Protein ANKUB1

Overview
NameProtein ANKUB1
Smed IDSMED30032910
Length (bp)2035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein ANKUB1 (SMED30032910) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein ANKUB1 (SMED30032910) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein ANKUB1 (SMED30032910) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein ANKUB1 (SMED30032910) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032910

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032910h1SMcG0006593 SmedASXL_013662SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30032910h1SMcG0006593 Contig10690newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032910h1SMcG0006593 Contig10690uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032910h1SMcG0006593 Contig45304newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032910h1SMcG0006593 Contig45304uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032910h1SMcG0006594 Contig10690newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032910h1SMcG0006594 Contig10690uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30032910h1SMcG0006593 dd_Smed_v6_9027_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30032910h1SMcG0006593 dd_Smed_v4_9027_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein ANKUB1 vs. Ensembl Human
Match: ANKUB1 (ankyrin repeat and ubiquitin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:29642])

HSP 1 Score: 248.054 bits (632), Expect = 9.260e-74
Identity = 133/373 (35.66%), Postives = 209/373 (56.03%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRS 1313
            MR+FI +E      D+   E+V  +K +I     IP     L  + Q R+ L L  +GA L D W L+D+ I+  STLK ++K E  P LY       +T+PV+E + L + +V DLR+L + + GLP SV+ + T    E++DC  ++DY     + ++++ WDGW EFL    LG   +V   ++ +  +L +YQ++VA+YIAA  G+++L     K G  P E VG+HP R WC    H D  K PIH A E GQL +L++FV+ S+  + CK+  G  PL I  + K K+C  +LLSK WS + F   ++ + ++ K+K+W  RA+   S SL+  +    R        VG  + +DG++  +++S+S
Sbjct:    1 MRIFIAFEGSFEPFDVSADETVEVVKLMIKDYFHIP-----LSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQDTMPVMESISLLDKTVSDLRTLVTLRCGLPVSVYCLRTPRGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRYLSKEGPVL-KYQKRVALYIAAFCGYIELTEWALKQGARPHEAVGVHPYRAWCHEALHADVSKCPIHAAAEAGQLLILKAFVNYSVLCLECKNAAGQTPLTIVFKHKHKDCVLYLLSKMWSTVSFPKISVPMRIYIKIKQWILRAQ---SHSLHKSQFCGAR---VFGAKVGDTVMVDGFTKPKMTSKS 361          
BLAST of Protein ANKUB1 vs. Ensembl Human
Match: ANKUB1 (ankyrin repeat and ubiquitin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:29642])

HSP 1 Score: 248.054 bits (632), Expect = 2.178e-73
Identity = 133/373 (35.66%), Postives = 209/373 (56.03%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRS 1313
            MR+FI +E      D+   E+V  +K +I     IP     L  + Q R+ L L  +GA L D W L+D+ I+  STLK ++K E  P LY       +T+PV+E + L + +V DLR+L + + GLP SV+ + T    E++DC  ++DY     + ++++ WDGW EFL    LG   +V   ++ +  +L +YQ++VA+YIAA  G+++L     K G  P E VG+HP R WC    H D  K PIH A E GQL +L++FV+ S+  + CK+  G  PL I  + K K+C  +LLSK WS + F   ++ + ++ K+K+W  RA+   S SL+  +    R        VG  + +DG++  +++S+S
Sbjct:    1 MRIFIAFEGSFEPFDVSADETVEVVKLMIKDYFHIP-----LSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQDTMPVMESISLLDKTVSDLRTLVTLRCGLPVSVYCLRTPRGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRYLSKEGPVL-KYQKRVALYIAAFCGYIELTEWALKQGARPHEAVGVHPYRAWCHEALHADVSKCPIHAAAEAGQLLILKAFVNYSVLCLECKNAAGQTPLTIVFKHKHKDCVLYLLSKMWSTVSFPKISVPMRIYIKIKQWILRAQ---SHSLHKSQFCGAR---VFGAKVGDTVMVDGFTKPKMTSKS 361          
BLAST of Protein ANKUB1 vs. Ensembl Xenopus
Match: pou4f1.2 (POU class 4 homeobox 1 [Source:Xenbase;Acc:XB-GENE-5996034])

