-131121-54... [more]
wif11.055e-2938.86WNT inhibitory factor 1 [Source:NCBI gene;Acc:1030... [more]
vwde1.468e-2941.10von Willebrand factor D and EGF domain-containing ... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VWDE1.555e-4945.10von Willebrand factor D and EGF domains [Source:HG... [more]
ENSPMAT00000009276.11.907e-3444.17pep scaffold:Pmarinus_7.0:GL476916:212692:218299:-... [more]
vwde2.361e-2940.36von Willebrand factor D and EGF domains [Source:ZF... [more]
ENSPMAT00000001302.11.144e-2833.00pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 ... [more]
vwde2.826e-2738.92von Willebrand factor D and EGF domains [Source:ZF... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310403.452e-2340.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285022.366e-2142.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347034.890e-1936.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330485.487e-1733.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303062.443e-1632.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VWDE6.229e-5645.63von Willebrand factor D and EGF domains [Source:NC... [more]
VWDE7.984e-4944.95von Willebrand factor D and EGF domains [Source:NC... [more]
vwde6.467e-3544.24wnt inhibitory factor 1-like [Source:NCBI gene;Acc... [more]
zmp:00000008463.644e-3335.32tenascin [Source:NCBI gene;Acc:101171095][more]
tnc3.861e-3336.32tenascin-like [Source:NCBI gene;Acc:101170815][more]
back to top
BLAST of von Willebrand factor D and EGF domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005380.10.000e+099.13SMESG000005380.1[more]
SMESG000016735.11.195e-1835.03SMESG000016735.1[more]
SMESG000016735.11.269e-1835.03SMESG000016735.1[more]
SMESG000016735.16.348e-1834.83SMESG000016735.1[more]
SMESG000063217.12.418e-1735.92SMESG000063217.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032931 ID=SMED30032931|Name=von Willebrand factor D and EGF domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2115bp
TTATGAATTCGACTCCAATCATAATTGTCATTTTTATTGTCGTTCTCAAT
TTCAGTCTCTGTTGTATAGAGTTATTGAATGCCCAATGGTCGCAAATGTC
TATCGAAGAGAGAGTAGAACGAGCTGAAATCGTTTTGGTAATTCGAGTCA
TTAAGAAGCTTCAACCGTCTTCGAAGATTATAAAATTCTATTCAGCCGAG
TGTGAAATTATTGACGTTTTAAAAGGTTGGCAAAATTTCAAGAGGAAACC
CGACGAAGAAAACGGCTGGATTACTAGGAAGAGCATAAGGATTCATGGAT
TTGGTAGTACTTTGGACTGTTTGTCAGAACCTATGGAGGATGAGATTTAT
TTATTTTTTGGAATGTTTAAAATTGACTCAAATTTGTGGGCCAGTTACTT
CACAAGCTTTGGAGCATTGGAAAATTTAAACACAGATTCTTATGAGAGAA
GTCTTTCGGTTTTAGGTCTACATCATTGGGATGCATGGTCGGTTTGTTCA
AAGAAATGCGAAACTGGAATTCAATTGAGGAAACGGAACTGCGTTCTTAT
AACAAGCTGTGACTACAGTTGGACTTACCAATATAAATTCTGCAATTGGC
AATCGTGCGATAATACAATTTTATCACACGTTGGATTATTAGAAAAAGAA
ATCATTGATATCAAAAAGACCCAAATAGCAATTATGAGAACTATTCTTAT
ATCCATTTTGTTTAAAAACCAGACCCAAATAAATTCCAAAATTAAAGACT
TTTTTTCACTGGAATTAATTGATGAAAATAGTTTAATTGTGTCTATATCA
ATAACGCATGATGCAATAATTAATATCAAATCAGGGGACGGGAATAACAG
TTCAAAGTTCTCATTGGAGAAATTACAAGCATTAAAAAATGAAGATCTTT
CTTTCAATGTTTTCATCAACGATTCTGGAATATTTGTGGAAACATTTTGT
ATATTTAGAATGTTTACGATCTATAATGAAAAAATTAGAAAGTTCTTTTC
AGGTTCAGTTCAAAAGTTACATTTAAAAGTGTCGAAAAATGTTATCATTC
GAGTGTCCACAGATTCACTAGAAACTTTTAAAAATACAGTCTGTTCCAAT
GTTTTCTATGATCACTCATCAAATGTGCTAAATGCCAGCAAAATCCAGCA
GCTGTCAATTCCATTGTCAACAGTGTCGCCGAGATCAAGTTGGTCAACGT
GTTCTGTAACTTGCGGGATTGGATGGCAAAAACGTTATCGGCCTTGTCAA
GATGATGAATGCTTAGAAAAAGAGAATATAAAATCCGAAATTAGAAGCTG
TTTCATTCAAAAACGGTGTCCTAACGAATCTTGCAATATAACCTGTCAAA
ATAATGGGCAATGTGTGAAATGGAAATGTTTTTGTCCAACCGGATATCAA
GGCAAGTTTTGTCAAAACCCAATTTGCAATGAAAAATGTAAAAATGGGGG
TAAATGTATAGGGCCAAATATTTGTCAATGTTCAGAAGGTTTTGAAGGTT
TATTTTGTGAAAAATTGAAATGCGATATTACTTGCGAAAATGGCGGACAG
TGCTTGCGTCCAAATTTATGCACTTGTGCATTTGGTTATATAGGAAAATT
CTGTGAAAAAAGGATATGCAATCCCCCATGTCAAAAGGGAGGGATTTGCC
AAAAAGGAAATATTTGTTCCTGTCCTGAAGGCACTGTTGGAAATCGGTGT
GAAAAATATGAATGCTATCCGCAATGTATGAATGGAGGAACCTGTATTGG
