Alkaline phosphatase

Overview
NameAlkaline phosphatase
Smed IDSMED30032915
Length (bp)1677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alkaline phosphatase (SMED30032915) t-SNE clustered cells

Violin plots show distribution of expression levels for Alkaline phosphatase (SMED30032915) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alkaline phosphatase (SMED30032915) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alkaline phosphatase (SMED30032915) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032915

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30032915SMESG000061191.1 dd_Smed_v4_8942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30032915SMESG000061191.1 dd_Smed_v4_8942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032915SMESG000061191.1 dd_Smed_v4_8942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032915SMESG000061191.1 dd_Smed_v4_8942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032915SMESG000061191.1 dd_Smed_v6_8942_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30032915SMESG000061191.1 dd_Smed_v4_8942_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alkaline phosphatase vs. Ensembl Human
Match: ALPL (alkaline phosphatase, biomineralization associated [Source:HGNC Symbol;Acc:HGNC:438])

HSP 1 Score: 199.519 bits (506), Expect = 3.221e-57
Identity = 102/213 (47.89%), Postives = 143/213 (67.14%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQIL---DKKGFTSLLYGTGPGYKV---PRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            GLFE  +M+YE  R +  DP+L +M V AI IL +NPKG+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  ++S +DTL V+TADHSH FT G Y  R   I G     +  +L   DKK FT++LYG GPGYKV    REN++    + NN+  +    S VPL   THGGE+V+V+++GP  H+L  ++EQ+Y+ HVM YA+CIG
Sbjct:  211 GLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFG-----LAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQ----SAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIG 414          

HSP 2 Score: 107.071 bits (266), Expect = 3.856e-24
Identity = 67/214 (31.31%), Postives = 108/214 (50.47%), Query Frame = 3
Query:  423 TYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLNEIT 1040
            TY+ +  V DSA TATA L G+K N G +G+ A+ +   C+  T++  ++  I     + GKS+G VTTT +  ATP++ YA +  R W     +P        +DIA Q +       V++GGGR    P N+ D EY       G R DG +L+  W S    ++K  + F++N +E  +++   + YL G     +     Q+++  N +T
Sbjct:   23 TYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN--TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKS-FKPRYK-HSHFIWNRTELLTLDPHNVDYLLGLFEPGD----MQYELNRNNVT 228          
BLAST of Alkaline phosphatase vs. Ensembl Human
Match: ALPL (alkaline phosphatase, biomineralization associated [Source:HGNC Symbol;Acc:HGNC:438])

HSP 1 Score: 199.519 bits (506), Expect = 5.003e-57
Identity = 102/214 (47.66%), Postives = 143/214 (66.82%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQIL---DKKGFTSLLYGTGPGYKV---PRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGT 1624
            GLFE  +M+YE  R +  DP+L +M V AI IL +NPKG+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  ++S +DTL V+TADHSH FT G Y  R   I G     +  +L   DKK FT++LYG GPGYKV    REN++    + NN+  +    S VPL   THGGE+V+V+++GP  H+L  ++EQ+Y+ HVM YA+CIG 
Sbjct:  233 GLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFG-----LAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQ----SAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGA 437          

HSP 2 Score: 147.517 bits (371), Expect = 4.411e-38
Identity = 89/259 (34.36%), Postives = 137/259 (52.90%), Query Frame = 3
Query:  288 LVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLNEIT 1040
            + +GDGMG+ST+T+ARI K Q   HN   +  L  + FP V LSKTY+ +  V DSA TATA L G+K N G +G+ A+ +   C+  T++  ++  I     + GKS+G VTTT +  ATP++ YA +  R W     +P        +DIA Q +       V++GGGR    P N+ D EY       G R DG +L+  W S    ++K  + F++N +E  +++   + YL G     +     Q+++  N +T
Sbjct:    1 MFLGDGMGVSTVTAARILKGQLH-HNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN--TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKS-FKPRYK-HSHFIWNRTELLTLDPHNVDYLLGLFEPGD----MQYELNRNNVT 250          
BLAST of Alkaline phosphatase vs. Ensembl Human
Match: ALPL (alkaline phosphatase, biomineralization associated [Source:HGNC Symbol;Acc:HGNC:438])

HSP 1 Score: 199.904 bits (507), Expect = 1.412e-56
Identity = 102/213 (47.89%), Postives = 143/213 (67.14%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQIL---DKKGFTSLLYGTGPGYKV---PRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            GLFE  +M+YE  R +  DP+L +M V AI IL +NPKG+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  ++S +DTL V+TADHSH FT G Y  R   I G     +  +L   DKK FT++LYG GPGYKV    REN++    + NN+  +    S VPL   THGGE+V+V+++GP  H+L  ++EQ+Y+ HVM YA+CIG
Sbjct:  288 GLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFG-----LAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQ----SAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIG 491          

HSP 2 Score: 166.007 bits (419), Expect = 2.702e-44
Identity = 107/318 (33.65%), Postives = 164/318 (51.57%), Query Frame = 3
Query:  114 MIYFAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLNEIT 1040
            MI    ++AI      S+    V   EK  +YW    Q+ L   L  + + +N AKN+I+ +GDGMG+ST+T+ARI K Q   HN   +  L  + FP V LSKTY+ +  V DSA TATA L G+K N G +G+ A+ +   C+  T++  ++  I     + GKS+G VTTT +  ATP++ YA +  R W     +P        +DIA Q +       V++GGGR    P N+ D EY       G R DG +L+  W S    ++K  + F++N +E  +++   + YL G     +     Q+++  N +T
Sbjct:    1 MISPFLVLAIGTCLTNSL----VPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLH-HNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN--TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKS-FKPRYK-HSHFIWNRTELLTLDPHNVDYLLGLFEPGD----MQYELNRNNVT 305          
BLAST of Alkaline phosphatase vs. Ensembl Human
Match: ALPL (alkaline phosphatase, biomineralization associated [Source:HGNC Symbol;Acc:HGNC:438])

HSP 1 Score: 199.904 bits (507), Expect = 1.412e-56
Identity = 102/213 (47.89%), Postives = 143/213 (67.14%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQIL---DKKGFTSLLYGTGPGYKV---PRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            GLFE  +M+YE  R +  DP+L +M V AI IL +NPKG+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  ++S +DTL V+TADHSH FT G Y  R   I G     +  +L   DKK FT++LYG GPGYKV    REN++    + NN+  +    S VPL   THGGE+V+V+++GP  H+L  ++EQ+Y+ HVM YA+CIG
Sbjct:  288 GLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFG-----LAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQ----SAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIG 491          

HSP 2 Score: 166.007 bits (419), Expect = 2.702e-44
Identity = 107/318 (33.65%), Postives = 164/318 (51.57%), Query Frame = 3
Query:  114 MIYFAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLNEIT 1040
            MI    ++AI      S+    V   EK  +YW    Q+ L   L  + + +N AKN+I+ +GDGMG+ST+T+ARI K Q   HN   +  L  + FP V LSKTY+ +  V DSA TATA L G+K N G +G+ A+ +   C+  T++  ++  I     + GKS+G VTTT +  ATP++ YA +  R W     +P        +DIA Q +       V++GGGR    P N+ D EY       G R DG +L+  W S    ++K  + F++N +E  +++   + YL G     +     Q+++  N +T
Sbjct:    1 MISPFLVLAIGTCLTNSL----VPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLH-HNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN--TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKS-FKPRYK-HSHFIWNRTELLTLDPHNVDYLLGLFEPGD----MQYELNRNNVT 305          
BLAST of Alkaline phosphatase vs. Ensembl Human
Match: ALPP (alkaline phosphatase, placental [Source:HGNC Symbol;Acc:HGNC:439])

HSP 1 Score: 197.978 bits (502), Expect = 8.791e-56
Identity = 97/219 (44.29%), Postives = 143/219 (65.30%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLS 1654
            + GLFE  +MKYE  R  T DP+L +MT  A+ +LSRNP+G+FL +EGG++D  HHE++A RA+ ET+  + A+  A +++SE+DTL ++TADHSH F+ G Y  R + I G      G+  D+K +T LLYG GPGY +    R ++T S + + E    S VPL   TH GE+V+V+ARGP  H++  + EQ++I HVM +A+C+  Y     C+L+
Sbjct:  287 LMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAP---GKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY---TACDLA 499          

HSP 2 Score: 180.259 bits (456), Expect = 2.479e-49
Identity = 111/308 (36.04%), Postives = 170/308 (55.19%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKL-PDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYP---GKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQK-IKYLFGYLLTSNYKNLFQFKVYLNEIT*NMKMKEQMIRLWNR 1085
            E+  ++W +   + L +    +P  + AKN+I+ +GDGMG+ST+T+ARI K Q++  +KL P+  L  + FP V LSKTY+VDK+V DS ATATA L G+K N   +G+ A+ +F  C+  T++  +++ +       GKS+G VTTT +  A+PA  YA T  R+W     VP +      +DIA+Q +   +I  V+LGGGR         DPEYP    + G R DG+NL+ EW +K  G     A++V+N +E    +    + +L G     + K        L+     M+M E  +RL +R
Sbjct:   28 EENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKK--DKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCN--TTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDI-DVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQG-----ARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSL--MEMTEAALRLLSR 323          
BLAST of Alkaline phosphatase vs. Ensembl Fly
Match: Alp1 (gene:FBgn0283479 transcript:FBtr0078396)

HSP 1 Score: 180.259 bits (456), Expect = 1.453e-86
Identity = 95/232 (40.95%), Postives = 138/232 (59.48%), Query Frame = 2
Query: 1019 GLFERDNMKYE-DERTDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYK---------VPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG---TYNDRVGCNLSTIVTYFP 1675
            GLF   ++ Y  D+  D PTL +MT  AIN+LSR+P GYFL +EGG++D AHHE KA +A+ ET++   AV  A ++++  DTLIV++ADH HT T+  Y + N  I+G N       +D+  +TS+ Y  GP Y+         V R ++ + +    + +Y  GVP+   THGG +V+VYA GPW H+   +YEQS + H+M +ASC+G   TY     C+L     Y P
Sbjct:  299 GLFNASHLAYHMDDSIDTPTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHAHHETKAKKALDETVQFSDAVRKARQLTNPWDTLIVVSADHGHTVTISGYPDVNNSIVGLNSELSN--VDQLPYTSISYANGPAYERFYKSTDGVVERVDLRNLDFSKPDAIYPHGVPMTEETHGGGDVAVYAHGPWSHLFTGVYEQSTLPHLMGFASCLGPGITY-----CDLQPKARYSP 523          

HSP 2 Score: 160.229 bits (404), Expect = 1.453e-86
Identity = 104/278 (37.41%), Postives = 147/278 (52.88%), Query Frame = 3
Query:  195 KTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWK--YRV------PKNCAVEDIASQFLKKS--EIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSN 995
            K+ E+W  + Q+ LY+KL+  P    AKN+I  +GDGM + T+T+ RIF  Q  +   + + N L FE F  VGLSKTY V+K VADSA TA+A L+GIK N   +G+ A V+  +C      +  L  I+       KS G VTTT +  A+PA +YA T  R ++  Y V      P NC   DIA Q +     +  +VV+GGG   F+PN   D    G  G R D RNL+ EW     G     A+ V++ ++  + + Q   +L G    S+
Sbjct:   38 KSKEFWFHDAQRTLYNKLSTPPNQYRAKNVIFFLGDGMSVPTVTAGRIFDGQ--LRGVVGERNRLEFEKFNYVGLSKTYCVNKQVADSACTASAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSSIAAWALKGSKSAGLVTTTRVTHASPAGVYAHTSNRDFESDYDVTKLGQNPGNCP--DIAQQLIDGDVGKRLRVVMGGGTIKFLPNTTND--VFGNKGQRLDNRNLIEEWQQTKPG----NARVVFSRTDLLNNDAQNTDFLLGLFNASH 305          
BLAST of Alkaline phosphatase vs. Ensembl Fly
Match: Alp1 (gene:FBgn0283479 transcript:FBtr0331821)

HSP 1 Score: 173.711 bits (439), Expect = 9.790e-85
Identity = 95/239 (39.75%), Postives = 139/239 (58.16%), Query Frame = 2
Query: 1019 GLFERDNMKYE-DERTDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYK---------VPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYA-------RGPWGHMLKDIYEQSYIGHVMMYASCIG---TYNDRVGCNLSTIVTYFP 1675
            GLF   ++ Y  D+  D PTL +MT  AIN+LSR+P GYFL +EGG++D AHHE KA +A+ ET++   AV  A ++++  DTLIV++ADH HT T+  Y + N  I+G N       +D+  +TS+ Y  GP Y+         V R ++ + +    + +Y  GVP+   THGG +V+VYA       +GPW H+   +YEQS + H+M +ASC+G   TY     C+L     Y P
Sbjct:  299 GLFNASHLAYHMDDSIDTPTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHAHHETKAKKALDETVQFSDAVRKARQLTNPWDTLIVVSADHGHTVTISGYPDVNNSIVGLNSELSN--VDQLPYTSISYANGPAYERFYKSTDGVVERVDLRNLDFSKPDAIYPHGVPMTEETHGGGDVAVYAHVVEYLLQGPWSHLFTGVYEQSTLPHLMGFASCLGPGITY-----CDLQPKARYSP 530          

HSP 2 Score: 160.614 bits (405), Expect = 9.790e-85
Identity = 104/278 (37.41%), Postives = 147/278 (52.88%), Query Frame = 3
Query:  195 KTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWK--YRV------PKNCAVEDIASQFLKKS--EIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSN 995
            K+ E+W  + Q+ LY+KL+  P    AKN+I  +GDGM + T+T+ RIF  Q  +   + + N L FE F  VGLSKTY V+K VADSA TA+A L+GIK N   +G+ A V+  +C      +  L  I+       KS G VTTT +  A+PA +YA T  R ++  Y V      P NC   DIA Q +     +  +VV+GGG   F+PN   D    G  G R D RNL+ EW     G     A+ V++ ++  + + Q   +L G    S+
Sbjct:   38 KSKEFWFHDAQRTLYNKLSTPPNQYRAKNVIFFLGDGMSVPTVTAGRIFDGQ--LRGVVGERNRLEFEKFNYVGLSKTYCVNKQVADSACTASAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSSIAAWALKGSKSAGLVTTTRVTHASPAGVYAHTSNRDFESDYDVTKLGQNPGNCP--DIAQQLIDGDVGKRLRVVMGGGTIKFLPNTTND--VFGNKGQRLDNRNLIEEWQQTKPG----NARVVFSRTDLLNNDAQNTDFLLGLFNASH 305          
BLAST of Alkaline phosphatase vs. Ensembl Fly
Match: Alp9 (gene:FBgn0035620 transcript:FBtr0077086)

HSP 1 Score: 164.466 bits (415), Expect = 8.675e-80
Identity = 89/218 (40.83%), Postives = 132/218 (60.55%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTDDP-----TLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGY----------KVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            + GLF + +M Y  E+  DP     TLE+MT KAI +L    +GYFL +EGGK+D +HHE  A  A+ ET EL KAV  A +M++ ++TLIV+T+DHSHTF++  Y  R +DI G  +   G+  D K + +L Y  G  +          +V   ++ +  +F  + L+ + VPL   THGGE+V V+A GPW H+   +YEQ+ I H+M +A+C+G
Sbjct:  298 LLGLFSKSHMHYHLEQLADPDNNEPTLEEMTQKAIEVLETEEQGYFLFVEGGKIDISHHETMARIALDETAELSKAVKKAREMTNPEETLIVVTSDHSHTFSVSGYQPRGSDIFGAAKAN-GK--DGKPYLALSYANGKSFQDYYNTETHERVDPTSLPTIGDF--DQLFPAMVPLESETHGGEDVGVFASGPWAHLFTGVYEQNTIPHMMAFAACVG 510          

HSP 2 Score: 153.68 bits (387), Expect = 8.675e-80
Identity = 97/280 (34.64%), Postives = 150/280 (53.57%), Query Frame = 3
Query:  186 SIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYR--VPKNC-----AVEDIASQFLKKSEI---FQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSN 995
            S E+T E+W    +K +  KL     T  AKNIIL +GDGMG++TL +AR +    ++        L FE FP  GLSKTYSVDK V DSA T+T+ L G+K N G +G++A V+  +C++  ++   +  + +   + GK+ G VTTT +  A+P+ +YA    R W+    + + C      ++DIA Q +   E+    +V+LGGG+ +F     + PE+  K G R DGRNL+ E+ +   G       FV    +  ++N  +   L G    S+
Sbjct:   46 SGEETQEFWHSASKKLIREKLEFVRNTKKAKNIILFLGDGMGLATLAAARSYIGGEEL-------KLSFEEFPFTGLSKTYSVDKIVPDSACTSTSYLCGVKANYGTIGVNAHVKRGDCAAMANETNHVFSLGKWAMDAGKAAGLVTTTRVTHASPSGVYAHVADREWENNAVLEEACGELSDGLQDIAVQLI-HGEVGSKLKVMLGGGKRSF-----YSPEHYDK-GRRTDGRNLVEEFEALDAGN-----TFVKTQKKLLNVNATETGRLLGLFSKSH 306          
BLAST of Alkaline phosphatase vs. Ensembl Fly
Match: Alp9 (gene:FBgn0035620 transcript:FBtr0345902)