HSP 1 Score: 221.09 bits (562), Expect = 6.173e-64
Identity = 148/529 (27.98%), Postives = 240/529 (45.37%), Query Frame = 3
Query:  309 NIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFANIEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSATEESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIXXXXXXVTNTNDQSLKFN-QNKGDAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHL 1892
            ++ L ++ Q R++L L  +G  L D W+L+D+ IT  ST+K  +K E  P LY         I +     L    V  L++L S+KSG P S++ + T    E+++C  + DY +   + ++++ WDGW E L     G    V   +    E+L RYQ +VA+YIAAHFGH++LA  +   G+   E VG+HP R+WC    H D  K  IH A E GQL VL++F+  ++  + C++  G  PL I   +  K+C  +L+ K WS + F   ++ ++++ K+KKW   A++             K++++     VG  + +DG++   ++SR                    L+ +  E   K  DDS      N++   S     N++S                  K +  KLP IH                   Q I +          T + D SL    +N   A +PLP        RP      +    ++ S++++ K  G  PRE AI CL L+ ++
Sbjct:   13 HVQLSDDKQGRRILELTFAGGVLRDEWVLTDVGITLCSTIKCTIKEETKPALYVFNAVTKERIGIFGGAYLFTDRVSSLKTLISQKSGYPVSIYTLRTWQGTEMYNCNCLSDYKLDLGASLRMDVWDGWKELLKACVTGHKNNVQRYLAGKQEVL-RYQERVALYIAAHFGHLELAQWLLNRGVRADEAVGVHPYREWCHETDHPDVGKCAIHAAAEAGQLLVLKAFIAHNVLCLQCQNPVGQTPLKICTLQGHKDCVLYLVMKTWSLVSFPNISLPMNIYIKVKKWLFVAQKHIW--------KVKKRLVEFKTRVGDTLVVDGFTEPNMTSRG-------------------LHRLHHENGGKETDDS-----GNKSLCVSEKHGTNKVSHDTMRNG-----------KGQKLKLPPIH-------------------QTITN---------CTRSKDTSLGDTFKNTWTAHVPLPPLVNAANGRPQNLTDPHAVIILNSSLKSFSKHSGRTPRENAIYCLGLARYV 469          
BLAST of Protein ANKUB1 vs. Ensembl Mouse
Match: Ankub1 (ankrin repeat and ubiquitin domain containing 1 [Source:MGI Symbol;Acc:MGI:2685256])

HSP 1 Score: 243.432 bits (620), Expect = 3.727e-72
Identity = 133/377 (35.28%), Postives = 206/377 (54.64%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAK-ERASLS-LNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKF 1319
            MR+FI +E    + D+    SVG IK++I     IP     L  + Q R  L L  +GA L + W LSD+ I+  STLK ++K E  P LY         +P++E M L +  V DLR L + + G P SV+ + T    E++DC  ++DY     + ++++ WDGW EFL    LG   +V   ++ +  +L +YQ++VA+YIAA  GH +L     K G+ P E VG+HP R WC    H D    PIH A E GQL +L++FV+ S+  + CK+  G  PL IA + + K+C  +LLSK WS + F   ++ + ++ K+K+W  RA+  R   S L   R +  +        VG  + +DG++  +++S+S +
Sbjct:    1 MRIFIAFEGSFEAFDVEAHTSVGAIKQMIKDYFHIP-----LSEDKQGRWYLELMYAGAALRNSWSLSDVGISFCSTLKCFVKKEDKPTLYVFNAVTQEMMPIMENMSLLDKKVSDLRMLVTLRCGFPVSVYCLRTPTGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKPKVQHYLSKEGPVL-KYQKRVALYIAAFHGHTELTEWALKQGVQPHEAVGVHPYRAWCHEALHTDVSNCPIHAAAEAGQLLILKAFVNCSVLCLECKNAAGQSPLAIASKHQHKDCVLYLLSKMWSTVSFLKLSVPMWIYIKIKQWILRAQSHRCHKSQLGRGRVSGAK--------VGDTVMVDGFTKPKMTSKSWY 363          
BLAST of Protein ANKUB1 vs. Ensembl Mouse
Match: Ankub1 (ankrin repeat and ubiquitin domain containing 1 [Source:MGI Symbol;Acc:MGI:2685256])

HSP 1 Score: 243.432 bits (620), Expect = 1.023e-71
Identity = 133/377 (35.28%), Postives = 206/377 (54.64%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAK-ERASLS-LNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKF 1319
            MR+FI +E    + D+    SVG IK++I     IP     L  + Q R  L L  +GA L + W LSD+ I+  STLK ++K E  P LY         +P++E M L +  V DLR L + + G P SV+ + T    E++DC  ++DY     + ++++ WDGW EFL    LG   +V   ++ +  +L +YQ++VA+YIAA  GH +L     K G+ P E VG+HP R WC    H D    PIH A E GQL +L++FV+ S+  + CK+  G  PL IA + + K+C  +LLSK WS + F   ++ + ++ K+K+W  RA+  R   S L   R +  +        VG  + +DG++  +++S+S +
