Alpha-galactosidase

Overview
NameAlpha-galactosidase
Smed IDSMED30032907
Length (bp)1488
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032907

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032907h1SMcG0022505 Contig169GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032907h1SMcG0022504 Contig169GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30032907h1SMcG0022505 Contig50317newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032907h1SMcG0022505 Contig50317uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30032907h1SMcG0022504 dd_Smed_v6_606_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032907h1SMcG0022505 dd_Smed_v6_606_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: NAGA (alpha-N-acetylgalactosaminidase [Source:HGNC Symbol;Acc:HGNC:7631])

HSP 1 Score: 330.487 bits (846), Expect = 1.004e-108
Identity = 176/388 (45.36%), Postives = 238/388 (61.34%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVG---FSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            DNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPLLMS DLR I+  ++ +L N  ++ INQDPLG QG+ +  EK+LI+V+ R LS   +A+   +      + Y Y + +G   F+    Y+  D ++      +   T  T  +  + + + Y+Y
Sbjct:   19 DNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSC--RTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLY 401          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: NAGA (alpha-N-acetylgalactosaminidase [Source:HGNC Symbol;Acc:HGNC:7631])

HSP 1 Score: 330.487 bits (846), Expect = 1.004e-108
Identity = 176/388 (45.36%), Postives = 238/388 (61.34%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVG---FSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            DNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPLLMS DLR I+  ++ +L N  ++ INQDPLG QG+ +  EK+LI+V+ R LS   +A+   +      + Y Y + +G   F+    Y+  D ++      +   T  T  +  + + + Y+Y
Sbjct:   19 DNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSC--RTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLY 401          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: NAGA (alpha-N-acetylgalactosaminidase [Source:HGNC Symbol;Acc:HGNC:7631])

HSP 1 Score: 330.487 bits (846), Expect = 1.004e-108
Identity = 176/388 (45.36%), Postives = 238/388 (61.34%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVG---FSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            DNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPLLMS DLR I+  ++ +L N  ++ INQDPLG QG+ +  EK+LI+V+ R LS   +A+   +      + Y Y + +G   F+    Y+  D ++      +   T  T  +  + + + Y+Y
Sbjct:   19 DNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSC--RTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLY 401          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: GLA (galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4296])

HSP 1 Score: 309.301 bits (791), Expect = 2.928e-100
Identity = 164/332 (49.40%), Postives = 205/332 (61.75%), Query Frame = 3
Query:  240 IPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNP-STQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            IP     DNGLARTP MGW+ WERF C  DC + P  CISE L +  A  M   G+  AGYEY+ IDDCW+   R  +G L  DP RFP+G+  L+  +HS GLK GIY D G KTC G+PGS  +   D  TF  W VD +K DGCY +       GY   S  LN T R IV+SC WP Y       P+ T++ Q  CN WR + DIDDSW S+  I+++   N  +    A PG WNDPDML+IGN GL++NQQ  QM +WAI AAPL MSNDLR I+  +  LL +K+++AINQDPLGKQG  L + +  +VW R LS    A+A++N
Sbjct:   26 IPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ-KPNYTEIRQ-YCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMIN 355          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: GLA (galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4296])

HSP 1 Score: 289.271 bits (739), Expect = 6.645e-92
Identity = 164/373 (43.97%), Postives = 205/373 (54.96%), Query Frame = 3
Query:  240 IPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECIS-----------------------------------------ENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNP-STQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            IP     DNGLARTP MGW+ WERF C  DC + P  CIS                                         E L +  A  M   G+  AGYEY+ IDDCW+   R  +G L  DP RFP+G+  L+  +HS GLK GIY D G KTC G+PGS  +   D  TF  W VD +K DGCY +       GY   S  LN T R IV+SC WP Y       P+ T++ Q  CN WR + DIDDSW S+  I+++   N  +    A PG WNDPDML+IGN GL++NQQ  QM +WAI AAPL MSNDLR I+  +  LL +K+++AINQDPLGKQG  L + +  +VW R LS    A+A++N
Sbjct:   26 IPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISWSFALVAQAGVQCHDLGSPQPPPPRFKQFSCLILASSWNYSEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ-KPNYTEIRQY-CNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMIN 396          
BLAST of Alpha-galactosidase vs. Ensembl Celegans
Match: gana-1 (Alpha-galactosidase [Source:UniProtKB/TrEMBL;Acc:Q21801])