HSP 1 Score: 164.466 bits (415), Expect = 8.675e-80
Identity = 89/218 (40.83%), Postives = 132/218 (60.55%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTDDP-----TLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGY----------KVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            + GLF + +M Y  E+  DP     TLE+MT KAI +L    +GYFL +EGGK+D +HHE  A  A+ ET EL KAV  A +M++ ++TLIV+T+DHSHTF++  Y  R +DI G  +   G+  D K + +L Y  G  +          +V   ++ +  +F  + L+ + VPL   THGGE+V V+A GPW H+   +YEQ+ I H+M +A+C+G
Sbjct:  298 LLGLFSKSHMHYHLEQLADPDNNEPTLEEMTQKAIEVLETEEQGYFLFVEGGKIDISHHETMARIALDETAELSKAVKKAREMTNPEETLIVVTSDHSHTFSVSGYQPRGSDIFGAAKAN-GK--DGKPYLALSYANGKSFQDYYNTETHERVDPTSLPTIGDF--DQLFPAMVPLESETHGGEDVGVFASGPWAHLFTGVYEQNTIPHMMAFAACVG 510          

HSP 2 Score: 153.68 bits (387), Expect = 8.675e-80
Identity = 97/280 (34.64%), Postives = 150/280 (53.57%), Query Frame = 3
Query:  186 SIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYR--VPKNC-----AVEDIASQFLKKSEI---FQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSN 995
            S E+T E+W    +K +  KL     T  AKNIIL +GDGMG++TL +AR +    ++        L FE FP  GLSKTYSVDK V DSA T+T+ L G+K N G +G++A V+  +C++  ++   +  + +   + GK+ G VTTT +  A+P+ +YA    R W+    + + C      ++DIA Q +   E+    +V+LGGG+ +F     + PE+  K G R DGRNL+ E+ +   G       FV    +  ++N  +   L G    S+
Sbjct:   46 SGEETQEFWHSASKKLIREKLEFVRNTKKAKNIILFLGDGMGLATLAAARSYIGGEEL-------KLSFEEFPFTGLSKTYSVDKIVPDSACTSTSYLCGVKANYGTIGVNAHVKRGDCAAMANETNHVFSLGKWAMDAGKAAGLVTTTRVTHASPSGVYAHVADREWENNAVLEEACGELSDGLQDIAVQLI-HGEVGSKLKVMLGGGKRSF-----YSPEHYDK-GRRTDGRNLVEEFEALDAGN-----TFVKTQKKLLNVNATETGRLLGLFSKSH 306          
BLAST of Alkaline phosphatase vs. Ensembl Fly
Match: Alp6 (gene:FBgn0033423 transcript:FBtr0088520)

HSP 1 Score: 171.4 bits (433), Expect = 1.041e-79
Identity = 107/289 (37.02%), Postives = 161/289 (55.71%), Query Frame = 3
Query:  150 FEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEK--PITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPD--ENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWK--YRVP-KNCAVE---DIASQFLKK--SEIFQVVLGGGRSNFIPNNEFDPE-YPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            F+ +S  +K     E+ ++YW+   Q +L SKL E+    T+ AKN+IL +GDGM + T+T+ R         N L D  E ++FE FP  GLSKTY V++ VADSA TATA L G+K N G +G++A+V   +C    +++  +L I+      GK  G VTT  +  A+PA +YA    R+W+  + V  + C  E   DIA Q +++   +  +V+LGGGR NFI     D E YPGK   R DGR+L+  W  +   +    AK+V++    + ++ +   YL G
Sbjct:   31 FDAESHPIKYAE--EQQTQYWVDKAQAKLLSKLAEQESATTNKAKNVILFLGDGMSVHTVTATR---------NLLGDSAEQVYFEGFPYTGLSKTYCVNRQVADSACTATAYLGGVKANYGTIGVNANVSRYSCDGAANEEDRVLSIAHWAQAAGKDAGLVTTARVTHASPAGVYAHIADRNWENDWEVANRECDPEQTIDIARQLVEQPVGQQLKVILGGGRKNFIDATVNDEEGYPGK---RTDGRHLIRSWLDQKK-EANVSAKYVWSRKGLSLVDLENTDYLLG 304          

HSP 2 Score: 145.976 bits (367), Expect = 1.041e-79
Identity = 83/220 (37.73%), Postives = 124/220 (56.36%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD------DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKK-GFTSLLYGTGPGY----------KVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTY 1627
            GLF  D++ Y  +R        DP+L ++T  AI +LSRN KG+FL +EG ++D AHH+  A R++ +T E  +AV  A +++SE DTLIV+TADH+H  ++  Y  R+ +I G     + Q+ D    +T L Y  GPGY           + +E + + +++   TL     PL   THGG++V+VYA GP+       YEQS I  +M  A+ IG Y
Sbjct:  304 GLFANDHLPYNGDRDRKRSQLADPSLSELTEAAITVLSRNDKGFFLFVEGARIDMAHHDTFAKRSLEDTAEFARAVQKARELTSEDDTLIVVTADHAHVMSINGYPYRDQEITG-----LAQLADDNLPYTILSYANGPGYYSGYNRAEGRALLKEKLVADSDYQYPTL----APLDAETHGGDDVAVYASGPYAQYFSGNYEQSNIPALMARAAGIGPY 514          
BLAST of Alkaline phosphatase vs. Ensembl Zebrafish
Match: alpi.2 (alkaline phosphatase, intestinal, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-142])

HSP 1 Score: 184.882 bits (468), Expect = 3.020e-93
Identity = 108/270 (40.00%), Postives = 154/270 (57.04%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            EK   +W    +  L++ L+    T  AKN+IL +GDGMGIST+T+AR+ K Q  ++ K  +E+ L  + FP + LSKTY+VD+ + DSAATATA L G+K N G LG+ A+ Q   CSS   K  ++  I       GKS+G V+T  +  A+PA+ Y+ TP R W          V   C  +DIA Q +  ++I  V+LGGGR    P    DPEY    G+R+D RNL+ EW      K +  A++V+N  +F+++N  K  YL G
Sbjct:   37 EKNPNFWYVKAKDSLHASLSMTFNTHRAKNLILFLGDGMGISTVTAARVLKGQ--MNKKTGEESVLAMDTFPYLALSKTYNVDQQMPDSAATATAYLCGVKANYGTLGLSAAAQREVCSSV--KGNEVKSILHQAKMAGKSVGIVSTARVQHASPAASYSHTPERGWYSDKELTSEAVAGGC--QDIAVQLITNTDI-NVILGGGRQYMFPRETTDPEYSTVTGSRKDKRNLVDEWL-----KNRKNAQYVWNKQQFDAVNEDKTDYLMG 294          

HSP 2 Score: 178.333 bits (451), Expect = 3.020e-93
Identity = 93/227 (40.97%), Postives = 137/227 (60.35%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL--STIVTYF 1672
            + GLFE  + +YE ER    DP+L +M  KAI IL +NP G++L +EGG++D  HH  +A  A+ E +E + ++  A +++SE DTL V+TADHSH F+ G Y  R   +LG +     +  D K FT+ LYG GPGY++    R ++  S +   + L  + VPL   THG E+V+++A+GP  H+   + EQSYI H M +A+CI  Y+D   C L  S + T F
Sbjct:  292 LMGLFEPKDTRYELERDPKMDPSLTEMVEKAIKILRKNPNGFYLFVEGGRIDHGHHAGQAKYALTEAVEFDNSIERAGQLTSELDTLSVVTADHSHVFSFGGYSYRGNPVLGVS---YAKGEDGKSFTNALYGNGPGYQITNGTRPDVNESVSGRDDYLQQAAVPLDSETHGSEDVAIFAKGPMAHLFHGVQEQSYIPHAMAFAACIEPYSD---CQLHDSGVYTQF 512          
BLAST of Alkaline phosphatase vs. Ensembl Zebrafish
Match: alpl (alkaline phosphatase, biomineralization associated [Source:ZFIN;Acc:ZDB-GENE-040420-1])

HSP 1 Score: 188.734 bits (478), Expect = 3.747e-93
Identity = 98/223 (43.95%), Postives = 140/223 (62.78%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERT--DDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLSTIVTYF 1672
            GLFE  ++ YE ER   +DP+L +M   AI IL +N +G+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  ++SE DTL V+TADHSH F+ G Y  R   I G         +D+K FT++LYG GPG+K+    REN+++ +         S VPL   THGGE+V+++++GP  H+L  + EQ YI HVM YA+CIG   D    N S   +YF
Sbjct:  324 GLFEPADLNYELERNTENDPSLTEMVDVAIKILKKNERGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAITRAGLLTSEYDTLTVVTADHSHVFSFGGYTPRGNSIFGLAPTLSD--VDQKPFTAILYGNGPGFKLVNGARENVSTVDYQQNNYQAQSAVPLRMETHGGEDVAIFSKGPMAHLLHGVQEQHYIPHVMAYAACIGQNKDHCRTN-SGSSSYF 543          

HSP 2 Score: 174.096 bits (440), Expect = 3.747e-93
Identity = 103/271 (38.01%), Postives = 148/271 (54.61%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPG---KVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            EK  +YW    Q+ L   L  + +  N AKNIIL +GDGMG+ T+T+ARI K Q    N   +  L  + FP+V LSKTY+ +  V DSA TATA L G+K N G +G+ A+     C+  T++  ++  I +   + GKS+G VTTT +  ATP++ YA    R W     +P        +DIA Q  +      V++GGGR +  P N  D EYPG   + G R+DGRNL+ EW  ++  K   +  +V+N  +  S+N   + YL G
Sbjct:   60 EKRPDYWRDFAQRSLKDALKLQELNKNIAKNIILFLGDGMGVPTVTAARILKGQLSGQNG-EETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAFLCGVKANEGTVGVSAAAVRSQCN--TTQGNEVTSILKWAKDAGKSVGIVTTTRVNHATPSAAYAHCVDRDWYSDADMPNEALQSGCKDIARQLFENIPDINVIMGGGRRSMYPKNTPDVEYPGDKKQNGTRKDGRNLVGEWIDRVKEK---RGFYVWNKKDLLSLNPNNVDYLLG 324          
BLAST of Alkaline phosphatase vs. Ensembl Zebrafish
Match: alpi.2 (alkaline phosphatase, intestinal, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-142])

HSP 1 Score: 184.496 bits (467), Expect = 3.940e-93
Identity = 108/270 (40.00%), Postives = 154/270 (57.04%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            EK   +W    +  L++ L+    T  AKN+IL +GDGMGIST+T+AR+ K Q  ++ K  +E+ L  + FP + LSKTY+VD+ + DSAATATA L G+K N G LG+ A+ Q   CSS   K  ++  I       GKS+G V+T  +  A+PA+ Y+ TP R W          V   C  +DIA Q +  ++I  V+LGGGR    P    DPEY    G+R+D RNL+ EW      K +  A++V+N  +F+++N  K  YL G
Sbjct:   29 EKNPNFWYVKAKDSLHASLSMTFNTHRAKNLILFLGDGMGISTVTAARVLKGQ--MNKKTGEESVLAMDTFPYLALSKTYNVDQQMPDSAATATAYLCGVKANYGTLGLSAAAQREVCSSV--KGNEVKSILHQAKMAGKSVGIVSTARVQHASPAASYSHTPERGWYSDKELTSEAVAGGC--QDIAVQLITNTDI-NVILGGGRQYMFPRETTDPEYSTVTGSRKDKRNLVDEWL-----KNRKNAQYVWNKQQFDAVNEDKTDYLMG 286          

HSP 2 Score: 178.333 bits (451), Expect = 3.940e-93
Identity = 93/227 (40.97%), Postives = 137/227 (60.35%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL--STIVTYF 1672
            + GLFE  + +YE ER    DP+L +M  KAI IL +NP G++L +EGG++D  HH  +A  A+ E +E + ++  A +++SE DTL V+TADHSH F+ G Y  R   +LG +     +  D K FT+ LYG GPGY++    R ++  S +   + L  + VPL   THG E+V+++A+GP  H+   + EQSYI H M +A+CI  Y+D   C L  S + T F
Sbjct:  284 LMGLFEPKDTRYELERDPKMDPSLTEMVEKAIKILRKNPNGFYLFVEGGRIDHGHHAGQAKYALTEAVEFDNSIERAGQLTSELDTLSVVTADHSHVFSFGGYSYRGNPVLGVS---YAKGEDGKSFTNALYGNGPGYQITNGTRPDVNESVSGRDDYLQQAAVPLDSETHGSEDVAIFAKGPMAHLFHGVQEQSYIPHAMAFAACIEPYSD---CQLHDSGVYTQF 504          
BLAST of Alkaline phosphatase vs. Ensembl Zebrafish
Match: alpi.2 (alkaline phosphatase, intestinal, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-142])

HSP 1 Score: 184.496 bits (467), Expect = 4.875e-91
Identity = 108/270 (40.00%), Postives = 154/270 (57.04%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            EK   +W    +  L++ L+    T  AKN+IL +GDGMGIST+T+AR+ K Q  ++ K  +E+ L  + FP + LSKTY+VD+ + DSAATATA L G+K N G LG+ A+ Q   CSS   K  ++  I       GKS+G V+T  +  A+PA+ Y+ TP R W          V   C  +DIA Q +  ++I  V+LGGGR    P    DPEY    G+R+D RNL+ EW      K +  A++V+N  +F+++N  K  YL G
Sbjct:   37 EKNPNFWYVKAKDSLHASLSMTFNTHRAKNLILFLGDGMGISTVTAARVLKGQ--MNKKTGEESVLAMDTFPYLALSKTYNVDQQMPDSAATATAYLCGVKANYGTLGLSAAAQREVCSSV--KGNEVKSILHQAKMAGKSVGIVSTARVQHASPAASYSHTPERGWYSDKELTSEAVAGGC--QDIAVQLITNTDI-NVILGGGRQYMFPRETTDPEYSTVTGSRKDKRNLVDEWL-----KNRKNAQYVWNKQQFDAVNEDKTDYLMG 294          

HSP 2 Score: 171.014 bits (432), Expect = 4.875e-91
Identity = 92/228 (40.35%), Postives = 136/228 (59.65%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIE-GGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL--STIVTYF 1672
            + GLFE  + +YE ER    DP+L +M  KAI IL +NP G++L +E  G++D  HH  +A  A+ E +E + ++  A +++SE DTL V+TADHSH F+ G Y  R   +LG +     +  D K FT+ LYG GPGY++    R ++  S +   + L  + VPL   THG E+V+++A+GP  H+   + EQSYI H M +A+CI  Y+D   C L  S + T F
Sbjct:  292 LMGLFEPKDTRYELERDPKMDPSLTEMVEKAIKILRKNPNGFYLFVEDNGRIDHGHHAGQAKYALTEAVEFDNSIERAGQLTSELDTLSVVTADHSHVFSFGGYSYRGNPVLGVS---YAKGEDGKSFTNALYGNGPGYQITNGTRPDVNESVSGRDDYLQQAAVPLDSETHGSEDVAIFAKGPMAHLFHGVQEQSYIPHAMAFAACIEPYSD---CQLHDSGVYTQF 513          
BLAST of Alkaline phosphatase vs. Ensembl Zebrafish
Match: alp3 (alkaline phosphatase 3 [Source:ZFIN;Acc:ZDB-GENE-120919-1])