Sbjct:    1 MRIFIAFEGSFEAFDVEAHTSVGAIKQMIKDYFHIP-----LSEDKQGRWYLELMYAGAALRNSWSLSDVGISFCSTLKCFVKKEDKPTLYVFNAVTQEMMPIMENMSLLDKKVSDLRMLVTLRCGFPVSVYCLRTPTGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKPKVQHYLSKEGPVL-KYQKRVALYIAAFHGHTELTEWALKQGVQPHEAVGVHPYRAWCHEALHTDVSNCPIHAAAEAGQLLILKAFVNCSVLCLECKNAAGQSPLAIASKHQHKDCVLYLLSKMWSTVSFLKLSVPMWIYIKIKQWILRAQSHRCHKSQLGRGRVSGAK--------VGDTVMVDGFTKPKMTSKSWY 363          
BLAST of Protein ANKUB1 vs. Ensembl Mouse
Match: Ankub1 (ankrin repeat and ubiquitin domain containing 1 [Source:MGI Symbol;Acc:MGI:2685256])

HSP 1 Score: 118.242 bits (295), Expect = 5.354e-30
Identity = 66/193 (34.20%), Postives = 101/193 (52.33%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEIL 773
            MR+FI +E    + D+    SVG IK++I     IP     L  + Q R  L L  +GA L + W LSD+ I+  STLK ++K E  P LY         +P++E M L +  V DLR L + + G P SV+ + T    E++DC  ++DY     + ++++ WDGW EFL    LG   +V   ++ +  +L
Sbjct:    1 MRIFIAFEGSFEAFDVEAHTSVGAIKQMIKDYFHIP-----LSEDKQGRWYLELMYAGAALRNSWSLSDVGISFCSTLKCFVKKEDKPTLYVFNAVTQEMMPIMENMSLLDKKVSDLRMLVTLRCGFPVSVYCLRTPTGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKPKVQHYLSKEGPVL 188          
BLAST of Protein ANKUB1 vs. UniProt/SwissProt
Match: sp|A6NFN9|ANKUB_HUMAN (Protein ANKUB1 OS=Homo sapiens OX=9606 GN=ANKUB1 PE=2 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 4.447e-73
Identity = 133/373 (35.66%), Postives = 209/373 (56.03%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRS 1313
            MR+FI +E      D+   E+V  +K +I     IP     L  + Q R+ L L  +GA L D W L+D+ I+  STLK ++K E  P LY       +T+PV+E + L + +V DLR+L + + GLP SV+ + T    E++DC  ++DY     + ++++ WDGW EFL    LG   +V   ++ +  +L +YQ++VA+YIAA  G+++L     K G  P E VG+HP R WC    H D  K PIH A E GQL +L++FV+ S+  + CK+  G  PL I  + K K+C  +LLSK WS + F   ++ + ++ K+K+W  RA+   S SL+  +    R        VG  + +DG++  +++S+S
Sbjct:    1 MRIFIAFEGSFEPFDVSADETVEVVKLMIKDYFHIP-----LSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQDTMPVMESISLLDKTVSDLRTLVTLRCGLPVSVYCLRTPRGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRYLSKEGPVL-KYQKRVALYIAAFCGYIELTEWALKQGARPHEAVGVHPYRAWCHEALHADVSKCPIHAAAEAGQLLILKAFVNYSVLCLECKNAAGQTPLTIVFKHKHKDCVLYLLSKMWSTVSFPKISVPMRIYIKIKQWILRAQ---SHSLHKSQFCGAR---VFGAKVGDTVMVDGFTKPKMTSKS 361          
BLAST of Protein ANKUB1 vs. UniProt/SwissProt
Match: sp|Q3UUE9|ANKUB_MOUSE (Protein ANKUB1 OS=Mus musculus OX=10090 GN=Ankub1 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.745e-29
Identity = 66/193 (34.20%), Postives = 101/193 (52.33%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEIL 773
            MR+FI +E    + D+    SVG IK++I     IP     L  + Q R  L L  +GA L + W LSD+ I+  STLK ++K E  P LY         +P++E M L +  V DLR L + + G P SV+ + T    E++DC  ++DY     + ++++ WDGW EFL    LG   +V   ++ +  +L
Sbjct:    1 MRIFIAFEGSFEAFDVEAHTSVGAIKQMIKDYFHIP-----LSEDKQGRWYLELMYAGAALRNSWSLSDVGISFCSTLKCFVKKEDKPTLYVFNAVTQEMMPIMENMSLLDKKVSDLRMLVTLRCGFPVSVYCLRTPTGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKPKVQHYLSKEGPVL 188          
BLAST of Protein ANKUB1 vs. TrEMBL
Match: A0A267GDX2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021153g2 PE=4 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 3.930e-167
Identity = 245/611 (40.10%), Postives = 376/611 (61.54%), Query Frame = 3
Query:  150 LCDPICYLSNGKRKLMRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKD-GITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFAN--IEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSATEESDLQIDIQDVVTKEKP-----------FKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIXXXXXXVTNTNDQSLKFNQNKG-DAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNL 1937