HSP 1 Score: 284.648 bits (727), Expect = 9.822e-91
Identity = 165/377 (43.77%), Postives = 221/377 (58.62%), Query Frame = 3
Query:  234 ILIPL--CLGS---DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT--KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRT-----AIAVLNAGNSD--QIFYLYLTDVGFSIDKQYDVSDAFT 1322
            +L+PL  C+G+   DNGL RTPPMGWM+W  F C  DCVK+P+ CI+E L    A  +   G+   GY+ + IDDCW    R   G L+ +  RFP+GM  L+  +H  GLKFGIYEDYGTKTCGGYPGS  H K D  TF  W+VDY+KLDGC  + +  P GY  +   LN T RPI++SCSWPAY       P L    L+   CN WR +DDI+ SW S++ II+Y+    +K      PG W+DPDML+IGN G+  +    Q  +W I++APL+MSNDLR I D    +L NK  + INQDPLG  G+ +     I V+ + ++ S+      A A LN    +  +   + L  +G +    Y V D ++
Sbjct:    3 LLLPLLFCVGAFCLDNGLGRTPPMGWMSWTAFYCEIDCVKHPTGCINEQLYKDMADQLVSGGYDKVGYKSVHIDDCWSEMERDSHGILVANKTRFPSGMKALAKYMHDRGLKFGIYEDYGTKTCGGYPGSYKHEKVDAQTFAAWDVDYLKLDGCNIDQAMMPIGYPLFEKELNETGRPIMYSCSWPAYLIDH---PELVNYNLIGKYCNTWRNFDDINSSWKSIISIISYYDKMQDKHIPTHGPGKWHDPDMLVIGNKGITLDMSISQFTVWCIWSAPLIMSNDLRIIGDSFKDVLKNKEAIKINQDPLGIMGRLIKNSTDIGVYVKQITPSKGDKKSFAFAYLNRNEKEGYKRIEIQLASIGLTDPAGYYVHDIWS 376          
BLAST of Alpha-galactosidase vs. Ensembl Fly
Match: CG7997 (gene:FBgn0034117 transcript:FBtr0087172)

HSP 1 Score: 360.533 bits (924), Expect = 1.241e-120
Identity = 180/379 (47.49%), Postives = 246/379 (64.91%), Query Frame = 3
Query:  222 ISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKD-GSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLS------QSRTAIAVLNAGNSDQIFYLYLT--DVGFSIDKQYDVSDAFTMST 1331
            I L  ++ L +G DNGLA  PPMGWM+WERFRC TDC  YP ECISE L    A  +   G++ AGYEY++IDDCWL K+R  D   L+PD  RFPNG+  LS  IH+ GLKFG+Y+DYGT TC GYPG + H+K D  TF  W+VDY+KLDGCY+N S    GY E+   LN T RP+V+SCSWPAY +     P    L Q  CNLWR +DDI+DS  S++ II+Y   N ++      PGHWNDPDML++GN GL+Y+Q ++QM +WAI AAPL+MSNDL  +  +   +L N+ ++A++QD LG QG+ +  +N I+VW+R ++          A+A ++  +    + +  T  ++G +  K Y+V D +  S+
Sbjct:   12 ILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKLFQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHNQGLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMASGYPEFGRLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQ-HCNLWRNWDDIEDSLESLMQIIDYFAKNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLAAVRPEIKAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGAPYRIPFTVKELGLTNPKGYNVQDLYDASS 389          
BLAST of Alpha-galactosidase vs. Ensembl Fly
Match: CG7997 (gene:FBgn0034117 transcript:FBtr0087171)