HSP 1 Score: 196.823 bits (499), Expect = 1.283e-55
Identity = 116/302 (38.41%), Postives = 176/302 (58.28%), Query Frame = 3
Query:  123 FAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLF-FENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE---DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKV---GNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYK 1001
            FA  +++  F    + + + S  E+  E+W K+ Q  L S L+ K  T+ AKNI+L +GDGMG++T+T+ARI K Q Q H+   +E +   + FPNVGL+K YSVD  + DSAATATA L G+KTN   +G+ A+ +   C S   K  ++  I     + GKS+G VTTT +  ATPA+ +A + +R+W     +P + A E   DIA+Q L   +I  V++GGGR    P    DPEYP      G R+DGRNL+ +W     GK    A++V+N ++F++++ +K  YL      ++ +
Sbjct:    2 FAVRVSVVCF---LLTITSGSVEEENPEFWRKSAQNTLRSALSRKINTNVAKNIVLFLGDGMGVTTITAARILKGQLQKHSG--EETVMNMDTFPNVGLAKVYSVDFQIPDSAATATAYLCGVKTNLNTVGVSAAARNGVCRS--QKGNEVTSILRWAKDAGKSVGIVTTTRVQHATPAASFAHSASRTWYSDADLPASAATEGCVDIATQLLHNIDI-DVIIGGGRKYMTPKGFPDPEYPSDASAQGQRRDGRNLIQDWIQMKEGKV---ARYVWNKTDFDAVDPEKTDYLMALFEPADLR 292          

HSP 2 Score: 184.882 bits (468), Expect = 3.521e-51
Identity = 88/208 (42.31%), Postives = 136/208 (65.38%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            +  LFE  +++++ ER  + DP++ + T KAI IL +NPKG+FLL+EGG++D+ HH ++A  A+ E + L++AV    +++ E++TL ++TADHSH FT   Y  R   ILGK+  +    L    +T+L+YG GPG+K+    R +I   +    + +  S VPL   THGGE+V+V+ARGP  H+ + +YEQ+YI H M YA+CIG
Sbjct:  282 LMALFEPADLRFDVERDHSMDPSISETTDKAIQILKKNPKGFFLLVEGGRIDQGHHSSRASAALHEAVALDEAVSRGLELTDEEETLTIVTADHSHAFTFNGYPFRGNSILGKSPIFASDFLP---YTTLMYGNGPGHKITNNKRPDIRKVDTADKDYIQQSAVPLDSETHGGEDVAVFARGPMAHLFQGVYEQNYIPHAMAYAACIG 486          
BLAST of Alkaline phosphatase vs. Ensembl Xenopus
Match: galnt15 (polypeptide N-acetylgalactosaminyltransferase 15 [Source:Xenbase;Acc:XB-GENE-982198])

HSP 1 Score: 157.918 bits (398), Expect = 6.866e-74
Identity = 103/275 (37.45%), Postives = 144/275 (52.36%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSN--AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDE--NLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE----DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            EK  +YW +  Q  L   L      +   AKN+I+ +GDGMG+ T+T+ RI K Q       P E   L  + FP+V LSKTY+ +  V DSA TATA L G+K N G +G++A+     C+  T++  ++  I +     GKS+G VTTT I  ATP++ YA    R W     +PK  AVE    DIA Q +      +V++GGGR    P N  D EYP      G R DG NL   W  +     K  A++V+N  +  S+N Q++ +L G
Sbjct:   34 EKDPKYWRRQAQDTLRDALLLLQNLNTNVAKNVIMFLGDGMGVPTVTATRILKGQMAGQ---PGEETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVNAAAVRGQCN--TTRGNEVDSILKWAKQAGKSVGVVTTTRINHATPSAAYAHCVNRDWYSDLEMPKE-AVEQGCKDIAWQLMHNVPNIEVIMGGGRKYMYPRNTSDVEYPNDDKASGTRLDGLNLTQIWLDQKPN--KQAARYVWNRQQLLSVNPQEVDHLLG 300          

HSP 2 Score: 140.969 bits (354), Expect = 6.866e-74
Identity = 74/154 (48.05%), Postives = 102/154 (66.23%), Query Frame = 2
Query: 1001 EFISIQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITS 1447
            E   + GLFE  +M YE ER  T DP+L +M   AI IL +NP+G+FLL+EGG++D  HHE KA +A+ E ++++ A+  A  M+SE+DTL V+TADHSH FT G Y +R   I G         +D+K FTS+LYG GPGYK+    REN+++
Sbjct:  294 EVDHLLGLFEPIDMLYELERNTTMDPSLPEMVEMAIKILRKNPEGFFLLVEGGRIDHGHHEGKANQALHEAVQMDIAIGLAGSMTSEEDTLTVVTADHSHVFTFGGYTHRGTSIFGLAPAVSD--VDQKPFTSILYGNGPGYKLVNGQRENVST 445          
BLAST of Alkaline phosphatase vs. Ensembl Xenopus
Match: galnt15 (polypeptide N-acetylgalactosaminyltransferase 15 [Source:Xenbase;Acc:XB-GENE-982198])

HSP 1 Score: 156.377 bits (394), Expect = 2.636e-73
Identity = 102/274 (37.23%), Postives = 143/274 (52.19%), Query Frame = 3
Query:  195 KTSEYWIKNGQKQLYSKLNEKPITSN--AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDE--NLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE----DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            K  +YW +  Q  L   L      +   AKN+I+ +GDGMG+ T+T+ RI K Q       P E   L  + FP+V LSKTY+ +  V DSA TATA L G+K N G +G++A+     C+  T++  ++  I +     GKS+G VTTT I  ATP++ YA    R W     +PK  AVE    DIA Q +      +V++GGGR    P N  D EYP      G R DG NL   W  +     K  A++V+N  +  S+N Q++ +L G
Sbjct:   17 KDPKYWRRQAQDTLRDALLLLQNLNTNVAKNVIMFLGDGMGVPTVTATRILKGQMAGQ---PGEETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVNAAAVRGQCN--TTRGNEVDSILKWAKQAGKSVGVVTTTRINHATPSAAYAHCVNRDWYSDLEMPKE-AVEQGCKDIAWQLMHNVPNIEVIMGGGRKYMYPRNTSDVEYPNDDKASGTRLDGLNLTQIWLDQKPN--KQAARYVWNRQQLLSVNPQEVDHLLG 282          

HSP 2 Score: 140.969 bits (354), Expect = 2.636e-73
Identity = 74/154 (48.05%), Postives = 102/154 (66.23%), Query Frame = 2
Query: 1001 EFISIQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITS 1447
            E   + GLFE  +M YE ER  T DP+L +M   AI IL +NP+G+FLL+EGG++D  HHE KA +A+ E ++++ A+  A  M+SE+DTL V+TADHSH FT G Y +R   I G         +D+K FTS+LYG GPGYK+    REN+++
Sbjct:  276 EVDHLLGLFEPIDMLYELERNTTMDPSLPEMVEMAIKILRKNPEGFFLLVEGGRIDHGHHEGKANQALHEAVQMDIAIGLAGSMTSEEDTLTVVTADHSHVFTFGGYTHRGTSIFGLAPAVSD--VDQKPFTSILYGNGPGYKLVNGQRENVST 427          
BLAST of Alkaline phosphatase vs. Ensembl Xenopus
Match: galnt15 (polypeptide N-acetylgalactosaminyltransferase 15 [Source:Xenbase;Acc:XB-GENE-982198])

HSP 1 Score: 141.354 bits (355), Expect = 2.436e-68
Identity = 74/154 (48.05%), Postives = 102/154 (66.23%), Query Frame = 2
Query: 1001 EFISIQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITS 1447
            E   + GLFE  +M YE ER  T DP+L +M   AI IL +NP+G+FLL+EGG++D  HHE KA +A+ E ++++ A+  A  M+SE+DTL V+TADHSH FT G Y +R   I G         +D+K FTS+LYG GPGYK+    REN+++
Sbjct:  254 EVDHLLGLFEPIDMLYELERNTTMDPSLPEMVEMAIKILRKNPEGFFLLVEGGRIDHGHHEGKANQALHEAVQMDIAIGLAGSMTSEEDTLTVVTADHSHVFTFGGYTHRGTSIFGLAPAVSD--VDQKPFTSILYGNGPGYKLVNGQRENVST 405          

HSP 2 Score: 139.428 bits (350), Expect = 2.436e-68
Identity = 90/236 (38.14%), Postives = 125/236 (52.97%), Query Frame = 3
Query:  303 GMGISTLTSARIFKNQRQVHNKLPDE--NLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE----DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            GMG+ T+T+ RI K Q       P E   L  + FP+V LSKTY+ +  V DSA TATA L G+K N G +G++A+     C+  T++  ++  I +     GKS+G VTTT I  ATP++ YA    R W     +PK  AVE    DIA Q +      +V++GGGR    P N  D EYP      G R DG NL   W  +     K  A++V+N  +  S+N Q++ +L G
Sbjct:   33 GMGVPTVTATRILKGQMAGQ---PGEETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVNAAAVRGQCN--TTRGNEVDSILKWAKQAGKSVGVVTTTRINHATPSAAYAHCVNRDWYSDLEMPKE-AVEQGCKDIAWQLMHNVPNIEVIMGGGRKYMYPRNTSDVEYPNDDKASGTRLDGLNLTQIWLDQKPN--KQAARYVWNRQQLLSVNPQEVDHLLG 260          
BLAST of Alkaline phosphatase vs. Ensembl Xenopus
Match: galnt15 (polypeptide N-acetylgalactosaminyltransferase 15 [Source:Xenbase;Acc:XB-GENE-982198])

HSP 1 Score: 139.428 bits (350), Expect = 1.031e-67
Identity = 90/236 (38.14%), Postives = 125/236 (52.97%), Query Frame = 3
Query:  303 GMGISTLTSARIFKNQRQVHNKLPDE--NLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE----DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            GMG+ T+T+ RI K Q       P E   L  + FP+V LSKTY+ +  V DSA TATA L G+K N G +G++A+     C+  T++  ++  I +     GKS+G VTTT I  ATP++ YA    R W     +PK  AVE    DIA Q +      +V++GGGR    P N  D EYP      G R DG NL   W  +     K  A++V+N  +  S+N Q++ +L G
Sbjct:   21 GMGVPTVTATRILKGQMAGQ---PGEETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVNAAAVRGQCN--TTRGNEVDSILKWAKQAGKSVGVVTTTRINHATPSAAYAHCVNRDWYSDLEMPKE-AVEQGCKDIAWQLMHNVPNIEVIMGGGRKYMYPRNTSDVEYPNDDKASGTRLDGLNLTQIWLDQKPN--KQAARYVWNRQQLLSVNPQEVDHLLG 248          

HSP 2 Score: 139.043 bits (349), Expect = 1.031e-67
Identity = 71/144 (49.31%), Postives = 96/144 (66.67%), Query Frame = 2
Query: 1001 EFISIQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV 1426
            E   + GLFE  +M YE ER  T DP+L +M   AI IL +NP+G+FLL+EGG++D  HHE KA +A+ E ++++ A+  A  M+SE+DTL V+TADHSH FT G Y +R   I G         +D+K FTS+LYG GPGYK+
Sbjct:  242 EVDHLLGLFEPIDMLYELERNTTMDPSLPEMVEMAIKILRKNPEGFFLLVEGGRIDHGHHEGKANQALHEAVQMDIAIGLAGSMTSEEDTLTVVTADHSHVFTFGGYTHRGTSIFGLAPAVSD--VDQKPFTSILYGNGPGYKL 383          
BLAST of Alkaline phosphatase vs. Ensembl Xenopus
Match: alpi.2 (alkaline phosphatase, intestinal, gene 2 [Source:NCBI gene;Acc:100144722])

HSP 1 Score: 196.052 bits (497), Expect = 1.873e-55
Identity = 98/213 (46.01%), Postives = 134/213 (62.91%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIE-GGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVP---RENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYND 1633
            + GLFE  +MKYE  R    DP+L +MT KAI ILS+NPKG+FL +E  G++D  HH+  A +++ E LE +KAV+   +++ E +TL V+TADHSH FT G Y +R   I G          D+K +TSLLYG GPGY +P   R NIT  N  +   L  + VP+   THGGE+V++ A+GP  H+    +EQSYI HVM YA+C+  Y +
Sbjct:  270 LMGLFEPKDMKYELNRNASLDPSLAEMTEKAIRILSKNPKGFFLFVEDNGRIDHGHHDGNAKQSLTEALEFDKAVLRGGQLTQENETLTVVTADHSHVFTFGGYTDRGNSIFGLAPSLAS---DRKPYTSLLYGNGPGYPLPDAIRANITGVNTGSNSYLQQAAVPVVSETHGGEDVAIMAKGPQAHLFHGFHEQSYIAHVMAYAACLEPYTE 479          

HSP 2 Score: 190.66 bits (483), Expect = 2.241e-53
Identity = 116/307 (37.79%), Postives = 167/307 (54.40%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLF-FENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-----KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKV---GNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLNEIT*NMKMKEQMIRLWNR 1085
            EK  ++W    ++ L + LN  PIT  AKN+I+ +GDGMG++T+ +ARI+  Q QV  +  +EN+   E FP V LSK Y+VD  V DSA T TA L G+K NSG LG+ A+  + NC S  SK  ++  I       GKS+G VTTT +  A+P + YA + +R+W           N   +DIA Q +  ++I  V+LGGGR+   P    DPEYPG     G R+DG NL   W SK     +  A++V+N  +FN++N     YL G     + K        L+      +M E+ IR+ ++
Sbjct:   12 EKNPKFWNDQAKETLKNALNLNPITHRAKNLIMFLGDGMGVTTIAAARIY--QGQVEGQPGEENIMAMEKFPYVALSKVYNVDAQVPDSAGTGTAYLCGVKANSGTLGVSAAAIYGNCVS--SKGNEVTSILHRAKLAGKSVGIVTTTRVQHASPGAAYAHSASRNWYSDNEMTSAMINNGCKDIAYQLVHNTDI-DVILGGGRAYMYPAGTPDPEYPGSSADRGLRRDGLNLTDIWLSK-----RQNARYVWNKEQFNAVNVDTTDYLMGLFEPKDMKYELNRNASLDPSL--AEMTEKAIRILSK 306          
BLAST of Alkaline phosphatase vs. Ensembl Mouse
Match: Akp3 (alkaline phosphatase 3, intestine, not Mn requiring [Source:MGI Symbol;Acc:MGI:87984])

HSP 1 Score: 182.185 bits (461), Expect = 1.611e-90
Identity = 90/218 (41.28%), Postives = 134/218 (61.47%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGY--KVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLS 1654
            + GLFE  + K++ +R    DP+L+ MT  A+ +LSRNPKG++L +EGG++D+ HH   A  A+ E +  + A+  A +++SE+DTL ++TADHSH F+ G Y  R   I G         LD K +TS+LYG GPGY     R N+T++ +        + VP+   THGGE+V+++ARGP  H+L  + EQ+YI HVM +A C+  Y D   C L+
Sbjct:  284 LMGLFEPVDTKFDIQRDPLMDPSLKDMTEAAVKVLSRNPKGFYLFVEGGRIDRGHHLGTAYLALTEAVMFDLAIERASQLTSERDTLTIVTADHSHVFSFGGYTLRGTSIFGLAP---LNALDGKPYTSILYGNGPGYVGTGERPNVTAAESSGSSYRQQAAVPVKSETHGGEDVAIFARGPQAHLLHGVQEQNYIAHVMAFAGCLEPYTD---CGLA 495          

HSP 2 Score: 171.785 bits (434), Expect = 1.611e-90
Identity = 102/271 (37.64%), Postives = 150/271 (55.35%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE---DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYP---GKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEF-NSINTQKIKYLFG 977
            E+   +W K   + L +    +PI ++AKN+I+ +GDGMG+ T+T+ RI K Q + H   P+  L  + FP + LSKTYSVD+ V DSA+TATA L G+KTN   +G+ A+ +F  C+  T+   ++  +       GKS+G VTTT +  A+P+  Y  T  R+W     +P +   E   DIA+Q +   +I  V+LGGGR    P    DPEYP    + G R DGRNL+ EW SK  G     +++V+N  +         + YL G
Sbjct:   25 EENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLG-PETPLAMDRFPYMALSKTYSVDRQVPDSASTATAYLCGVKTNYKTIGVSAAARFDQCN--TTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPSGTYVHTVNRNWYGDADMPASALREGCKDIATQLISNMDI-NVILGGGRKYMFPAGTPDPEYPNDANETGTRLDGRNLVQEWLSKHQG-----SQYVWNREQLIQKAQDPSVTYLMG 286          
BLAST of Alkaline phosphatase vs. Ensembl Mouse
Match: Alppl2 (alkaline phosphatase, placental-like 2 [Source:MGI Symbol;Acc:MGI:108009])