            L D  C+ S G+RK MRLFI +EN R +MD+P G++VG IK++I  +  I  + + LG+ N  R  LVL  +G EL D W+LSD+ I PGSTL+AY+K E DP+LY ++ YN   +P+L+++ L    V  LRS+AS++SGLP  +FR+ T    E+FDC+ +++Y +     +++ETWDGW + L LS+LGFT+ + ++I+  DE+LA++Q KVA+Y+AAHFG V+L+  + +  G+   E VG HPL+QWC   +H D  K PIHEAVE GQL VLR FVH ++ SI+ +DG GLQPLN+ALR+K K+CASFLL+KQWSRI +   T+ +++F ++K W+E+AK+R ++    ++ + K+K I+ +PLVGQG+Y+DG+S  Q++S +K P+ K        I+ YY  +Y   PE +FK       K++K         +      +   +++   +   D  +   P            KLP +   S        S       ++      +K+ ++ +     SL+  + KG D  +PLPL SV+ TPRP+ ++   QT+E+ + ++ YY+ RG   REYAI+CL+ +   KDK WL QV++AM+ 
Sbjct:   32 LADSTCFNSVGERKKMRLFICHENGRNTMDVPEGKTVGAIKQIIKDRFKIRVDQVQLGDINFERNTLVLAYAGGELDDRWVLSDMGIKPGSTLRAYVKEETDPVLYLRLCYNEEMVPILDRLNLTGFPVSALRSMASRRSGLPVGIFRLATSQGVEMFDCHSLDEYSVKPGDTVRVETWDGWTDLLRLSALGFTSHLLEKISPTDEVLAKFQMKVALYMAAHFGQVELSTTLTRQHGVRADEAVGPHPLKQWCTAERHPDLKKTPIHEAVEMGQLSVLRGFVHHNVCSIMVRDGAGLQPLNLALRQKQKSCASFLLTKQWSRIGYGSGTVPLAIFARMKNWSEKAKDRVTVLYGQEKSSLKKKPIKDYPLVGQGVYVDGFSQQQLNSSNKPPANKQETEVTRAIDRYYSAVYRTDPEDHFK----KITKLMKTPKQKSKWSKMAGAGGNRGEQDAAASMARADSASTTPPHTQQQQQAPGGVKLPPLQQSS-------GSAVYIETGKQAAKKQPQKQLQQKSQATTSSLQLTKAKGNDGAIPLPLHSVEDTPRPFMHLRKGQTNEVQQVLDLYYRQRGVPAREYAIQCLSAAQSFKDKPWLHQVRLAMSF 631          
BLAST of Protein ANKUB1 vs. TrEMBL
Match: A0A1I8GPE4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010110g1 PE=4 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 4.171e-166
Identity = 255/619 (41.20%), Postives = 388/619 (62.68%), Query Frame = 3
Query:  144 NELCDPICYLSNGKRKLMRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKD-GITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFAN--IEAYYQNLYGISPEQYFKSPDDSTGKVVKNRN--FNRSGHRRVNRISSSATEESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQS----------YGISQEI-----QSNFIXXXXXXVTNTNDQSLKFNQNKG-DAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNL 1937
            + L D  CY   G+RK MR+FI +EN R S+D+P G++V  IK++I  +  I  + + LG+ N  R  LVL+ +GAEL D WILSD+ I PG+TL+AY+K E DP+LY ++GY+   +P+L+++KL   +V  LR +AS+++GLP  VFR+ T +  E++DC+ +EDY +     I++ETWDGW + L L+SLGFT+ V + +N  D+ LA++Q KVA+Y+AAHFG V+L+  + +  GI   E VG HPL+QWC   +H D  K+PIHEAVE GQL VLR FVH ++ SI+ +DG GLQPLN+ALR+K K+CASFLL+KQWSRIP++ +T+ +++F ++K W+++AK++ S+    D+ + K+K +R FPLVGQG+YIDGYS   ++S  K P  K     +  +E+YY    G  PE +FKS   S  K+ K +N     +G++  +     A E                  +LP +     +++SR SS +S           G   EI     Q    ++++ K    N  +    + KG D  +PLP++S+D TPRP+ ++   + +E+ + ++ Y+K RG   REYAI+CL+ + + K+K WL QV++AM  
Sbjct:   17 DTLADSTCYNCVGERKRMRVFICHENGRSSLDLPEGKTVADIKQIIKDRFKIRVDQVQLGDINFERNTLVLSYAGAELDDRWILSDMGIRPGATLRAYVKEETDPVLYLRVGYSEELMPILDRIKLLNYTVASLRGMASRRTGLPVGVFRLTTSSGAEMYDCHTMEDYSVRPGDTIRVETWDGWTDLLKLASLGFTSHVLELVNRTDDALAKFQMKVALYMAAHFGQVELSTTLTRQCGIRCDEAVGAHPLKQWCSAERHPDLKKSPIHEAVESGQLSVLRGFVHHNVCSIMVRDGAGLQPLNLALRQKQKSCASFLLTKQWSRIPYSNSTVPLAIFARMKNWSDKAKDKVSVLQGQDKSSLKKKQLREFPLVGQGVYIDGYSRQLLNSNPKAPVMKHESSVSRAVESYYARHLG-DPESHFKSAIKSL-KIPKQKNKWAKMAGNKPPDGAEEPAGE------------------RLPPLGRDRQQLQSRPSSAKSATATAQQQQTVGAGPEINPQPQQKQQQQQQQPKPGKQNASASLLAKAKGNDGSIPLPIQSIDDTPRPFLHLKRGEVNEVKQVLDLYHKHRGVPSREYAIQCLSAAQNFKEKPWLHQVRLAMTF 615          
BLAST of Protein ANKUB1 vs. TrEMBL
Match: A0A267DLG3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021153g3 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 1.237e-165
Identity = 246/607 (40.53%), Postives = 371/607 (61.12%), Query Frame = 3
Query:  150 LCDPICYLSNGKRKLMRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKD-GITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFAN--IEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSAT-------EESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIXXXXXXVTNTNDQSLKFNQNKG-DAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNL 1937