HSP 1 Score: 360.533 bits (924), Expect = 1.241e-120
Identity = 180/379 (47.49%), Postives = 246/379 (64.91%), Query Frame = 3
Query:  222 ISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKD-GSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLS------QSRTAIAVLNAGNSDQIFYLYLT--DVGFSIDKQYDVSDAFTMST 1331
            I L  ++ L +G DNGLA  PPMGWM+WERFRC TDC  YP ECISE L    A  +   G++ AGYEY++IDDCWL K+R  D   L+PD  RFPNG+  LS  IH+ GLKFG+Y+DYGT TC GYPG + H+K D  TF  W+VDY+KLDGCY+N S    GY E+   LN T RP+V+SCSWPAY +     P    L Q  CNLWR +DDI+DS  S++ II+Y   N ++      PGHWNDPDML++GN GL+Y+Q ++QM +WAI AAPL+MSNDL  +  +   +L N+ ++A++QD LG QG+ +  +N I+VW+R ++          A+A ++  +    + +  T  ++G +  K Y+V D +  S+
Sbjct:   12 ILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKLFQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHNQGLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMASGYPEFGRLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQ-HCNLWRNWDDIEDSLESLMQIIDYFAKNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLAAVRPEIKAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGAPYRIPFTVKELGLTNPKGYNVQDLYDASS 389          
BLAST of Alpha-galactosidase vs. Ensembl Fly
Match: CG5731 (gene:FBgn0032192 transcript:FBtr0079959)

HSP 1 Score: 340.887 bits (873), Expect = 4.942e-113
Identity = 168/318 (52.83%), Postives = 214/318 (67.30%), Query Frame = 3
Query:  249 CLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLS 1202
            CL  DNGLA+TPPMGW++WERFRC TDCV  P  CISE L  +    +  +G++S GYEYI IDDCWL K R+ DG L+ D  RFPNG+  LS  IHS GLKFGIYEDYG  TC GYPG + + ++D   F  W VDY+KLDGCY+ P     GY+ +   LN T + +V+SCSWP Y     I P+ +  +Q+ CNLWR YDDI DSW SV  II+Y+  N +  +  A PGHWNDPDMLIIGN GL+Y Q + Q  +W+I AAPLLMS DLR I      +L N+ I+A++QDPLG QG+ +++   I++W R + 
Sbjct:   17 CL--DNGLAKTPPMGWLSWERFRCNTDCVNDPDNCISEQLFQTMTDIVVADGYASVGYEYINIDDCWLEKHRSHDGKLVADRKRFPNGIKALSDYIHSRGLKFGIYEDYGNYTCAGYPGIIGYEEKDALQFADWNVDYVKLDGCYALPYDMDHGYSTFGRLLNSTGKSMVYSCSWPVYQIYAGIQPNYSA-IQTHCNLWRNYDDIQDSWASVENIIDYYGNNQDVIAPNAGPGHWNDPDMLIIGNFGLSYEQAKTQFAIWSILAAPLLMSVDLRTIRPQFKHILQNRKIIAVDQDPLGIQGRRIYKHKGIEIWSRPIG 331          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 338.191 bits (866), Expect = 1.548e-111
Identity = 188/392 (47.96%), Postives = 244/392 (62.24%), Query Frame = 3
Query:  249 CLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTD---VGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
             L  DNGL RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++   N +     AAPG WNDPDMLIIG+  L+ +Q R QM +W+I AAPL MSNDLR I+  +  +L NK +++INQDPLG QG+ L  EK+ IQV++R LS+  +A+ V  +  SD + Y Y T    +G+     ++V D F+      +  +TQ T  +  + + + Y+Y
Sbjct:   15 ALALDNGLMRTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDWFFDNQDALQPAAAPGQWNDPDMLIIGDFSLSLDQSRAQMALWSIMAAPLFMSNDLRTISSAARSVLQNKAVISINQDPLGIQGRRLLKEKSGIQVFQRPLSKGASAL-VFFSRRSD-MPYRYTTSLKTLGYQ-PGVFEVFDVFSEQRLPELKDSTQFTVSINPSGVVMWYIY 401          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 338.191 bits (866), Expect = 1.548e-111
Identity = 188/392 (47.96%), Postives = 244/392 (62.24%), Query Frame = 3
Query:  249 CLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTD---VGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
             L  DNGL RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++   N +     AAPG WNDPDMLIIG+  L+ +Q R QM +W+I AAPL MSNDLR I+  +  +L NK +++INQDPLG QG+ L  EK+ IQV++R LS+  +A+ V  +  SD + Y Y T    +G+     ++V D F+      +  +TQ T  +  + + + Y+Y
Sbjct:   15 ALALDNGLMRTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDWFFDNQDALQPAAAPGQWNDPDMLIIGDFSLSLDQSRAQMALWSIMAAPLFMSNDLRTISSAARSVLQNKAVISINQDPLGIQGRRLLKEKSGIQVFQRPLSKGASAL-VFFSRRSD-MPYRYTTSLKTLGYQ-PGVFEVFDVFSEQRLPELKDSTQFTVSINPSGVVMWYIY 401          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 329.331 bits (843), Expect = 1.856e-108
Identity = 183/383 (47.78%), Postives = 239/383 (62.40%), Query Frame = 3
Query:  276 RTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTD---VGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++   N +     AAPG WNDPDMLIIG+  L+ +Q R QM +W+I AAPL MSNDLR I+  +  +L NK +++INQDPLG QG+ L  EK+ IQV++R LS+  +A+ V  +  SD + Y Y T    +G+     ++V D F+      +  +TQ T  +  + + + Y+Y
Sbjct:    2 RTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDWFFDNQDALQPAAAPGQWNDPDMLIIGDFSLSLDQSRAQMALWSIMAAPLFMSNDLRTISSAARSVLQNKAVISINQDPLGIQGRRLLKEKSGIQVFQRPLSKGASAL-VFFSRRSD-MPYRYTTSLKTLGYQ-PGVFEVFDVFSEQRLPELKDSTQFTVSINPSGVVMWYIY 379          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: gla (galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041010-207])