HSP 1 Score: 201.445 bits (511), Expect = 2.320e-57
Identity = 100/224 (44.64%), Postives = 141/224 (62.95%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILG----KNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLST 1657
            + GLFE ++MKYE  R    DP+L +MT  A+ +LSRNPKG++L +EGG++D  HHE  A RA+ E +  + AV  ADK++SE+DT+I++TADHSH F+ G Y  R A I G    K E       D K FTS+LYG GPGYK+    R ++T   +        + VPL   TH GE+V+++ARGP  H++  + EQ+YI HVM +A+C+  Y D   C L++
Sbjct:  283 LMGLFEPNDMKYEIHRDPAQDPSLAEMTEVAVRMLSRNPKGFYLFVEGGRIDHGHHETVAYRALTEAVMFDSAVDKADKLTSEQDTMILVTADHSHVFSFGGYTQRGASIFGLAPFKAE-------DGKSFTSILYGNGPGYKLHNGARADVTEEESSNPTYQQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAACLEPYTD---CGLAS 496          

HSP 2 Score: 183.726 bits (465), Expect = 7.277e-51
Identity = 104/280 (37.14%), Postives = 162/280 (57.86%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPG---KVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEF--NSINTQKIKYLFGYLLTSNYK 1001
            E+   +W +   + L +    KPI ++AKN+++++GDGMG+ST+T+ RI K Q+Q H   P+  L  + FP++ LSKTY+ DK + DSA T TA L G+KTN  ++G+ A+ +F  C+  T+   +++ +       GKS+G VTTTS+  A+PA  YA T  R W    ++P +      +DI++Q +   +I  V+LGGGR    P    D EYP    + G R DGRNL+ EW +K  G     A++V+N SE    S+N + + +L G    ++ K
Sbjct:   24 EENPAFWNRKAAEALDAAKKLKPIQTSAKNLVILMGDGMGVSTVTATRILKGQQQGHLG-PETQLAMDRFPHMALSKTYNTDKQIPDSAGTGTAFLCGVKTNMKVIGLSAAARFNQCN--TTWGNEVVSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNRGWYSDAQMPASALQDGCKDISTQLISNMDI-DVILGGGRKFMFPKGTPDQEYPTDTKQAGTRLDGRNLVQEWLAKHQG-----ARYVWNRSELIQASLN-RSVTHLMGLFEPNDMK 293          
BLAST of Alkaline phosphatase vs. Ensembl Mouse
Match: Alppl2 (alkaline phosphatase, placental-like 2 [Source:MGI Symbol;Acc:MGI:108009])

HSP 1 Score: 201.445 bits (511), Expect = 2.320e-57
Identity = 100/224 (44.64%), Postives = 141/224 (62.95%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILG----KNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLST 1657
            + GLFE ++MKYE  R    DP+L +MT  A+ +LSRNPKG++L +EGG++D  HHE  A RA+ E +  + AV  ADK++SE+DT+I++TADHSH F+ G Y  R A I G    K E       D K FTS+LYG GPGYK+    R ++T   +        + VPL   TH GE+V+++ARGP  H++  + EQ+YI HVM +A+C+  Y D   C L++
Sbjct:  283 LMGLFEPNDMKYEIHRDPAQDPSLAEMTEVAVRMLSRNPKGFYLFVEGGRIDHGHHETVAYRALTEAVMFDSAVDKADKLTSEQDTMILVTADHSHVFSFGGYTQRGASIFGLAPFKAE-------DGKSFTSILYGNGPGYKLHNGARADVTEEESSNPTYQQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAACLEPYTD---CGLAS 496          

HSP 2 Score: 183.726 bits (465), Expect = 7.277e-51
Identity = 104/280 (37.14%), Postives = 162/280 (57.86%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPG---KVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEF--NSINTQKIKYLFGYLLTSNYK 1001
            E+   +W +   + L +    KPI ++AKN+++++GDGMG+ST+T+ RI K Q+Q H   P+  L  + FP++ LSKTY+ DK + DSA T TA L G+KTN  ++G+ A+ +F  C+  T+   +++ +       GKS+G VTTTS+  A+PA  YA T  R W    ++P +      +DI++Q +   +I  V+LGGGR    P    D EYP    + G R DGRNL+ EW +K  G     A++V+N SE    S+N + + +L G    ++ K
Sbjct:   24 EENPAFWNRKAAEALDAAKKLKPIQTSAKNLVILMGDGMGVSTVTATRILKGQQQGHLG-PETQLAMDRFPHMALSKTYNTDKQIPDSAGTGTAFLCGVKTNMKVIGLSAAARFNQCN--TTWGNEVVSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNRGWYSDAQMPASALQDGCKDISTQLISNMDI-DVILGGGRKFMFPKGTPDQEYPTDTKQAGTRLDGRNLVQEWLAKHQG-----ARYVWNRSELIQASLN-RSVTHLMGLFEPNDMK 293          
BLAST of Alkaline phosphatase vs. Ensembl Mouse
Match: Alpl (alkaline phosphatase, liver/bone/kidney [Source:MGI Symbol;Acc:MGI:87983])

HSP 1 Score: 197.978 bits (502), Expect = 3.956e-56
Identity = 104/217 (47.93%), Postives = 142/217 (65.44%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVG 1642
            GLFE  +M+YE  R +  DP+L +M   A+ IL++N KG+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  M+S+KDTL V+TADHSH FT G Y  R   I G     +    DKK FT++LYG GPGYKV    REN++    + NN+  +    S VPL   THGGE+V+V+A+GP  H+L  ++EQ+YI HVM YASCIG   D   
Sbjct:  288 GLFEPGDMQYELNRNNLTDPSLSEMVEVALRILTKNLKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIGKAGAMTSQKDTLTVVTADHSHVFTFGGYTPRGNSIFGL--APMVSDTDKKPFTAILYGNGPGYKVVDGERENVSMVDYAHNNYQAQ----SAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYIPHVMAYASCIGANLDHCA 498          

HSP 2 Score: 164.466 bits (415), Expect = 6.255e-44
Identity = 102/299 (34.11%), Postives = 159/299 (53.18%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEY---PGKVGNRQDGRNLLTEWSSKMTGKWKDKAK---FVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLNEIT 1040
            V   E+   YW +  Q+ L + L  + + +N AKN+I+ +GDGMG+ST+T+ARI K Q   HN   +  L  + FP V LSKTY+ +  V DSA TATA L G+K N G +G+ A+ +   C+  T++  ++  I     + GKS+G VTTT +  ATP++ YA +  R W     +P        +DIA Q +   +   V++GGGR    P N  D EY       G R DG +L++ W S     +K + K   +V+N +E  +++  ++ YL G     +     Q+++  N +T
Sbjct:   19 VPEKERDPSYWRQQAQETLKNALKLQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLH-HNTGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERTRCN--TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIDVIMGGGRKYMYPKNRTDVEYELDEKARGTRLDGLDLISIWKS-----FKPRHKHSHYVWNRTELLALDPSRVDYLLGLFEPGD----MQYELNRNNLT 305          
BLAST of Alkaline phosphatase vs. Ensembl Mouse
Match: Alpi (alkaline phosphatase, intestinal [Source:MGI Symbol;Acc:MGI:1924018])

HSP 1 Score: 189.504 bits (480), Expect = 8.925e-53
Identity = 93/219 (42.47%), Postives = 135/219 (61.64%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVP---RENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLS 1654
            + GLFE   MKY+  R    DP+L +MT  A+ +LSRNP+G++L +EGG++D+ HH   A  A+ E +  + A+  A ++++EKDTLI+ITADHSH F  G Y  R   I G       + LD K +TS+LYG GPGY++    R N+T + +        + VPL   THGGE+V+++ARGP  H++  + EQ+YI HVM +A C+  Y D   C L+
Sbjct:  285 LMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAP---LKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTD---CGLA 497          

HSP 2 Score: 164.851 bits (416), Expect = 7.728e-44
Identity = 100/283 (35.34%), Postives = 152/283 (53.71%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPG---KVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEF-NSINTQKIKYLFGYLLTSNYK 1001
            + + E+   +W K   + L +    +PI ++AKN+I+ +GDGMG+ T+T+ RI K Q + H   P+  L  + FP + LSKTY+VD+ V DSA TATA L G+K N   +G+ A+ +   C+  T+   ++  +       GKS+G VTTT +  A+PA  YA T  R+W     +P +      +DIA+Q +   +I  V+LGGGR    P    DPEYP    + G R D +NL+  W SK  G     A++V+N SE   +     + +L G    +  K
Sbjct:   22 IPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLG-PETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCN--TTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDI-DVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQG-----ARYVWNRSELIQASQDPAVTHLMGLFEPTEMK 295          
BLAST of Alkaline phosphatase vs. UniProt/SwissProt
Match: sp|Q92058|PPBT_CHICK (Alkaline phosphatase, tissue-nonspecific isozyme OS=Gallus gallus OX=9031 GN=ALPL PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.294e-97
Identity = 100/215 (46.51%), Postives = 142/215 (66.05%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCN 1648
            GLFE  +M YE +R +  DP+L +M   AI +L +NP+G+FLL+EGG++D  HHE KA +A+ E +EL++AV  A +++S +DTL V+TADHSH FT G Y  R   I G     +   +D+K FTS+LYG GPGYK+    REN+++ +         + VPL + THGGE+V+V+ARGP  H+L  + EQ+YI H M YA+CIG   +R  C+
Sbjct:  287 GLFEPGDMVYELDRNNETDPSLSEMVAVAIRMLQKNPRGFFLLVEGGRIDHGHHEGKAKQALHEAVELDRAVGLAGRLTSPRDTLSVVTADHSHVFTFGGYTPRGNPIFGL--APMQSDVDRKPFTSILYGNGPGYKIVGGERENVSAVDFAHANYQAQAAVPLRQETHGGEDVAVFARGPMAHLLHGVDEQNYIPHAMAYAACIGP--NRAHCS 497          

HSP 2 Score: 181.8 bits (460), Expect = 1.294e-97
Identity = 111/294 (37.76%), Postives = 166/294 (56.46%), Query Frame = 3
Query:  126 AFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEW-SSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            AFL+ + + ++ S ++  V   EK  EYW +  Q+ L   L  + +  N AKN+IL +GDGMG+ST+T+ARI K Q Q H K  +  L  + FP V L+KTY+ +  V DSA TATA L G+K N G +G+ A V    C+  T+K Q++  I     ++GK++G VTTT +  ATP++ YA +  R W     +P +      +DIA Q +      +V+LGGGR    P N  D EYP +    G R DG++L+  W  +K  GK    AK+V++  E  ++N  ++ +L G
Sbjct:    3 AFLLTL-LAQLCSASL--VPEREKDPEYWRQQAQETLRDALRLQHLNQNVAKNLILFLGDGMGVSTVTAARILKGQLQ-HRKGEESLLEMDKFPYVALAKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAGVTRDRCN--TTKGQEVTSILRWAKDEGKAVGIVTTTRVTHATPSAAYAHSANRDWYSDGEMPLDALEGGCKDIARQLVDNIPDIEVILGGGRKYMFPKNTSDVEYPQEERHRGTRLDGKDLVQAWHDTKPAGK---VAKYVWHRRELLALNVSRVDFLLG 287          
BLAST of Alkaline phosphatase vs. UniProt/SwissProt
Match: sp|P08289|PPBT_RAT (Alkaline phosphatase, tissue-nonspecific isozyme OS=Rattus norvegicus OX=10116 GN=Alpl PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 9.086e-94
Identity = 105/217 (48.39%), Postives = 143/217 (65.90%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVG 1642
            GLFE  +M+YE  R +  DP+L +M   A+ IL++NPKG+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  M+S+KDTL V+TADHSH FT G Y  R   I G     +    DKK FT++LYG GPGYKV    REN++    + NN+  +    S VPL   THGGE+V+V+A+GP  H+L  ++EQ+YI HVM YASCIG   D   
Sbjct:  288 GLFEPGDMQYELNRNNLTDPSLSEMVEVALRILTKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDEAIGKAGTMTSQKDTLTVVTADHSHVFTFGGYTPRGNSIFGL--APMVSDTDKKPFTAILYGNGPGYKVVDGERENVSMVDYAHNNYQAQ----SAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYIPHVMAYASCIGANLDHCA 498          

HSP 2 Score: 166.007 bits (419), Expect = 9.086e-94
Identity = 101/278 (36.33%), Postives = 151/278 (54.32%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEY---PGKVGNRQDGRNLLTEWSSKMTGKWKDKAK---FVYNSSEFNSINTQKIKYLFG 977
            V   EK   YW +  Q+ L + L  + + +N AKNII+ +GDGMG+ST+T+ARI K Q   HN   +  L  + FP V LSKTY+ +  V DSA TATA L G+K N G +G+ A+ +   C+  T++  ++  I     + GKS+G VTTT +  ATP++ YA +  R W     +P        +DIA Q +   +   V++GGGR    P N  D EY       G R DG +L++ W S     +K + K   +V+N +E  +++  ++ YL G
Sbjct:   19 VPEKEKDPSYWRQQAQETLKNALKLQKLNTNVAKNIIMFLGDGMGVSTVTAARILKGQLH-HNTGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERTRCN--TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIDVIMGGGRKYMYPKNRTDVEYELDEKARGTRLDGLDLISIWKS-----FKPRHKHSHYVWNRTELLALDPSRVDYLLG 288          
BLAST of Alkaline phosphatase vs. UniProt/SwissProt
Match: sp|Q29486|PPBT_FELCA (Alkaline phosphatase, tissue-nonspecific isozyme OS=Felis catus OX=9685 GN=ALPL PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.680e-93
Identity = 106/217 (48.85%), Postives = 142/217 (65.44%), Query Frame = 2
Query: 1019 GLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVG 1642
            GLFE  +M+YE  R  T DP+L +M   AI ILS+NPKG+FLL+EGG++D  HHE KA +A+ E +E+++A+  A  M+S +DTL ++TADHSH FT G Y  R   I G     +    DKK FTS+LYG GPGYKV    REN++    + NN+  +    S VPL   THGGE+V+V+A+GP  H+L  ++EQ+YI HVM YA+CIG   D   
Sbjct:  288 GLFEPGDMQYELNRNSTTDPSLSEMVEIAIKILSKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIGRAGAMTSVEDTLTIVTADHSHVFTFGGYTPRGNSIFGLAP--MVSDTDKKPFTSILYGNGPGYKVVGGERENVSMVDYAHNNYQAQ----SAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYIPHVMAYAACIGANLDHCA 498          

HSP 2 Score: 165.622 bits (418), Expect = 1.680e-93
Identity = 106/300 (35.33%), Postives = 156/300 (52.00%), Query Frame = 3
Query:  114 MIYFAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNA-KNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEY---PGKVGNRQDGRNLLTEWSSKMTGKWKDKAK---FVYNSSEFNSINTQKIKYLFG 977
            MI    ++AI      S+    V   EK  +YW    Q+ L + L  + + +N  KN+I+ +GDGMG+ST+T+ARI K Q   HN   +  L  + FP V LSKTY+ +  V DSA TATA L G+K N G +G+ A+ Q   C+  T++  ++  I     + GKS+G VTTT +  ATP++ YA +  R W     +P        +DIA Q +      +V++GGGR    P N  D EY       G R DG NL+  W S     +K + K   +V+N +E  +++   + YL G
Sbjct:    1 MISPFLVLAIGTCLTNSL----VPEKEKDPKYWRDQAQQTLKNALRLQKLNTNVVKNVIMFLGDGMGVSTVTAARILKGQLH-HNPGEETRLEMDKFPYVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATQRTQCN--TTQGNEVTSILRWAKDSGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNVRDIEVIMGGGRKYMFPKNRTDVEYEMDEKARGTRLDGLNLVDIWKS-----FKPRHKHSHYVWNRTELLTLDPYGVDYLLG 288          
BLAST of Alkaline phosphatase vs. UniProt/SwissProt
Match: sp|P83456|PPB_GADMO (Alkaline phosphatase OS=Gadus morhua OX=8049 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 7.818e-93
Identity = 96/206 (46.60%), Postives = 137/206 (66.50%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            GLFE  ++ Y+ ER    DP+L +M   AI IL RNP G++LL+EGG++D  HHE K  +AI E +E+++A+  AD M+S  DTL V+TADHSH F+ G Y  R  +I G    ++  + D+K FT++LYG GPGYK+    REN+++ +      L  + VPL   THGGE+V+V+A+GP  H+L  ++EQ+YI H M YA+CIG
Sbjct:  271 GLFEPADLPYDLERNKETDPSLSEMVEVAIKILRRNPNGFYLLVEGGRIDHGHHEGKDKQAIHEAVEMDRAIGRADLMTSTSDTLTVVTADHSHLFSFGGYTPRGNEIFGL-AAFISDV-DQKPFTAILYGNGPGYKLVNGARENVSTVDYQDNSYLAQAAVPLSSETHGGEDVAVFAKGPMAHLLHGVHEQNYIPHAMAYAACIG 474          