            L D  C+ S G+RK MRLFI +EN R +MD+P G++VG IK++I  +  I  + + LG+ N  R  LVL  +G EL D W+LSD+ I PGSTL+AY+K E DP+LY ++ YN   +P+L+++ L    V  LRS+AS++SGLP  +FR+ T    E+FDC+ +++Y +     +++ETWDGW + L LS+LGFT+ + ++I+  DE+LA++Q KVA+Y+AAHFG V+L+  + +  G+   E VG HPL+QWC   +H D  K PIHEAVE GQL VLR FVH ++ SI+ +DG GLQPLN+ALR+K K+CASFLL+KQWSRI +   T+ +++F ++K W+E+AK+R ++    ++ + K+K I+ +PLVGQG+Y+DG+S  Q++S +K P+ K        I+ YY  +Y   PE +FK          +   + +      NR    A          S      Q         KLP +   S        S       ++      +K+ ++ +     SL+  + KG D  +PLPL SV+ TPRP+ ++   QT+E+ + ++ YY+ RG   REYAI+CL+ +   KDK WL QV++AM+ 
Sbjct:   67 LADSTCFNSVGERKKMRLFICHENGRNTMDVPEGKTVGAIKQIIKDRFKIRVDQVQLGDINFERNTLVLAYAGGELDDRWVLSDMGIKPGSTLRAYVKEETDPVLYLRLCYNEEMVPILDRLNLTGFPVSALRSMASRRSGLPVGIFRLATSQGVEMFDCHSLDEYSVKPGDTVRVETWDGWIDLLRLSALGFTSHLLEKISPTDEVLAKFQMKVALYMAAHFGQVELSTTLTRQHGVRADEAVGPHPLKQWCTAERHPDLKKTPIHEAVEMGQLSVLRGFVHHNVCSIMVRDGAGLQPLNLALRQKQKSCASFLLTKQWSRIGYGSGTVPLAIFARMKNWSEKAKDRVTVLYGQEKSSLKKKPIKGYPLVGQGVYVDGFSQQQLNSSNKPPANKQETEVTRAIDRYYSAMYRTDPEDHFKKVTKLMKTPKQKSKWAKMAGAGGNRGDQDAAAPMARIDSASTTPPQTQQQQQAPGGVKLPPLQQSS-------GSAVYIETGKQAAKKQPQKQLQQKSQATTSSLQLTKAKGNDGAIPLPLHSVEDTPRPFLHLRKGQTNEVQQVLDLYYRQRGVPAREYAIQCLSAAQSFKDKPWLHQVRLAMSF 666          
BLAST of Protein ANKUB1 vs. TrEMBL
Match: A0A1I8GR02 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 1.749e-165
Identity = 246/607 (40.53%), Postives = 371/607 (61.12%), Query Frame = 3
Query:  150 LCDPICYLSNGKRKLMRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKD-GITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFAN--IEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSAT-------EESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIXXXXXXVTNTNDQSLKFNQNKG-DAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNL 1937
            L D  C+ S G+RK MRLFI +EN R +MD+P G++VG IK++I  +  I  + + LG+ N  R  LVL  +G EL D W+LSD+ I PGSTL+AY+K E DP+LY ++ YN   +P+L+++ L    V  LRS+AS++SGLP  +FR+ T    E+FDC+ +++Y +     +++ETWDGW + L LS+LGFT+ + ++I+  DE+LA++Q KVA+Y+AAHFG V+L+  + +  G+   E VG HPL+QWC   +H D  K PIHEAVE GQL VLR FVH ++ SI+ +DG GLQPLN+ALR+K K+CASFLL+KQWSRI +   T+ +++F ++K W+E+AK+R ++    ++ + K+K I+ +PLVGQG+Y+DG+S  Q++S +K P+ K        I+ YY  +Y   PE +FK          +   + +      NR    A          S      Q         KLP +   S        S       ++      +K+ ++ +     SL+  + KG D  +PLPL SV+ TPRP+ ++   QT+E+ + ++ YY+ RG   REYAI+CL+ +   KDK WL QV++AM+ 
Sbjct:   32 LADSTCFNSVGERKKMRLFICHENGRNTMDVPEGKTVGAIKQIIKDRFKIRVDQVQLGDINFERNTLVLAYAGGELDDRWVLSDMGIKPGSTLRAYVKEETDPVLYLRLCYNEEMVPILDRLNLTGFPVSALRSMASRRSGLPVGIFRLATSQGVEMFDCHSLDEYSVKPGDTVRVETWDGWIDLLRLSALGFTSHLLEKISPTDEVLAKFQMKVALYMAAHFGQVELSTTLTRQHGVRADEAVGPHPLKQWCTAERHPDLKKTPIHEAVEMGQLSVLRGFVHHNVCSIMVRDGAGLQPLNLALRQKQKSCASFLLTKQWSRIGYGSGTVPLAIFARMKNWSEKAKDRVTVLYGQEKSSLKKKPIKGYPLVGQGVYVDGFSQQQLNSSNKPPANKQETEVTRAIDRYYSAMYRTDPEDHFKKVTKLMKTPKQKSKWAKMAGAGGNRGDQDAAAPMARIDSASTTPPQTQQQQQAPGGVKLPPLQQSS-------GSAVYIETGKQAAKKQPQKQLQQKSQATTSSLQLTKAKGNDGAIPLPLHSVEDTPRPFLHLRKGQTNEVQQVLDLYYRQRGVPAREYAIQCLSAAQSFKDKPWLHQVRLAMSF 631          
BLAST of Protein ANKUB1 vs. TrEMBL
Match: A0A1I8HMX1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 489.574 bits (1259), Expect = 4.865e-162
Identity = 244/600 (40.67%), Postives = 369/600 (61.50%), Query Frame = 3
Query:  150 LCDPICYLSNGKRKLMRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKD-GITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFAN--IEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSATEESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIXXXXXXVTNTNDQSLKFNQNKG-DAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNL 1937