GAAAAACAAATGCCATTGTCCGCAATCTTTCTCTGGCTCCTTCTGTGAAA
ACCATATCTGCACTCGGTGCTACAATGGAGGGAAATGTGTCGGCAACATG
TGCCAGTGTCCTACTGGGTTCTTTGGGCCAGAATGTAAGTCGAGAATCTG
TATTACAGGATTAAAATTTCGGAAAATAATCAAGCCGGTAATCGTCCAAT
TCCCAGTTATAGTAAGCAACAAAATGTGCATTGAATCGACTTGCACATTC
ATTCAACCTCAACGATCAGTTGTTGTGAACAAAGTTGTCTTTAAACCGTA
CATTGACTGTCTCTGATTCGAAGTCAAGCCACTATTACCATTTATCCAAG
ACCATATTTACTGTG
back to top

protein sequence of SMED30032931-orf-1

>SMED30032931-orf-1 ID=SMED30032931-orf-1|Name=SMED30032931-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=688bp
MNSTPIIIVIFIVVLNFSLCCIELLNAQWSQMSIEERVERAEIVLVIRVI
KKLQPSSKIIKFYSAECEIIDVLKGWQNFKRKPDEENGWITRKSIRIHGF
GSTLDCLSEPMEDEIYLFFGMFKIDSNLWASYFTSFGALENLNTDSYERS
LSVLGLHHWDAWSVCSKKCETGIQLRKRNCVLITSCDYSWTYQYKFCNWQ
SCDNTILSHVGLLEKEIIDIKKTQIAIMRTILISILFKNQTQINSKIKDF
FSLELIDENSLIVSISITHDAIINIKSGDGNNSSKFSLEKLQALKNEDLS
FNVFINDSGIFVETFCIFRMFTIYNEKIRKFFSGSVQKLHLKVSKNVIIR
VSTDSLETFKNTVCSNVFYDHSSNVLNASKIQQLSIPLSTVSPRSSWSTC
SVTCGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQN
NGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGL
FCEKLKCDITCENGGQCLRPNLCTCAFGYIGKFCEKRICNPPCQKGGICQ
KGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCEN
HICTRCYNGGKCVGNMCQCPTGFFGPECKSRICITGLKFRKIIKPVIVQF
PVIVSNKMCIESTCTFIQPQRSVVVNKVVFKPYIDCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0045202synapse
GO:0005886plasma membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR000742EGF-like_dom
IPR000884TSP1_rpt
IPR013032EGF-like_CS
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0043236laminin binding
Vocabulary: biological process
TermDefinition
GO:0007213G-protein coupled acetylcholine receptor signaling pathway
GO:0043113receptor clustering
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 156..203
e-value: 2.8E-7
score: 40.2
coord: 391..440
e-value: 1.0E-8
score: 45.0
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 158..183
e-value: 0.0015
score: 18.7
coord: 392..439
e-value: 1.8E-5
score: 24.8
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 388..440
score: 10.214
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 154..203
score: 9.001
IPR000742EGF-like domainSMARTSM00181egf_5coord: 506..535
e-value: 0.25
score: 20.4
coord: 443..471
e-value: 0.0025
score: 27.1
coord: 602..629
e-value: 53.0
score: 7.7
coord: 538..567
e-value: 0.0053
score: 26.0
coord: 570..599
e-value: 0.0089
score: 25.2
coord: 474..503
e-value: 0.13
score: 21.4
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 471..503
score: 12.447
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 567..599
score: 13.57
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 504..535
score: 9.188
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 439..503
e-value: 2.2E-15
score: 58.6
coord: 570..629
e-value: 1.5E-10
score: 43.1
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 539..569
e-value: 4.6E-5
score: 25.1
coord: 507..537
e-value: 4.1E-6
score: 28.5
NoneNo IPR availablePANTHERPTHR14949EGF-LIKE-DOMAIN, MULTIPLE 7, 8coord: 414..502
coord: 459..642
NoneNo IPR availablePANTHERPTHR14949:SF30VON WILLEBRAND FACTOR D AND EGF DOMAIN-CONTAINING PROTEINcoord: 414..502
coord: 459..642
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..27
score: 0.501
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 140..209
e-value: 2.1E-6
score: 29.3
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 388..438
e-value: 1.7E-6
score: 30.1
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 156..202
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 391..434
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 491..502
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 587..598
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 491..502
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 34..119