HSP 2 Score: 170.244 bits (430), Expect = 7.818e-93
Identity = 105/273 (38.46%), Postives = 149/273 (54.58%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDE--NLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKN---CAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKV---GNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            E   ++W    QK L   L+ + +  N A+N+IL +GDGMG+ T+T+ARI K Q +     P E   L  + FP V LSKTY+ +  VADSA TATA L G+K N G +G+ A+   +   + T++  ++  I     + GKSIG VTTT +  ATP++ YA    R W     +P +      +DIA Q  +      V++GGGR    P N  D EYPG+    G R+DGRNL+ EW  + T K   K  +V+N  +  S+N  K+ YL G
Sbjct:    7 EPEPKFWNDWAQKTLDKALSLQTLNKNKAQNLILFLGDGMGVPTVTAARILKGQLRGQ---PGEEGQLEMDKFPFVALSKTYNTNAQVADSAGTATAYLCGVKANEGTVGVSAAA--VRSQANTTQGNEVTSILRWAKDAGKSIGIVTTTRVNHATPSAAYAHCVDRDWYSDNEMPADAVEAGCKDIARQLFENIPDIDVIMGGGRKYMYPKNTTDVEYPGQPKHSGTRKDGRNLVKEWVDRNTEK---KGHYVWNKKDLLSLNPTKVDYLLG 271          
BLAST of Alkaline phosphatase vs. UniProt/SwissProt
Match: sp|P24822|PPBI_MOUSE (Intestinal-type alkaline phosphatase OS=Mus musculus OX=10090 GN=Iap PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 8.649e-89
Identity = 89/218 (40.83%), Postives = 133/218 (61.01%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGY--KVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLS 1654
            + GLFE  + K++ +R    DP+L+ MT  A+ +LSRNPKG++L +EGG++D+ HH   A  A+ E +  + A+  A +++SE+DTL ++TADHSH F+ G Y  R   I G         LD K +TS+LYG GPGY     R N+T++ +        + VP+   THGGE+V+++ARGP  H++  + EQ+YI HVM  A C+  Y D   C L+
Sbjct:  284 LMGLFEPVDTKFDIQRDPLMDPSLKDMTETAVKVLSRNPKGFYLFVEGGRIDRGHHLGTAYLALTEAVMFDLAIERASQLTSERDTLTIVTADHSHVFSFGGYTLRGTSIFGLAP---LNALDGKPYTSILYGNGPGYVGTGERPNVTAAESSGSSYRRQAAVPVKSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMASAGCLEPYTD---CGLA 495          

HSP 2 Score: 172.17 bits (435), Expect = 8.649e-89
Identity = 102/271 (37.64%), Postives = 150/271 (55.35%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE---DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYP---GKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEF-NSINTQKIKYLFG 977
            E+   +W K   + L +    +PI ++AKN+I+ +GDGMG+ T+T+ RI K Q + H   P+  L  + FP + LSKTYSVD+ V DSA+TATA L G+KTN   +G+ A+ +F  C+  T+   ++  +       GKS+G VTTT +  A+P+  Y  T  R+W     +P +   E   DIA+Q +   +I  V+LGGGR    P    DPEYP    + G R DGRNL+ EW SK  G     +++V+N  +         + YL G
Sbjct:   25 EENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLG-PETPLAMDRFPYMALSKTYSVDRQVPDSASTATAYLCGVKTNYKTIGLSAAARFDQCN--TTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPSGTYVHTVNRNWYGDADMPASALREGCKDIATQLISNMDI-NVILGGGRKYMFPAGTPDPEYPNDANETGTRLDGRNLVQEWLSKHQG-----SQYVWNREQLIQKAQDPSVTYLMG 286          
BLAST of Alkaline phosphatase vs. TrEMBL
Match: A0A3B3V430 (Alkaline phosphatase, intestinal, tandem duplicate 1 OS=Poecilia latipinna OX=48699 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 9.547e-100
Identity = 115/273 (42.12%), Postives = 164/273 (60.07%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            V+  E  +EYW    ++ L + LN +P    AKN+IL +GDGMGI+T+T+ARI K Q +  N   + +L  + FP++ LSKTY+VD+ + DSA TATA L G+K N G LG+ A+    NCS+  +   ++  I     N GKS+G VTTT +  A+PA+ YA +  R W       K  V   C   DIA Q +  +EI  V+LGGGR   +P +  DPEYP K GNR+DG NL+ EW+     K K  AK+V+N S+F++++ +K  +L G
Sbjct:   24 VNEEELHAEYWNNKAKQALRTALNVQPNVHKAKNLILFLGDGMGITTVTAARILKGQLEG-NSGEEGSLVMDTFPHLALSKTYNVDQQMPDSAGTATAYLCGVKANYGTLGVSAATPLGNCSA--TFGNEVTSILHRAKNAGKSVGIVTTTRVQHASPAASYAHSADRDWYSDSELSKEAVQNGC--HDIAYQLIHNTEI-DVILGGGREYMLPKDTLDPEYPSKTGNREDGTNLIVEWA-----KNKKNAKYVWNKSDFDAVDPRKTDFLLG 285          

HSP 2 Score: 182.956 bits (463), Expect = 9.547e-100
Identity = 97/221 (43.89%), Postives = 137/221 (61.99%), Query Frame = 2
Query: 1019 GLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEG-GKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV-------PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL 1651
            GLFE  +  YE ER  + DP+L +MT KAI IL +NPKGYFL +E  G++D  HH   A +A+ E +E ++A+  A ++++E DTL V+TADHSH F  G Y  R   +LG +       +DKK FT+ +YG GPGY++         E+I+S+NN+  +T     VPL   THG E+V+++A+GP  H+   + EQ+YI HVM YA+CI  Y D   C L
Sbjct:  285 GLFEPRDCHYELERDTSMDPSLTEMTEKAIKILQKNPKGYFLFVEDKGRIDHGHHATSAKKALHEAVEFDRAIGRAAELTNEMDTLTVVTADHSHVFAFGGYSARGNPVLGVSRALA---MDKKHFTTAVYGNGPGYQIVNGTRPDVNESISSTNNYKQQTT----VPLSSETHGIEDVAIFAKGPMSHLFHGVQEQNYIPHVMAYAACIEPYED---CQL 495          
BLAST of Alkaline phosphatase vs. TrEMBL
Match: A0A096M6R2 (Alkaline phosphatase, intestinal, tandem duplicate 2 OS=Poecilia formosa OX=48698 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.612e-99
Identity = 113/267 (42.32%), Postives = 161/267 (60.30%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNC---AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            E   EYW    ++ L++ LN +P    AKN+IL +GDGMGI T+T+ARI K Q +  N   + +L  + FP++ LSKTY+VD+ + DSA TATA L G+K N G LG+ A+    NCS+  +   ++  I     N GKS+G VTTT +  A+PA+ YA +  R W     +PK        DIA Q +  +EI  V+LGGGR   +P +  DPEYP K GNR+DG NL+ EW+     K K  AK+V+N S+F++++ +K  +L G
Sbjct:   28 ELHPEYWNNKAKQALHTALNVQPNVHKAKNLILFLGDGMGIPTVTAARILKGQLEG-NSGEEGSLVMDTFPHLALSKTYNVDQQMPDSAGTATAYLCGVKANYGTLGVSAATPLGNCSA--TFGNEVTSILHRAKNAGKSVGIVTTTRVQHASPAASYAHSADRDWYSDSDLPKEAVQNGCHDIAYQLIHNTEI-DVILGGGREYMLPKDTLDPEYPSKTGNREDGTNLIVEWA-----KNKKNAKYVWNKSDFDAVDPRKTDFLLG 285          

HSP 2 Score: 182.57 bits (462), Expect = 1.612e-99
Identity = 97/221 (43.89%), Postives = 137/221 (61.99%), Query Frame = 2
Query: 1019 GLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEG-GKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVP-------RENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL 1651
            GLFE  +  YE ER  + DP+L +MT KAI IL +NPKGYFL +E  G++D  HH   A +A+ E +E ++A+  A ++++E DTL V+TADHSH F  G Y  R   +LG +       +DKK FT+ +YG GPGY++         E+I+S+NN+  +T     VPL   THG E+V+++A+GP  H+   + EQ+YI HVM YA+CI  Y D   C L
Sbjct:  285 GLFEPRDCHYELERDTSMDPSLTEMTEKAIKILQKNPKGYFLFVEDKGRIDHGHHATWAKKALHEAVEFDRAIGRAAELTNEMDTLTVVTADHSHVFAFGGYSARGNSVLGVSRALA---MDKKHFTTAVYGNGPGYQIVNGTRPDMNESISSTNNYKQQTT----VPLSSETHGIEDVAIFAKGPMSHLFHGVQEQNYIPHVMAYAACIEPYED---CQL 495          
BLAST of Alkaline phosphatase vs. TrEMBL
Match: A0A3B3TLZ5 (Alkaline phosphatase, intestinal, tandem duplicate 1 OS=Poecilia latipinna OX=48699 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.017e-99
Identity = 113/273 (41.39%), Postives = 166/273 (60.81%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            +++++  +EYW    ++ L + LN +P    AKN+IL +GDGMGI+T+T+ARI K Q +  N   + +L  + FP++ LSKTY+VD+ + DSA TATA L G+K N G LG+ A+    NCS+  +   ++  I     N GKS+G VTTT +  A+PA+ YA +  R W       K  V   C   DIA Q +  +EI  V+LGGGR   +P +  DPEYP K GNR+DG NL+ EW+     K K  AK+V+N S+F++++ +K  +L G
Sbjct:   13 LTNLKLHAEYWNNKAKQALRTALNVQPNVHKAKNLILFLGDGMGITTVTAARILKGQLEG-NSGEEGSLVMDTFPHLALSKTYNVDQQMPDSAGTATAYLCGVKANYGTLGVSAATPLGNCSA--TFGNEVTSILHRAKNAGKSVGIVTTTRVQHASPAASYAHSADRDWYSDSELSKEAVQNGC--HDIAYQLIHNTEI-DVILGGGREYMLPKDTLDPEYPSKTGNREDGTNLIVEWA-----KNKKNAKYVWNKSDFDAVDPRKTDFLLG 274          

HSP 2 Score: 182.57 bits (462), Expect = 2.017e-99
Identity = 97/221 (43.89%), Postives = 137/221 (61.99%), Query Frame = 2
Query: 1019 GLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEG-GKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV-------PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL 1651
            GLFE  +  YE ER  + DP+L +MT KAI IL +NPKGYFL +E  G++D  HH   A +A+ E +E ++A+  A ++++E DTL V+TADHSH F  G Y  R   +LG +       +DKK FT+ +YG GPGY++         E+I+S+NN+  +T     VPL   THG E+V+++A+GP  H+   + EQ+YI HVM YA+CI  Y D   C L
Sbjct:  274 GLFEPRDCHYELERDTSMDPSLTEMTEKAIKILQKNPKGYFLFVEDKGRIDHGHHATSAKKALHEAVEFDRAIGRAAELTNEMDTLTVVTADHSHVFAFGGYSARGNPVLGVSRALA---MDKKHFTTAVYGNGPGYQIVNGTRPDVNESISSTNNYKQQTT----VPLSSETHGIEDVAIFAKGPMSHLFHGVQEQNYIPHVMAYAACIEPYED---CQL 484          
BLAST of Alkaline phosphatase vs. TrEMBL
Match: M3ZUX1 (Alkaline phosphatase, intestinal, tandem duplicate 2 OS=Xiphophorus maculatus OX=8083 PE=3 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 2.676e-99
Identity = 110/272 (40.44%), Postives = 162/272 (59.56%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLY---NKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            E  +EYW    ++ +++ LN +P    AKN+IL +GDGMGI T+T+ARI K Q +  N   + +L  + FP++ LSKTY+VD+ + DSA TATA L G+K N G LG+ A+    +C +         +++ +LY   N GKS+G VTTT +  A+PA+ YA +  R W          V   C   DIA Q +  +EI  V+LGGGR    P +  DPEYP + G+R+DG+NL+ EW+     K K  AK+V+N SEF++++ +K  +L G
Sbjct:   28 ELHAEYWNNKAKQAIHTALNVQPNAHQAKNLILFLGDGMGIPTVTAARILKGQLE-GNSGEEGSLVMDTFPHLALSKTYNVDQQMPDSAGTATAYLCGVKANYGTLGVSAATPLGDCKAVFGN-----EVTSILYRAKNAGKSVGIVTTTRVQHASPAASYAHSADRDWYSDSDLSNEAVQNGC--RDIAYQLVYNTEI-DVILGGGRQYMFPRDTPDPEYPSETGSRKDGKNLIDEWA-----KNKINAKYVWNKSEFDAVDPRKTDFLLG 285          

HSP 2 Score: 192.971 bits (489), Expect = 2.676e-99
Identity = 99/222 (44.59%), Postives = 141/222 (63.51%), Query Frame = 2
Query: 1019 GLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVP-------RENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLST 1657
            GLFE  + +YE ER  + DP+L +MT KAI IL +NPKGYFL +EGG++D AHH   A +A+ E +E ++A+  A ++++E DTL V+TADHSH F  G Y  R   ++G +        DKK FT+ +YG GPGY++         E+I+S+N++T +T     VPL   THG E+V+++A+GP  H+   + EQSYI HVM YA+CI  Y D   C L +
Sbjct:  285 GLFEPKDCRYELERDTSMDPSLTEMTEKAIKILQKNPKGYFLFVEGGRIDHAHHSTMAKKALHEAVEFDRAIGRAAELTNELDTLTVVTADHSHVFAFGGYSARGNSVVGVSRSLAS---DKKHFTTAVYGNGPGYQIVNGTRPDMNESISSTNDYTQQTT----VPLDSETHGIEDVAIFAKGPMSHLFHGVQEQSYIPHVMAYAACIEPYTD---CQLES 496          
BLAST of Alkaline phosphatase vs. TrEMBL
Match: A0A3B3TPS4 (Alkaline phosphatase, intestinal, tandem duplicate 1 OS=Poecilia latipinna OX=48699 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 5.942e-99
Identity = 114/269 (42.38%), Postives = 162/269 (60.22%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            E  +EYW    ++ L + LN +P    AKN+IL +GDGMGI+T+T+ARI K Q +  N   + +L  + FP++ LSKTY+VD+ + DSA TATA L G+K N G LG+ A+    NCS+  +   ++  I     N GKS+G VTTT +  A+PA+ YA +  R W       K  V   C   DIA Q +  +EI  V+LGGGR   +P +  DPEYP K GNR+DG NL+ EW+     K K  AK+V+N S+F++++ +K  +L G
Sbjct:   27 ELHAEYWNNKAKQALRTALNVQPNVHKAKNLILFLGDGMGITTVTAARILKGQLEG-NSGEEGSLVMDTFPHLALSKTYNVDQQMPDSAGTATAYLCGVKANYGTLGVSAATPLGNCSA--TFGNEVTSILHRAKNAGKSVGIVTTTRVQHASPAASYAHSADRDWYSDSELSKEAVQNGC--HDIAYQLIHNTEI-DVILGGGREYMLPKDTLDPEYPSKTGNREDGTNLIVEWA-----KNKKNAKYVWNKSDFDAVDPRKTDFLLG 284          

HSP 2 Score: 181.03 bits (458), Expect = 5.942e-99
Identity = 96/221 (43.44%), Postives = 135/221 (61.09%), Query Frame = 2
Query: 1019 GLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEG-GKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPR-------ENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL 1651
            GLFE  +  YE ER  + DP+L +MT KAI IL +NPKGYFL +E  G++D  HH   A +A+ E +E ++A+  A ++++E DTL V+TADHSH F  G Y  R   +L          +DKK FT+ +YG GPGY++         E+I+S+NN+  +T     VPL   THG E+V+++A+GP  H+   + EQ+YI HVM YA+CI  Y D   C L
Sbjct:  284 GLFEPRDCHYELERDTSMDPSLTEMTEKAIKILQKNPKGYFLFVEDKGRIDHGHHATSAKKALHEAVEFDRAIGRAAELTNEMDTLTVVTADHSHVFAFGGYSARGNPVLVTQCFSRALAMDKKHFTTAVYGNGPGYQIVNGTRPDVNESISSTNNYKQQTT----VPLSSETHGIEDVAIFAKGPMSHLFHGVQEQNYIPHVMAYAACIEPYED---CQL 497          
BLAST of Alkaline phosphatase vs. Ensembl Cavefish
Match: alp3 (alkaline phosphatase-like [Source:NCBI gene;Acc:111192490])