            L D  C+ S G+RK MRLFI +EN R +MD+P G++VG IK++I  +  I  + + LG+ N  R  LVL  +G EL D W+LSD+ I PGSTL+AY+K E DP+LY ++ YN   +P+L+++ L    V  LRS+AS++SGLP  +FR+ T    E+FDC+ +++Y +     +++ETWDGW + L LS+LGFT+ + ++I+  DE+LA++Q KVA+Y+AAHFG V+L+  + +  G+   E VG HPL+QWC   +H D  K PIHEAVE GQL VLR FVH ++ SI+ +DG GLQPLN+ALR+K K+CASFLL+KQWSRI +   T+ +++F ++K W+E+AK+R ++    ++ + K+K I+ +PLVGQG+Y+DG+S  Q++S +K P+ K        I+ YY      S  ++ K         +     NR G +      + A   S      Q         KLP +   S        S       ++      +K+ ++ +     SL+  + KG D  +PLPL SV+ TPRP+ ++   QT+E+ + ++ YY+ RG   REYAI+CL+ +   KDK WL QV++AM+ 
Sbjct:   32 LADSTCFNSVGERKKMRLFICHENGRNTMDVPEGKTVGAIKQIIKDRFKIRVDQVQLGDINFERNTLVLAYAGGELDDRWVLSDMGIKPGSTLRAYVKEETDPVLYLRLCYNEEMVPILDRLNLTGFPVSALRSMASRRSGLPVGIFRLATSQGVEMFDCHSLDEYSVKPGDTVRVETWDGWTDLLRLSALGFTSHLLEKISPTDEVLAKFQMKVALYMAAHFGQVELSTTLTRQHGVRADEAVGPHPLKQWCTAERHPDLKKTPIHEAVEMGQLSVLRGFVHHNVCSIMVRDGAGLQPLNLALRQKQKSCASFLLTKQWSRIGYGSGTVPLAIFARMKNWSEKAKDRVTVLYGQEKSSLKKKPIKDYPLVGQGVYVDGFSQQQLNSSNKPPANKQETEVTRAIDRYY------SASKWSK---------MAGAGGNR-GEQDAAASMARADSASTTPPHTQQQQQAPGGVKLPPLQQSS-------GSAVYIETGKQAAKKQPQKQLQQKSQATTSSLQLTKAKGNDGAIPLPLHSVEDTPRPFMHLRKGQTNEVQQVLDLYYRQRGVPAREYAIQCLSAAQSFKDKPWLHQVRLAMSF 608          
BLAST of Protein ANKUB1 vs. Ensembl Nematostella
Match: EDO35529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL87])

HSP 1 Score: 109.768 bits (273), Expect = 9.963e-28
Identity = 59/179 (32.96%), Postives = 97/179 (54.19%), Query Frame = 3
Query:  195 MRLFITYENERVSMDIPFGESVGKIKELIIKKMSIP--QNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLG 725
            MR+ I +   R  +D+   ++V  +K+L+ KK  +   QN      E +    L LN +G  L D WI +D+ I PG TL+  +       L     Y+   +   E M L + +V DL+++ + K+GL  SVFR++    KE+FDC +++DY+I     I++ETW+GW +FL  ++ G
Sbjct:    1 MRVVILFHGFRHCLDVSPTQTVADMKQLLRKKFDLDTVQNE-----ETENDIFLSLNYAGGVLEDDWIFADIGIPPGVTLRCELIQNTKSYLNVHCAYSGEIVKFTEPMSLFDTTVGDLKTMVTNKTGLHVSVFRLVIPEGKEMFDCNLLKDYNISTGDTIRLETWNGWADFLKAATKG 174          
BLAST of Protein ANKUB1 vs. Planmine SMEST
Match: SMESG000033543.1 (SMESG000033543.1)

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 617/621 (99.36%), Postives = 619/621 (99.68%), Query Frame = 3
Query:  132 MSVDNELCDPICYLSNGKRKLMRLFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFANIEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSATEESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIXXXXXXVTNTNDQSLKFNQNKGDAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNLGXXXXXXXXXXXXXXILIK 1994
            MSVDNELCDPICYLSNGKRKLMR+FITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSV DLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVH SITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFANIEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSAT+ESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIKKKKKKVTNTNDQSLKFNQNKGDAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNLGKESVKKSVKFKSDSILIK
Sbjct:    1 MSVDNELCDPICYLSNGKRKLMRVFITYENERVSMDIPFGESVGKIKELIIKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLKAYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVPDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFTAQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHHSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERAKERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKKPNKFANIEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRISSSATDESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQEIQSNFIKKKKKKVTNTNDQSLKFNQNKGDAGLPLPLRSVDYTPRPYYYVSSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAMNLGKESVKKSVKFKSDSILIK 621          
BLAST of Protein ANKUB1 vs. Planmine SMEST
Match: SMESG000060742.1 (SMESG000060742.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.339e-8
Identity = 54/242 (22.31%), Postives = 101/242 (41.74%), Query Frame = 3
Query:  471 KIGYNLNTIPVLEKMKLQELS----VLDLRSLASKKSGLPCSVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFL---------HLSSLGFTAQVSDRINSDDEILARYQRK--------VAMYIAAHFGHVDLAINMCKDGITPGEPVGLHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGNGLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNT 1133
            +I  N+N +P  E  KL  +     + DLRS     +G+P ++  +   +  ++ D   ++  DI +N+ + ++ W  W E +          + ++G T Q SD      EIL   +++        +A+ IA+H GH++L   + K G        L                +  +H A    +  ++   + +   +I  KD NGL P+ +A +   K+C   L   +W +   N  T
Sbjct:    8 QINININLLPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITAVVKNDIAKIFTMGVT-QDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLG---------------RTALHLAAAKDKSEIIDLLLLKG-ANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMET 232          
The following BLAST results are available for this feature:
BLAST of Protein ANKUB1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ANKUB19.260e-7435.66ankyrin repeat and ubiquitin domain containing 1 [... [more]
ANKUB12.178e-7335.66ankyrin repeat and ubiquitin domain containing 1 [... [more]
back to top
BLAST of Protein ANKUB1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ANKUB1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ANKUB1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ANKUB1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pou4f1.26.173e-6427.98POU class 4 homeobox 1 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Protein ANKUB1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ankub13.727e-7235.28ankrin repeat and ubiquitin domain containing 1 [S... [more]
Ankub11.023e-7135.28ankrin repeat and ubiquitin domain containing 1 [S... [more]
Ankub15.354e-3034.20ankrin repeat and ubiquitin domain containing 1 [S... [more]
back to top
BLAST of Protein ANKUB1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A6NFN9|ANKUB_HUMAN4.447e-7335.66Protein ANKUB1 OS=Homo sapiens OX=9606 GN=ANKUB1 P... [more]
sp|Q3UUE9|ANKUB_MOUSE3.745e-2934.20Protein ANKUB1 OS=Mus musculus OX=10090 GN=Ankub1 ... [more]
back to top
BLAST of Protein ANKUB1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GDX23.930e-16740.10Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GPE44.171e-16641.20Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DLG31.237e-16540.53Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GR021.749e-16540.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HMX14.865e-16240.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Protein ANKUB1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ANKUB1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ANKUB1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ANKUB1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO355299.963e-2832.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein ANKUB1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ANKUB1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000033543.10.000e+099.36SMESG000033543.1[more]
SMESG000060742.11.339e-822.31SMESG000060742.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032910 ID=SMED30032910|Name=Protein ANKUB1|organism=Schmidtea mediterranea sexual|type=transcript|length=2035bp
TAATTCATTATCAACACTCATTATAAATTATTCCAAAATCCAAATCGTAC