HSP 1 Score: 194.897 bits (494), Expect = 9.642e-97
Identity = 117/298 (39.26%), Postives = 169/298 (56.71%), Query Frame = 3
Query:  111 KMIYFAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLF-FENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVP---KNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKV---GNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            K+    FL+    F + ++A   V   E+  E+W    Q  L + L+ K  T+ AKN++L +GDGMGI+T+T+ARI K Q Q  N+L +E +   + FP+VGL K Y+VD  + DSAATATA L G+KTN  ++GM A+ +  N    T K  ++  I +   + GKS+G VTTT +  ATPA  YA + +R W     +P   K     DIA+Q +  ++I  V++GGGR    P    DPEYP      GNRQD RNL+ EW S+  GK    A +V+N  +F+ ++ +   YL  
Sbjct:    5 KVSILCFLLTTG-FALVTLASAPVE--EENPEFWRAQAQTTLKTSLSRKLNTNVAKNVMLFLGDGMGITTITAARILKGQLQ--NQLGEETVMTMDTFPHVGLVKVYTVDFQIPDSAATATAYLCGVKTNLNVVGMSAAAK--NGVCRTEKGNEVTSILQWAKDAGKSVGIVTTTRVQHATPAGAYAHSCSRKWYSDADMPAAAKRDGCRDIAAQLINNTDI-DVIIGGGRKYMTPKGTADPEYPADASANGNRQDQRNLIEEWISQKKGKV---AHYVWNKDDFDRVDPENTDYLMA 291          

HSP 2 Score: 179.489 bits (454), Expect = 9.642e-97
Identity = 89/208 (42.79%), Postives = 135/208 (64.90%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTD--DPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            +  LFE  +M++E ER    DP++ + T KAI IL +NPKG+FLL+EGG++D+ HH ++A  A+ E + L+ AV  A +M+ E +TL V+TADHSH+ +   Y  R   ILGK+  +    LD   +T+L+YG GPG+K+    R +I + +  + + +  + VPL   THGGE+V+V ARGP  H+ + + EQSY+ H M YA+C+G
Sbjct:  289 LMALFEPVDMRFEVERDPLMDPSIIETTEKAIRILQKNPKGFFLLVEGGRIDQGHHASRASMALHEAVALDNAVARALEMTKEDETLTVVTADHSHSLSFNGYPFRGNSILGKSPLFG---LDMLPYTTLMYGNGPGHKITNNKRPDIRNVDTKSKDYVQQAAVPLDSETHGGEDVAVLARGPMAHLFQGVNEQSYLAHAMAYAACMG 493          
BLAST of Alkaline phosphatase vs. Ensembl Cavefish
Match: alpl (alkaline phosphatase, biomineralization associated [Source:ZFIN;Acc:ZDB-GENE-040420-1])

HSP 1 Score: 181.8 bits (460), Expect = 2.442e-89
Identity = 93/221 (42.08%), Postives = 140/221 (63.35%), Query Frame = 2
Query: 1019 GLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLSTIVT 1666
            GLFE  +++Y+ ER  + DP+L +M   AI IL +NP+G++LL+EGG++D  HHE KA +A+ E +E+++A+  A  ++S  DT+ V+TADHSH F  G Y  R   I G     +   +D+K FTS+LYG GPG+K+    R N+++ +    +    S VPL   THGGE+V+V+++GP  H+L  + EQ+YI H M YA+CIG   +R  C   +  T
Sbjct:  290 GLFEPGDLQYDLERDSSTDPSLTEMVEVAIKILRKNPEGFYLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGRAGLLTSVHDTMTVVTADHSHVFNFGGYTLRGNSIFGLAP--MVSDVDQKPFTSILYGNGPGFKLINGSRVNVSTEDYQQNDYQAQSAVPLRMETHGGEDVAVFSKGPMAHLLHGVQEQNYIPHAMAYAACIG--QNRAHCRTRSSAT 506          

HSP 2 Score: 167.933 bits (424), Expect = 2.442e-89
Identity = 104/267 (38.95%), Postives = 148/267 (55.43%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLN-EKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDE-NLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGK---VGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            EK   +W    Q+ L S L  ++P  + AKN+IL +GDGMG+ T+T+ARI K Q  +  +  +E  L  + FP V LSKTY+ +  V DSA TATA L G+K N G +G+ A+     C+  T++  ++  I +     GKS+G VTTT +  ATP++ Y    A      V   C  +DIA Q ++      V++GGGR   +P N  D EYPG+    G R+DGRNL+ EW+ +M  K   K  +V+N  +  SIN     YL G
Sbjct:   39 EKDPGFWNAWAQRTLRSALTLQEPNRNIAKNLILFLGDGMGVPTVTAARILKGQ--LSGQYGEEVQLEMDKFPYVSLSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAAAVRGQCN--TTRGNEVTSILKWAKESGKSVGIVTTTRVNHATPSAAYMPPEA------VQAGC--KDIARQLMENIPDINVIMGGGRKYMLPKNTSDVEYPGEKKHSGTRKDGRNLIQEWTDRMRDK---KGYYVWNKKDLLSINPSSADYLLG 290          
BLAST of Alkaline phosphatase vs. Ensembl Cavefish
Match: alpi.2 (alkaline phosphatase, intestinal, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-142])

HSP 1 Score: 177.178 bits (448), Expect = 5.961e-83
Identity = 103/268 (38.43%), Postives = 152/268 (56.72%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNC-----AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            E+  ++W   G++ L + L+ K     AKN+IL +GDGMG+ST+T+ RI K Q  +  K  +E  L  + FPN+ LSKTY+V+  + DSAATATA L G+K   G LG+ A+ +   CS  T K  ++  +       GKS+G VTTT +  A+P   YA T  R+W     +         +DIA Q +  ++I  V+LGGGR   +PNN  DPEY  + G+R D  NL+ EW      K K  AK+V+N ++ ++++    +YL G
Sbjct:   27 EQNPQFWNAKGKEALVTALSLKHNFHLAKNLILFLGDGMGVSTVTATRILKGQ--LEGKPGEETVLTMDTFPNLALSKTYNVNMQMPDSAATATAYLCGVKATYGTLGLSATARRGQCS--TEKNNEVHSVLHRARAAGKSVGIVTTTRVQHASPGGNYAHTSERNWYSDAAQPADALAGGCKDIAYQLVHNTDI-NVILGGGRQYMLPNNITDPEYAKQTGDRLDNTNLIDEWL-----KNKKNAKYVWNKAQLDAVDEDTTEYLMG 284          

HSP 2 Score: 151.369 bits (381), Expect = 5.961e-83
Identity = 87/212 (41.04%), Postives = 122/212 (57.55%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERT--DDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPRE--------NITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCI 1618
            + GLFE  + +YE ER    DP+L +M  KAI ILS+NPKG++L +E         +N+A +A+ E L            +SE+DT+ V+TADHSH F+ GS   R   +LG +   +G   DKK FT+ LYG GPG+ +           NITS+  +T +    S VPL   THG E+V+++A+GP  H+   + EQSYI H M YA+CI
Sbjct:  282 LMGLFEPKDTRYELERNAETDPSLTEMVEKAIKILSKNPKGFYLFVE---------DNEAKKALYEAL------------TSERDTMSVVTADHSHVFSFGSSSPRGNPVLGLSTK-IGT--DKKYFTTALYGNGPGFAIDSNGTRPDININITSATGYTQQ----SAVPLSSETHGSEDVAIFAKGPMSHLFHGVQEQSYIAHAMAYAACI 465          
BLAST of Alkaline phosphatase vs. Ensembl Cavefish
Match: alpi.2 (alkaline phosphatase, intestinal, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-142])

HSP 1 Score: 180.259 bits (456), Expect = 1.707e-81
Identity = 95/223 (42.60%), Postives = 138/223 (61.88%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERT--DDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPRE--------NITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNL 1651
            + GLFE  + +YE ER    DP+L +M  KAI ILS+NPKG++L +E  K+D  HH ++A +A+ E +E ++A+  A +++SE+DT+ V+TADHSH F+ GS   R   +LG +   +G   DKK FT+ LYG GPG+ +           NITS+  +  +    S VPL   THG E+V+++A+GP  H+   + EQSYI H M YA+CI  Y +   CNL
Sbjct:  267 LMGLFEPKDTRYELERNAETDPSLTEMVEKAIKILSKNPKGFYLFVED-KIDHGHHASEAKKALYEAVEFDRAIARAGELTSERDTMSVVTADHSHVFSFGSSSPRGNPVLGLSTK-IGT--DKKYFTTALYGNGPGFAIDSNGTRPDININITSATGYAQQ----SAVPLSSETHGSEDVAIFAKGPMSHLFHGVQEQSYIAHAMAYAACIDPYTE---CNL 478          

HSP 2 Score: 143.28 bits (360), Expect = 1.707e-81
Identity = 99/267 (37.08%), Postives = 145/267 (54.31%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDG--MGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMY--ASTPARSWKYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            E+  ++W   G++ L + L+ K     AKN+IL +GDG  MG+ST+T+ RI K Q  +  K  +E  L  + FPN+ LSKTY+V+  + DSAATATA L G+K   G            CS  T K  ++  +       GKS+G VTTT  V     + Y  A+ PA +    +   C  +DIA Q +  ++I  V+LGGGR   +PNN  DPEY  + G+R D  NL+ EW      K K  AK+V+N ++ ++++    +YL G
Sbjct:   31 EQNPQFWNAKGKEALVTALSLKHNFHLAKNLILFLGDGECMGVSTVTATRILKGQ--LEGKPGEETVLTMDTFPNLALSKTYNVNMQMPDSAATATAYLCGVKATYG-----------QCS--TEKNNEVHSVLHRARAAGKSVGIVTTTR-VQQNERNWYSDAAQPADA----LAGGC--KDIAYQLVHNTDI-NVILGGGRQYMLPNNVTDPEYAKQTGDRLDNTNLIDEWL-----KNKKNAKYVWNKAQLDAVDEDTTEYLMG 269          
BLAST of Alkaline phosphatase vs. Ensembl Cavefish
Match: alpi.2 (alkaline phosphatase, intestinal, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-142])

HSP 1 Score: 171.785 bits (434), Expect = 2.264e-81
Identity = 103/270 (38.15%), Postives = 152/270 (56.30%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDG--MGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNC-----AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            E+  ++W   G++ L + L+ K     AKN+IL +GDG  MG+ST+T+ RI K Q  +  K  +E  L  + FPN+ LSKTY+V+  + DSAATATA L G+K   G LG+ A+ +   CS  T K  ++  +       GKS+G VTTT +  A+P   YA T  R+W     +         +DIA Q +  ++I  V+LGGGR   +PNN  DPEY  + G+R D  NL+ EW      K K  AK+V+N ++ ++++    +YL G
Sbjct:   29 EQNPQFWNAKGKEALVTALSLKHNFHLAKNLILFLGDGECMGVSTVTATRILKGQ--LEGKPGEETVLTMDTFPNLALSKTYNVNMQMPDSAATATAYLCGVKATYGTLGLSATARRGQCS--TEKNNEVHSVLHRARAAGKSVGIVTTTRVQHASPGGNYAHTSERNWYSDAAQPADALAGGCKDIAYQLVHNTDI-NVILGGGRQYMLPNNITDPEYAKQTGDRLDNTNLIDEWL-----KNKKNAKYVWNKAQLDAVDEDTTEYLMG 288          

HSP 2 Score: 151.369 bits (381), Expect = 2.264e-81
Identity = 87/212 (41.04%), Postives = 122/212 (57.55%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERT--DDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPRE--------NITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCI 1618
            + GLFE  + +YE ER    DP+L +M  KAI ILS+NPKG++L +E         +N+A +A+ E L            +SE+DT+ V+TADHSH F+ GS   R   +LG +   +G   DKK FT+ LYG GPG+ +           NITS+  +T +    S VPL   THG E+V+++A+GP  H+   + EQSYI H M YA+CI
Sbjct:  286 LMGLFEPKDTRYELERNAETDPSLTEMVEKAIKILSKNPKGFYLFVE---------DNEAKKALYEAL------------TSERDTMSVVTADHSHVFSFGSSSPRGNPVLGLSTK-IGT--DKKYFTTALYGNGPGFAIDSNGTRPDININITSATGYTQQ----SAVPLSSETHGSEDVAIFAKGPMSHLFHGVQEQSYIAHAMAYAACI 469          
BLAST of Alkaline phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005574.1 (pep scaffold:Pmarinus_7.0:GL476550:153880:181708:-1 gene:ENSPMAG00000005040.1 transcript:ENSPMAT00000005574.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 8.585e-71
Identity = 114/272 (41.91%), Postives = 170/272 (62.50%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQ--DLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVP---KNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYP-GKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            + ++ + + YW + G   L   L  +PI   AKNIIL IGDGM +ST+ +ARI K Q   H    + +L FE+FP+  L KTY VD+ V +SA TATA+L GIK+N+  +G+  SVQF +C + + + Q   +LK++      GK+ G ++T  +  ATPA +Y  +P+R+W++ VP   ++   +D+A+Q L+ SE  QV+LGGGRSNF P++  DPEYP   VG RQDGRNL+ EW ++    W  K+ +V+   +F +IN +   YL G
Sbjct:   21 IIAVVEDAAYWQQIGITALNQALLTQPIVRTAKNIILFIGDGMSLSTVNAARILKGQMAGHTG-EESHLSFEDFPHTALLKTYCVDRQVPESACTATALLCGIKSNANTIGVSHSVQFEDCGTMSPQTQADSILKLAA---QAGKTTGLISTARVTHATPAPLYGHSPSRAWEHHVPAPARDLGCQDLATQLLQHSEHIQVILGGGRSNFFPSSVKDPEYPETHVGKRQDGRNLVHEWLAR---TWGKKSDYVWTKKDFENINPEDTNYLLG 285          
BLAST of Alkaline phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005573.1 (pep scaffold:Pmarinus_7.0:GL476550:153880:182092:-1 gene:ENSPMAG00000005040.1 transcript:ENSPMAT00000005573.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 1.157e-70
Identity = 114/272 (41.91%), Postives = 170/272 (62.50%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQ--DLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVP---KNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYP-GKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            + ++ + + YW + G   L   L  +PI   AKNIIL IGDGM +ST+ +ARI K Q   H    + +L FE+FP+  L KTY VD+ V +SA TATA+L GIK+N+  +G+  SVQF +C + + + Q   +LK++      GK+ G ++T  +  ATPA +Y  +P+R+W++ VP   ++   +D+A+Q L+ SE  QV+LGGGRSNF P++  DPEYP   VG RQDGRNL+ EW ++    W  K+ +V+   +F +IN +   YL G
Sbjct:   25 IIAVVEDAAYWQQIGITALNQALLTQPIVRTAKNIILFIGDGMSLSTVNAARILKGQMAGHTG-EESHLSFEDFPHTALLKTYCVDRQVPESACTATALLCGIKSNANTIGVSHSVQFEDCGTMSPQTQADSILKLAA---QAGKTTGLISTARVTHATPAPLYGHSPSRAWEHHVPAPARDLGCQDLATQLLQHSEHIQVILGGGRSNFFPSSVKDPEYPETHVGKRQDGRNLVHEWLAR---TWGKKSDYVWTKKDFENINPEDTNYLLG 289          
BLAST of Alkaline phosphatase vs. Ensembl Yeast
Match: PHO8 (Repressible vacuolar alkaline phosphatase; regulated by levels of Pi and by Pho4p, Pho9p, Pho80p, Pho81p and Pho85p; dephosphorylates phosphotyrosyl peptides; contributes to NAD+ metabolism by producing nicotinamide riboside from NMN [Source:SGD;Acc:S000002889])

HSP 1 Score: 82.4185 bits (202), Expect = 4.645e-17
Identity = 74/206 (35.92%), Postives = 107/206 (51.94%), Query Frame = 3
Query:  276 KNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNCAVED-IASQFLKKSEIFQVV---LGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSS 881
            KN+I  + DGMG ++L+ AR F NQ    N LP +++   +   +G S+T S D  V DSAA ATA    +K+ +G +G+D       C +       +L+ +++    G   G V TT I DATPAS  +    R W+         ED IA+  L +  + +VV   +GGGRS+F P  E    Y G  G R+DGR+L+ E  S
Sbjct:   67 KNVIFFVTDGMGPASLSMARSF-NQHV--NDLPIDDILTLDEHFIGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDP--HHRPCGT-------VLEAAKL---AGYLTGLVVTTRITDATPASFSSHVDYR-WQ---------EDLIATHQLGEYPLGRVVDLLMGGGRSHFYPQGEKASPY-GHHGARKDGRDLIDEAQS 246          