GATTAATAATTTGGTATTTAATTATTGCTATTAAATACCGATTTTATTAA
TCGTACGATTTGGATTTTGGAATAATTTATAATGAGTGTTGATAATGAAT
TATGCGATCCGATATGTTATCTATCCAATGGAAAAAGAAAACTCATGCGT
CTCTTTATTACATATGAAAACGAACGGGTTTCGATGGATATACCATTTGG
GGAATCTGTTGGAAAAATCAAAGAATTAATAATCAAGAAAATGTCTATTC
CACAAAACAATATTCACTTAGGTAACGAAAATCAAATGAGGAAAGTTCTT
GTTTTAAATTGCTCTGGAGCAGAATTACCCGATCACTGGATATTGTCTGA
CCTGAGCATTACTCCCGGATCTACTTTGAAAGCTTACATGAAAGGTGAGA
TGGATCCAATCTTGTATTTTAAAATTGGTTACAATTTAAACACTATTCCC
GTTTTGGAAAAGATGAAATTACAAGAACTGTCTGTACTGGATCTCAGATC
GTTAGCATCAAAAAAGTCTGGCTTGCCTTGTAGCGTCTTTAGAATGATGA
CAGAAAACAATAAAGAAATTTTCGACTGTTATATGGTCGAGGATTATGAC
ATACATGCCAATAGTGTTATCAAAATTGAAACGTGGGATGGTTGGAATGA
ATTTCTGCATCTGAGTTCCTTGGGTTTCACAGCACAAGTGTCAGACAGAA
TTAATTCTGACGATGAAATACTCGCCAGATATCAAAGAAAGGTCGCTATG
TATATAGCTGCACACTTTGGGCATGTCGATTTAGCCATAAATATGTGTAA
AGATGGGATCACGCCAGGTGAACCGGTTGGTTTGCATCCATTGCGTCAGT
GGTGCCCCAATAACCAGCATATTGATAATTTTAAAGCTCCAATTCATGAA
GCAGTAGAATGCGGACAATTGGGAGTTCTTCGAAGTTTTGTACACCAAAG
TATAACAAGCATTCTTTGTAAAGACGGCAATGGACTTCAACCACTTAATA
TTGCATTAAGAAAGAAAATAAAAAATTGTGCATCTTTTCTTCTTAGTAAG
CAATGGAGTCGCATTCCATTTAATGGAAATACAATTACAATATCTGTATT
CAATAAATTAAAGAAATGGACGGAAAGAGCGAAAGAAAGAGCTAGTCTGA
GTTTAAATTCAGATAGGCCTGCTGCTAAACGAAAAATCATTCGATTATTT
CCATTAGTTGGGCAAGGAATTTACATTGATGGATATTCCGCTGATCAAAT
TAGTAGTAGATCTAAATTCCCGTCGAAAAAACCAAATAAATTTGCTAATA
TAGAAGCATACTATCAAAATCTTTACGGGATTTCTCCTGAACAGTATTTT
AAAAGTCCTGATGATTCTACTGGCAAAGTTGTTAAAAATCGGAATTTTAA
CAGATCTGGACACAGAAGGGTCAATAGAATTTCTTCCTCAGCAACGGAGG
AATCTGATCTACAAATAGATATTCAAGATGTAGTTACAAAAGAGAAACCT
TTCAAATTACCAAAAATTCATTCTGGATCATATGAAATGAGATCTCGAGC
ATCAAGCATGCAAAGTTATGGAATTTCTCAAGAAATTCAGTCAAATTTTA
TAAAGAAGAAAAAGAAAAAGGTTACAAATACAAATGATCAAAGTTTAAAG
TTTAACCAAAATAAAGGCGATGCTGGCCTACCTCTACCACTGAGGAGTGT
TGATTACACTCCTCGGCCATATTACTATGTCAGTTCGAATCAAACTGATG
AAATTTCCAAATCAATCGAGACTTATTATAAAGATAGGGGATATTTGCCA
CGAGAATATGCGATAAAGTGTTTGACTTTGAGTAACCACCTGAAAGATAA
ATCCTGGCTATCTCAAGTTCAAATTGCTATGAATCTAGGAAAGGAAAGTG
TTAAGAAAAGTGTCAAATTTAAATCGGATTCAATTCTCATTAAATAAACT
GATAATTTTCATAAATACACAAATATTTTCTAGAG
back to top

protein sequence of SMED30032910-orf-1

>SMED30032910-orf-1 ID=SMED30032910-orf-1|Name=SMED30032910-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=622bp
MSVDNELCDPICYLSNGKRKLMRLFITYENERVSMDIPFGESVGKIKELI
IKKMSIPQNNIHLGNENQMRKVLVLNCSGAELPDHWILSDLSITPGSTLK
AYMKGEMDPILYFKIGYNLNTIPVLEKMKLQELSVLDLRSLASKKSGLPC
SVFRMMTENNKEIFDCYMVEDYDIHANSVIKIETWDGWNEFLHLSSLGFT
AQVSDRINSDDEILARYQRKVAMYIAAHFGHVDLAINMCKDGITPGEPVG
LHPLRQWCPNNQHIDNFKAPIHEAVECGQLGVLRSFVHQSITSILCKDGN
GLQPLNIALRKKIKNCASFLLSKQWSRIPFNGNTITISVFNKLKKWTERA
KERASLSLNSDRPAAKRKIIRLFPLVGQGIYIDGYSADQISSRSKFPSKK
PNKFANIEAYYQNLYGISPEQYFKSPDDSTGKVVKNRNFNRSGHRRVNRI
SSSATEESDLQIDIQDVVTKEKPFKLPKIHSGSYEMRSRASSMQSYGISQ
EIQSNFIKKKKKKVTNTNDQSLKFNQNKGDAGLPLPLRSVDYTPRPYYYV
SSNQTDEISKSIETYYKDRGYLPREYAIKCLTLSNHLKDKSWLSQVQIAM
NLGKESVKKSVKFKSDSILIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR042788ANKUB1
IPR029071Ubiquitin-like_domsf
IPR020683Ankyrin_rpt-contain_dom
IPR000626Ubiquitin-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 189..333
e-value: 1.4E-6
score: 30.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 197..323
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 21..104
e-value: 1.0E-6
score: 30.5
NoneNo IPR availableCDDcd17050Ubl1_ANKUB1coord: 22..104
e-value: 1.13302E-22
score: 90.0513
NoneNo IPR availableCDDcd17051Ubl2_ANKUB1coord: 106..188
e-value: 6.98421E-24
score: 93.4832
IPR042788Protein ANKUB1PANTHERPTHR46885FAMILY NOT NAMEDcoord: 22..408
coord: 499..612
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 22..104
score: 9.286
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 13..101