HSP 2 Score: 47.7506 bits (112), Expect = 3.694e-6
Identity = 27/100 (27.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTDD--PTLEQMTVKAINIL------SRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAV--IAADKMSSEKDTLIVITADH 1288
            GLF  +++ +E +R +   P+L++    A+  L       ++  G+FL++EG ++D A H+N     + E L  ++A   +     +S+ +T++V T+DH
Sbjct:  275 GLFADNDIPFEIDRDEKEYPSLKEQVKVALGALEKASNEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDEAFQYVLEFAENSDTETVLVSTSDH 374          
BLAST of Alkaline phosphatase vs. Ensembl Nematostella
Match: EDO45655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSL3])

HSP 1 Score: 172.94 bits (437), Expect = 2.790e-47
Identity = 101/320 (31.56%), Postives = 180/320 (56.25%), Query Frame = 3
Query:  114 MIYFAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDEN-LFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQ--DLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKY------RVPKNCAVEDIASQFLK----KSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLNE 1034
            ++ FAF + +    + ++   +V + +  ++ W K+G   +   L ++P T  AKN+I+ +GDG  I+T T+ RI K Q  +  ++ ++  L +E FP  GLSKTY+ ++  +DSA TA A+ TG+KT S ++G++  V    C + T  ++   +LK++E     G + GF+T+  +  ATPA++YA + +R W+       R   N + +D+A Q +       +  +VV+GGGR +F+PN   DPE+  K G R DGRNL+ EW +K  G     + + +N ++F++++ +  K+  G   +S+     QF +  +E
Sbjct:    7 LLVFAFCLVV----LTALCSGDVPASQSNNQ-WFKDGVSTVKKHLLQRPNTKPAKNLIIFVGDGCDINTNTAGRILKGQ--LKGQVGEKGWLSYEEFPYTGLSKTYTTNRQGSDSAGTANAMFTGVKTRSAMIGVNEEVVTNKCETLTEDRKVDSILKLAE---EAGMATGFITSMRLTHATPANLYAHSASRYWESDKEMVSRGYGNTSCKDMAQQLVDFQGSVGDGIEVVMGGGRRSFLPNTTRDPEHVNKTGERYDGRNLIQEWLNKREG-----SVYAWNKTQFDAVDPKTTKHFLGMFESSH----MQFAIDRDE 307          

HSP 2 Score: 136.346 bits (342), Expect = 1.909e-34
Identity = 84/216 (38.89%), Postives = 125/216 (57.87%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTDD----PTLEQMTVKAINILSRNP--KGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILG--KNEGYVGQIL-DKKGFTSLLYGTGPG-YKVPRENI----TSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGT 1624
            G+FE  +M++  +R +D    P++ +M  KA++IL  N   KG+FL +E G +D  HH   A +A+ E + LE+ V  A +M+ ++DTLI+ TADH H FTL  Y + N+ I G  K +G V   L D K +T L Y  GPG  K  R N+    T + +F  + LY  G       HG ++V +Y+RGPW H+L  + EQ+ I HVM +A C+ +
Sbjct:  292 GMFESSHMQFAIDRDEDVGGEPSIAEMVEKAVSILKNNDNGKGFFLAVEAGLIDIGHHNGIARQALNEVVNLEEGVAKAVEMTDKEDTLIISTADHGHVFTLTGYPDINSPIFGLMKQDGEVKLALNDNKPYTILGYMNGPGAVKGVRANLTGVDTGAKDFKQQALY-IGYDYDEA-HGSQDVGIYSRGPWAHLLTGVVEQNVIFHVMDHALCLSS 505          
BLAST of Alkaline phosphatase vs. Ensembl Nematostella
Match: EDO33501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS15])

HSP 1 Score: 76.6406 bits (187), Expect = 8.458e-17
Identity = 50/132 (37.88%), Postives = 68/132 (51.52%), Query Frame = 2
Query: 1259 DTLIVITADHSHTFTLGSYMNRNADILG-----KNEGYVGQILDKKGFTSLLYGTGPG---YKVPRENIT----SSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCI 1618
            DTLI+ TADHSHTFT+  Y  R   I G      N   V    DK  +T+L Y  GPG       R ++T    +  +F  + LY          HGGE+V +YA GP  +++  + EQ+YI HVM +A C+
Sbjct:    3 DTLILTTADHSHTFTISGYPKRGNPIFGLVVDIYNRTVVASS-DKLPYTTLGYANGPGGLKVNATRADLTMVDTADKDFKSQALYYQS----SEAHGGEDVGIYADGPGAYLMHGVVEQNYIFHVMDHALCL 129          
BLAST of Alkaline phosphatase vs. Ensembl Nematostella
Match: EDO39541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9U4])

HSP 1 Score: 72.7886 bits (177), Expect = 1.796e-14
Identity = 59/185 (31.89%), Postives = 87/185 (47.03%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDERTDD----PTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILG-KNEGYVGQIL----DKKGFTSLLYGTGP-GYKVPRENITSSN----NFTGETLYNSGVPLPRGTHGGEEV 1525
            + GLFE  NM+Y+  R  D    P++ +M   AI IL  N KG+FL++E                                    ++TLI++TADH HT T+  Y  R   ILG   +G  G++L    DK  FT+L Y  GP  +   R+N+TS++     F  ++LYN        +HGG++V
Sbjct:   99 VLGLFESSNMQYDAHREADVGGEPSITEMVESAIKILKNNNKGFFLMVE------------------------------------EETLIIVTADHGHTMTMAGYPERGNPILGLAKDG--GKLLLSANDKLPFTTLGYMNGPSAFFGKRKNLTSTDTLSAKFQQQSLYNGNDEYE--SHGGQDV 243          

HSP 2 Score: 55.8398 bits (133), Expect = 9.490e-9
Identity = 28/81 (34.57%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  759 FQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYK 1001
             +VV GGGR  F+PN   DPE+    G R DGRNL+ EW+ K     +  +K+++N  +   +     K++ G   +SN +
Sbjct:   36 IEVVYGGGRLAFLPNTTKDPEHVNSTGERYDGRNLVQEWTEK-----QPDSKYIWNKKQMAELGN--AKHVLGLFESSNMQ 109          
BLAST of Alkaline phosphatase vs. Ensembl Medaka
Match: alpl (alkaline phosphatase, biomineralization associated [Source:NCBI gene;Acc:101158849])

HSP 1 Score: 191.815 bits (486), Expect = 7.523e-95
Identity = 96/206 (46.60%), Postives = 135/206 (65.53%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERT--DDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            GLF   ++ Y+ ER    DP+L QM   AI +L  NPKG++LL+EGG++D  HHE KA +A+ E +E+++A+  AD ++S +DTL V+TADHSH FT G Y  R   I G     +   +D K FTS+LYG GPGYK+    REN+++ +         S VPL   THGGE+V+V+A+GP  H+L  ++EQ++I HVM YA+CIG
Sbjct:  290 GLFGPVDLPYDLERNADSDPSLTQMVEVAIKVLQNNPKGFYLLVEGGRIDHGHHEGKAKQALYEAVEMDRAIGRADLLTSAQDTLTVVTADHSHVFTFGGYTRRGNTIFGLAP--MVSDVDHKPFTSILYGNGPGYKLVGGARENVSTVDFAENNYKAQSAVPLTSETHGGEDVAVFAKGPLAHLLHGVHEQNFIPHVMAYAACIG 493          

HSP 2 Score: 176.407 bits (446), Expect = 7.523e-95
Identity = 111/295 (37.63%), Postives = 158/295 (53.56%), Query Frame = 3
Query:  126 AFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSN-AKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDE-NLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPK---NCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKV---GNRQDGRNLLTEWSSKMTGKWKDK-AKFVYNSSEFNSINTQKIKYLFG 977
            A LI  +   ++S         EK+  +W    QK L   L+ + +  N AKN+IL +GDGMG+ T+T+ARI K Q  ++ +  +E  L  + FP V LSKTY+ D  V DSA TATA L G+K N G +G+ A+     C+  T+K  ++  I +   + GKS+G VTTT I  ATP++ YA +  R W     +P        +DIA Q  +      V++GGGR    P N  D +YPG     G R DGRNL+ EW  +M    KD+   +V+N  +  S+N +K  YL G
Sbjct:    4 ALLIICSCLSVRSSGKPMFPENEKSPAFWNNGAQKTLKEALSTQELNKNKAKNLILFLGDGMGVPTVTAARILKGQ--LNGQSGEEYQLEMDKFPFVSLSKTYNTDAQVPDSAGTATAYLCGVKANEGTVGVSAAAVRSQCN--TTKGNEVTSILKWAKDAGKSVGIVTTTRINHATPSAAYAHSVDRDWYSDNEMPSEALQAGCKDIARQLFENIPNIDVIMGGGRKYMFPKNMSDVDYPGVAKYNGVRNDGRNLVQEWIDRM----KDQGGHYVWNKQQLLSLNPKKTSYLLG 290          
BLAST of Alkaline phosphatase vs. Ensembl Medaka
Match: alp3 (alkaline phosphatase [Source:NCBI gene;Acc:101159123])

HSP 1 Score: 188.734 bits (478), Expect = 3.606e-92
Identity = 112/270 (41.48%), Postives = 159/270 (58.89%), Query Frame = 3
Query:  192 EKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLF-FENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW--KYRVPKNCAVE---DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKV---GNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLF 974
            E+  E+W    ++ L S L+ K  T  AKNI+  +GDGMGI+T T+ARI K Q Q  N+  +E +   + FP VGL+KTYSVD  +ADSAATATA L G+KTN   +G++A+ +   C   T K  ++  I +   + GKS+G VTTT +  ATPA  YA + +R+W     +P +   E   DI+SQ LK  +I  V++GGGR    P    DPEYP      G R+DGR+L+ EW +   GK    A + +N +EF++I+ +   YL 
Sbjct:   23 EENPEFWRAQAKQTLQSVLDRKLNTKVAKNILFFLGDGMGITTYTAARILKGQLQ--NQSGEETVMTMDTFPYVGLAKTYSVDFQIADSAATATAYLCGVKTNLNTVGVNAAARNGICR--TQKGNEVTSILKWAKDAGKSVGIVTTTRVQHATPAGSYAHSASRTWYSDADMPDSAIGEGCTDISSQLLKNVDI-DVIIGGGRQYMTPRGTKDPEYPADFSSGGKRRDGRHLIQEWQNMKNGK---AAHYAWNKTEFDAIDPETTDYLM 284          

HSP 2 Score: 170.244 bits (430), Expect = 3.606e-92
Identity = 87/208 (41.83%), Postives = 128/208 (61.54%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKV---PRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIG 1621
            +  LFE  +++YE ER  + DP++ + T KAI IL +NPKG+FLL+E G++D+AHH+  A  A+ E +  + A+    +++SE DTL + TADHSH  T   +  R   ILGK+  +   +L    +T+L+YG GPG+K+    R +I + N  + E +  S  PL   TH GE+V V ARGP  H+   I EQ+YI H M YA+C+G
Sbjct:  283 LMALFEPGDLRYEAERDPSMDPSIMETTEKAIRILQKNPKGFFLLVESGRIDQAHHQGNAYLALHEAVAFDGAIARGLELTSEDDTLTIATADHSHPLTFNGFPFRGQSILGKSPLWGTDMLP---YTTLMYGNGPGHKIVNGKRPDIRNVNTNSMEYIQLSAAPLDSTTHSGEDVVVLARGPMAHLFSGIQEQNYIAHAMGYAACVG 487          
BLAST of Alkaline phosphatase vs. Ensembl Medaka
Match: alpi.2 (intestinal-type alkaline phosphatase 1 [Source:NCBI gene;Acc:101155674])

HSP 1 Score: 178.333 bits (451), Expect = 5.631e-90
Identity = 87/213 (40.85%), Postives = 136/213 (63.85%), Query Frame = 2
Query: 1010 SIQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVP---RENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYND 1633
            ++ GLFE  + +YE ER  + DP+L +MT KAI ILS+ P+G+FL +EGG++D AHH  +A  A+ E +E ++A+  A +++SE DTL ++TADHSH F  G Y  R   +LG +        D K FT+ +YG GPGY++    R ++  + + T +    + VPL   THG E+V+++A+GP  H++  + EQ+YI HV+ YA+C+  Y +
Sbjct:  281 NLMGLFEPKDCRYELERDPSMDPSLTEMTEKAIRILSKKPEGFFLFVEGGRIDHAHHGGQAKLALHEAVEFDRAIGRAAELTSELDTLTIVTADHSHVFAFGGYSARGNPVLGVSRELAD---DGKHFTTTVYGNGPGYQIANGSRPDVNDTVSSTNDYRQQAAVPLESETHGIEDVAIFAKGPMSHLIHGVQEQNYIAHVLAYAACLEPYEN 490          

HSP 2 Score: 173.711 bits (439), Expect = 5.631e-90
Identity = 103/273 (37.73%), Postives = 151/273 (55.31%), Query Frame = 3
Query:  180 VSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG 977
            +S  E  + YW    ++ L + +        AKN+IL +GDGMG++T+T+AR+ K Q    +   + +L  + FP V LSKTY+VD+ + DSA TATA L G+K N G LG+ A+    NC   TS   ++  I       GK++G VTTT +  A+PA+ YA + +R W       +  +   C  +DIA Q +  +EI  V+LGGGR    P N  DPEYP   G+R DG +L+ EW      K KD AK+V++   F+++N +    L G
Sbjct:   23 ISVDELEASYWNNKAKEALNAAIQVPRNLERAKNLILFLGDGMGMATVTAARMLKGQLARQSG-EESSLVMDTFPYVALSKTYNVDEQMPDSAGTATAYLCGVKANYGTLGVTAATTRDNC--LTSFGNNVSSILHRAKRAGKAVGIVTTTRVQHASPAASYAHSASRDWYSDSDLTEEALQNGC--KDIAYQLINNTEI-NVILGGGRQYMFPKNTPDPEYPTLTGSRNDGLDLVEEWK-----KNKDTAKYVWDKKGFDAVNHRTTDNLMG 284          
BLAST of Alkaline phosphatase vs. Ensembl Medaka
Match: alpi.1 (alkaline phosphatase [Source:NCBI gene;Acc:101155917])

HSP 1 Score: 184.882 bits (468), Expect = 2.967e-51
Identity = 94/210 (44.76%), Postives = 130/210 (61.90%), Query Frame = 2
Query: 1013 IQGLFERDNMKYEDER--TDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVP---RENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTY 1627
            + GLFE  +MK+E  R  + DP++ +MT KAI IL +NPKGYFL +EGG++D  HH+N A  A+ ET+  + A+  A +++ E DTL V+TADHSH FT G    R   I G         +DK  FTS+LY  GPGY+     R+NIT  +    E    + VPL   THGGE+V++YA+GP  H+   + EQ+Y+ HVM YA+C+  Y
Sbjct:  298 LMGLFEPKDMKFEVYRNSSSDPSIVEMTEKAIQILRKNPKGYFLFVEGGRIDHGHHDNTAKLALRETVMFDAAIERAGQLTRESDTLTVVTADHSHVFTFGGSTPRGNPIFGLAP---KDAMDKMPFTSILYANGPGYEHANGSRDNITMVDYEDDEYKQQAAVPLEAETHGGEDVAIYAKGPMAHLFHGVKEQNYVAHVMAYAACLEPY 504          

HSP 2 Score: 172.94 bits (437), Expect = 5.667e-47
Identity = 113/327 (34.56%), Postives = 175/327 (53.52%), Query Frame = 3
Query:   96 IFEFYKMIYFAFLIAINVFEIKSIAVKN----VSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNC-SSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSW-------KYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYP---GKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQFKVYLN 1031
            +  F+ +    FL+   + ++ S+A       +  IEK   YW    +  L + L   P    AKN+IL +GDGMG++T+++ARI + Q +  +   +  L  + FP V LSKTYSVDK VADSA+TATA   G+K N+  LG++A      C +++ ++   +L+ ++    +GKS+G VTTT +  A+PA+ YA + +R W          + + C   DIA+Q +   +I  V+LGGGR    P    DPEYP    + G+R+D RNL+  W   +  K K K+ +V+N   F+ IN +    L G     + K    F+VY N
Sbjct:    3 VAHFWALNLQIFLLG-PILKVASMATMETRAALHEIEKEPAYWNAQAKAALNAALKLHPRHHRAKNLILFLGDGMGVTTVSAARILRGQMEGWSG-EETVLAMDTFPYVALSKTYSVDKQVADSASTATAYHCGVKANAKTLGLNAKAVVYECNTTFGNEVHSVLRRAKA---QGKSVGIVTTTRVQHASPAAAYAHSVSRKWYSDADLPSSAIQQGCV--DIATQLVTNVDI-DVILGGGRMYMTPQGTPDPEYPTSSSRKGDRKDKRNLINIW---LKAKPKKKSHYVWNKKGFDEINVKTTDRLMGLFEPKDMK----FEVYRN 314          
BLAST of Alkaline phosphatase vs. Planmine SMEST
Match: SMESG000061191.1 (SMESG000061191.1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 287/296 (96.96%), Postives = 289/296 (97.64%), Query Frame = 3
Query:  114 MIYFAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYK 1001
            MIYFAFLIAINVFE+KSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISE+LYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLL EWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFG     N K
Sbjct:    1 MIYFAFLIAINVFEMKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISELLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNCAVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLAEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGLFERDNMK 296          

HSP 2 Score: 461.455 bits (1186), Expect = 0.000e+0
Identity = 218/219 (99.54%), Postives = 219/219 (100.00%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLSTIVTYFP 1675
            GLFERDNMKYEDERTDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLST+VTYFP
Sbjct:  288 GLFERDNMKYEDERTDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLSTVVTYFP 506          
BLAST of Alkaline phosphatase vs. Planmine SMEST
Match: SMESG000037009.1 (SMESG000037009.1)

HSP 1 Score: 270.396 bits (690), Expect = 7.636e-140
Identity = 144/295 (48.81%), Postives = 194/295 (65.76%), Query Frame = 3
Query:  129 FLIAINVFEIKSIA---VKNVSSIEKTSEYWIKNGQKQLYSKLNEKPITSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVGLSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKKQDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNCAVE--DIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNLLTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNY 998
            F I + +F I+  +   VKN+S  EKT  YWIK+G+++L  KL E  I   AKNII+ IGDGMG STL ++R +KNQR V++  PD NL F+   N G+ KTYSV+ YVADS++TATAI TG+K  SG++G+  +V + NCS+Y+S+  +LL I  M     KS+G VTTT I  ATPAS+YA TP+R W+Y+VP+NC ++  DIA Q  KK+  FQVVLGGG   F+PN           G+R+DGRNLL EW   M    K ++  + NSSEF  ++ ++  YLFG LL  N+
Sbjct:    3 FYILLLLFYIELTSENKVKNISEDEKTKLYWIKSGKEELIKKLKENQIKKVAKNIIIFIGDGMGPSTLAASRAYKNQRMVNSTSPDINLSFDTLSNAGIVKTYSVNDYVADSSSTATAIFTGVKIRSGVVGVGPNVYYENCSTYSSETDNLLSIGTMFSKLKKSVGIVTTTRITHATPASLYAHTPSRDWEYKVPRNCGLQLDDIALQLFKKAHQFQVVLGGGSKYFLPNT--------LNGSREDGRNLLLEWKKSM----KARSALITNSSEFWKVDARETDYLFG-LLNENH 284          

HSP 2 Score: 247.284 bits (630), Expect = 7.636e-140
Identity = 116/212 (54.72%), Postives = 152/212 (71.70%), Query Frame = 2
Query: 1019 GLFERDNMKYEDERTDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAVRAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADILGKNEGYVGQILDKKGFTSLLYGTGPGYKVPRENITSSNNFTGETLYNSGVPLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRVGCNLS 1654
            GL   +++KY+  R D P+L  +T  AI ILS+N  GYFLL+EGGK+D AHH +KAV AILETL ++KAV  A K  + +DTL+++TADHSH FT+GSY  R+ DI  KN    G+  DKKG TSLLY  GPG+  PR N+T   NFT E +Y+SGVPL   THGGE+++VYA GPW H++  +++QSYIGH+MM+ASC+G+Y     CN S
Sbjct:  278 GLLNENHLKYDYYRQDQPSLTDLTDMAIKILSKNKNGYFLLVEGGKIDIAHHNSKAVLAILETLAMDKAVDHAIKSVNFEDTLVIVTADHSHVFTIGSYAERDIDITQKNNALSGEETDKKGHTSLLYSNGPGFVEPRINVTEKTNFTEEYVYSSGVPLSYETHGGEDITVYADGPWSHLISGLHQQSYIGHLMMFASCVGSYESSDHCNKS 489          
The following BLAST results are available for this feature:
BLAST of Alkaline phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALPL3.221e-5747.89alkaline phosphatase, biomineralization associated... [more]
ALPL5.003e-5747.66alkaline phosphatase, biomineralization associated... [more]
ALPL1.412e-5647.89alkaline phosphatase, biomineralization associated... [more]
ALPL1.412e-5647.89alkaline phosphatase, biomineralization associated... [more]
ALPP8.791e-5644.29alkaline phosphatase, placental [Source:HGNC Symbo... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alkaline phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alp11.453e-8640.95gene:FBgn0283479 transcript:FBtr0078396[more]
Alp19.790e-8539.75gene:FBgn0283479 transcript:FBtr0331821[more]
Alp98.675e-8040.83gene:FBgn0035620 transcript:FBtr0077086[more]
Alp98.675e-8040.83gene:FBgn0035620 transcript:FBtr0345902[more]
Alp61.041e-7937.02gene:FBgn0033423 transcript:FBtr0088520[more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alpi.23.020e-9340.00alkaline phosphatase, intestinal, tandem duplicate... [more]
alpl3.747e-9343.95alkaline phosphatase, biomineralization associated... [more]
alpi.23.940e-9340.00alkaline phosphatase, intestinal, tandem duplicate... [more]
alpi.24.875e-9140.00alkaline phosphatase, intestinal, tandem duplicate... [more]
alp31.283e-5538.41alkaline phosphatase 3 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt156.866e-7437.45polypeptide N-acetylgalactosaminyltransferase 15 [... [more]
galnt152.636e-7337.23polypeptide N-acetylgalactosaminyltransferase 15 [... [more]
galnt152.436e-6848.05polypeptide N-acetylgalactosaminyltransferase 15 [... [more]
galnt151.031e-6738.14polypeptide N-acetylgalactosaminyltransferase 15 [... [more]
alpi.21.873e-5546.01alkaline phosphatase, intestinal, gene 2 [Source:N... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Akp31.611e-9041.28alkaline phosphatase 3, intestine, not Mn requirin... [more]
Alppl22.320e-5744.64alkaline phosphatase, placental-like 2 [Source:MGI... [more]
Alppl22.320e-5744.64alkaline phosphatase, placental-like 2 [Source:MGI... [more]
Alpl3.956e-5647.93alkaline phosphatase, liver/bone/kidney [Source:MG... [more]
Alpi8.925e-5342.47alkaline phosphatase, intestinal [Source:MGI Symbo... [more]
back to top
BLAST of Alkaline phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92058|PPBT_CHICK1.294e-9746.51Alkaline phosphatase, tissue-nonspecific isozyme O... [more]
sp|P08289|PPBT_RAT9.086e-9448.39Alkaline phosphatase, tissue-nonspecific isozyme O... [more]
sp|Q29486|PPBT_FELCA1.680e-9348.85Alkaline phosphatase, tissue-nonspecific isozyme O... [more]
sp|P83456|PPB_GADMO7.818e-9346.60Alkaline phosphatase OS=Gadus morhua OX=8049 PE=1 ... [more]
sp|P24822|PPBI_MOUSE8.649e-8940.83Intestinal-type alkaline phosphatase OS=Mus muscul... [more]
back to top
BLAST of Alkaline phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3V4309.547e-10042.12Alkaline phosphatase, intestinal, tandem duplicate... [more]
A0A096M6R21.612e-9942.32Alkaline phosphatase, intestinal, tandem duplicate... [more]
A0A3B3TLZ52.017e-9941.39Alkaline phosphatase, intestinal, tandem duplicate... [more]
M3ZUX12.676e-9940.44Alkaline phosphatase, intestinal, tandem duplicate... [more]
A0A3B3TPS45.942e-9942.38Alkaline phosphatase, intestinal, tandem duplicate... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alp39.642e-9739.26alkaline phosphatase-like [Source:NCBI gene;Acc:11... [more]
alpl2.442e-8942.08alkaline phosphatase, biomineralization associated... [more]
alpi.25.961e-8338.43alkaline phosphatase, intestinal, tandem duplicate... [more]
alpi.21.707e-8142.60alkaline phosphatase, intestinal, tandem duplicate... [more]
alpi.22.264e-8138.15alkaline phosphatase, intestinal, tandem duplicate... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005574.18.585e-7141.91pep scaffold:Pmarinus_7.0:GL476550:153880:181708:-... [more]
ENSPMAT00000005573.11.157e-7041.91pep scaffold:Pmarinus_7.0:GL476550:153880:182092:-... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO84.645e-1735.92Repressible vacuolar alkaline phosphatase; regulat... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO456552.790e-4731.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335018.458e-1737.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395411.796e-1431.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alkaline phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
alpl7.523e-9546.60alkaline phosphatase, biomineralization associated... [more]
alp33.606e-9241.48alkaline phosphatase [Source:NCBI gene;Acc:1011591... [more]
alpi.25.631e-9040.85intestinal-type alkaline phosphatase 1 [Source:NCB... [more]
alpi.12.967e-5144.76alkaline phosphatase [Source:NCBI gene;Acc:1011559... [more]
back to top
BLAST of Alkaline phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000061191.10.000e+096.96SMESG000061191.1[more]
SMESG000037009.17.636e-14048.81SMESG000037009.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032915 ID=SMED30032915|Name=Alkaline phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1677bp
TCAAATTATGGCGCACATATGACACAAACTTGCACAGTCACCGAGCCGGC
ACACATTGACCTAATTTTGATATTTAAGCTAAAATGCGGTGAAATATTTT
TGAATTTTATAAAATGATATATTTTGCATTTTTAATTGCAATAAATGTTT
TTGAAATTAAGTCGATTGCAGTGAAAAATGTTTCATCCATTGAAAAGACC
AGTGAATATTGGATTAAAAATGGGCAAAAACAACTCTATTCCAAACTCAA
TGAGAAACCAATTACTTCAAATGCGAAAAATATAATATTAGTAATCGGCG
ACGGAATGGGAATTTCGACTTTGACATCGGCAAGGATTTTTAAAAACCAA
CGGCAAGTCCATAACAAGTTACCGGATGAAAATTTATTCTTTGAAAATTT
CCCAAACGTTGGACTCTCAAAAACATATTCAGTAGATAAATACGTTGCGG
ATAGCGCTGCAACCGCCACGGCGATTTTAACCGGAATTAAAACCAACAGT
GGAATATTAGGTATGGACGCCAGCGTCCAATTTCTTAATTGTAGTTCTTA
CACTTCAAAAAAACAAGATTTATTAAAAATATCTGAGATGCTTTATAATA
AAGGGAAATCTATTGGTTTTGTTACTACGACCTCCATCGTAGATGCTACG
CCAGCATCTATGTACGCCTCAACGCCAGCTAGGTCATGGAAGTACAGAGT
TCCAAAAAACTGTGCTGTAGAAGATATTGCAAGCCAATTTTTAAAAAAAT
CTGAAATCTTTCAAGTGGTATTAGGGGGAGGAAGATCGAATTTTATTCCA
AATAATGAATTCGATCCAGAGTATCCGGGTAAGGTTGGCAACCGCCAAGA
TGGTAGAAATTTATTAACAGAATGGAGCAGTAAAATGACAGGAAAATGGA
AAGATAAAGCTAAATTTGTCTATAATTCTTCTGAGTTTAATAGTATCAAT
ACTCAGAAAATCAAATATCTCTTTGGTTATTTATTAACTTCAAATTATAA
GAATTTATTTCAATTCAAGGTTTATTTGAACGAGATAACATGAAATATGA
AGATGAAAGAACAGATGATCCGACTTTGGAACAGATGACTGTAAAAGCAA
TTAATATTCTTTCAAGAAATCCTAAAGGTTATTTTCTTTTGATTGAAGGA
GGAAAAGTAGATAAAGCTCATCATGAAAACAAAGCAGTAAGAGCGATTTT
GGAAACTTTGGAATTGGAAAAAGCTGTTATAGCAGCGGATAAGATGTCAA
GCGAAAAAGATACATTAATAGTTATAACCGCGGATCATTCTCATACATTT
ACATTGGGAAGTTATATGAACAGAAATGCTGATATATTGGGTAAAAATGA
GGGCTATGTGGGCCAAATATTAGACAAAAAAGGTTTTACCTCACTTCTAT
ATGGTACTGGACCTGGATACAAAGTCCCACGCGAAAATATAACTTCATCT
AATAATTTTACTGGAGAAACCTTATATAATTCAGGTGTTCCTCTTCCAAG
GGGCACTCACGGAGGAGAGGAGGTTTCAGTGTATGCAAGAGGGCCTTGGG
GACATATGTTAAAGGACATATATGAACAATCGTATATTGGACATGTTATG
ATGTATGCCTCGTGTATTGGTACATATAACGATAGAGTTGGCTGTAATTT
GTCCACAATCGTAACTTACTTTCCAAT
back to top

protein sequence of SMED30032915-orf-1

>SMED30032915-orf-1 ID=SMED30032915-orf-1|Name=SMED30032915-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MIYFAFLIAINVFEIKSIAVKNVSSIEKTSEYWIKNGQKQLYSKLNEKPI
TSNAKNIILVIGDGMGISTLTSARIFKNQRQVHNKLPDENLFFENFPNVG
LSKTYSVDKYVADSAATATAILTGIKTNSGILGMDASVQFLNCSSYTSKK
QDLLKISEMLYNKGKSIGFVTTTSIVDATPASMYASTPARSWKYRVPKNC
AVEDIASQFLKKSEIFQVVLGGGRSNFIPNNEFDPEYPGKVGNRQDGRNL
LTEWSSKMTGKWKDKAKFVYNSSEFNSINTQKIKYLFGYLLTSNYKNLFQ
FKVYLNEIT*
back to top

protein sequence of SMED30032915-orf-2

>SMED30032915-orf-2 ID=SMED30032915-orf-2|Name=SMED30032915-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=212bp
MKYEDERTDDPTLEQMTVKAINILSRNPKGYFLLIEGGKVDKAHHENKAV
RAILETLELEKAVIAADKMSSEKDTLIVITADHSHTFTLGSYMNRNADIL
GKNEGYVGQILDKKGFTSLLYGTGPGYKVPRENITSSNNFTGETLYNSGV
PLPRGTHGGEEVSVYARGPWGHMLKDIYEQSYIGHVMMYASCIGTYNDRV
GCNLSTIVTYFP
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001952Alkaline_phosphatase
IPR017849Alkaline_Pase-like_a/b/a
IPR018299Alkaline_phosphatase_AS
IPR017850Alkaline_phosphatase_core_sf
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0016311dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0016791phosphatase activity
GO:0003824catalytic activity
GO:0004035alkaline phosphatase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001952Alkaline phosphatasePRINTSPR00113ALKPHPHTASEcoord: 111..126
score: 66.09
coord: 215..225
score: 49.09
coord: 160..180
score: 45.83
coord: 54..74
score: 63.45
IPR001952Alkaline phosphataseSMARTSM00098alk_phosph_2coord: 55..309
e-value: 3.2E-10
score: -21.7
IPR001952Alkaline phosphatasePFAMPF00245Alk_phosphatasecoord: 54..289
e-value: 1.5E-55
score: 188.9
IPR001952Alkaline phosphatasePANTHERPTHR11596ALKALINE PHOSPHATASEcoord: 10..290
IPR001952Alkaline phosphataseCDDcd16012ALPcoord: 55..227
e-value: 5.46137E-63
score: 198.807
IPR017850Alkaline-phosphatase-like, core domain superfamilyGENE3DG3DSA:3.40.720.10coord: 27..301
e-value: 4.4E-79
score: 268.5
IPR017850Alkaline-phosphatase-like, core domain superfamilySUPERFAMILYSSF53649Alkaline phosphatase-likecoord: 26..294
NoneNo IPR availablePANTHERPTHR11596:SF53AT01495P-RELATEDcoord: 10..290
IPR018299Alkaline phosphatase, active sitePROSITEPS00123ALKALINE_PHOSPHATASEcoord: 111..119