HSP 1 Score: 308.916 bits (790), Expect = 1.802e-100
Identity = 167/341 (48.97%), Postives = 212/341 (62.17%), Query Frame = 3
Query:  213 LLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQ-PQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            ++ I L  L+      DNGLA TP MGW+ WERF C TDC   P  CI E L +  A  M   G+  AGYE++ IDDCW ++ R   G L  DP RFP+G+  L+  +HS GLK GIY D GTKTC GYPGSL +   D  TF  W VD +K DGC+     Q  +GY   S  LN T R IV+SC WP Y + ++  P   + ++ +CN WR Y D+ D WTSV  I+++           A PG WNDPDMLIIGN GL+ +QQ+ QM +WAI AAPLLMSNDLRDI   + +LL NK I+AINQDPLGKQG  + + +  ++W R LS +R A+AV+N
Sbjct:    6 IVVIGLVCLLVPAAALDNGLALTPTMGWLHWERFMCNTDCDADPQNCIREELFMQMADVMVKEGWKDAGYEFVCIDDCWPSQQRDAQGRLQADPKRFPSGIKKLADYVHSKGLKLGIYADVGTKTCAGYPGSLGYYDIDAKTFADWGVDLLKFDGCFMPDWHQLGEGYINMSSALNQTGRSIVYSCEWPLY-EWQHQQPDY-EAIRKTCNHWRNYGDVYDQWTSVKSILDWTAEKQKIVVPVAGPGGWNDPDMLIIGNFGLSRDQQQTQMALWAIMAAPLLMSNDLRDICPKAKELLQNKQIIAINQDPLGKQGYRILKADSFELWERPLSGNRLAVAVMN 344          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 240.736 bits (613), Expect = 2.335e-76
Identity = 118/219 (53.88%), Postives = 141/219 (64.38%), Query Frame = 3
Query:  252 LGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINY 902
            L  DNGL RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++
Sbjct:   16 LALDNGLMRTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDW 232          
BLAST of Alpha-galactosidase vs. Ensembl Xenopus
Match: naga (N-acetylgalactosaminidase, alpha- [Source:NCBI gene;Acc:779501])

HSP 1 Score: 345.125 bits (884), Expect = 2.188e-114
Identity = 179/354 (50.56%), Postives = 226/354 (63.84%), Query Frame = 3
Query:  228 LFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGF 1283
            L  L+ LC   DNGL RTPPMGWMTW+R+RC  DC   P  CI ENLI S A  M  +G+   GY Y+ IDDCW  K R  +G L PDP RFP+GM  L+  +H+ GLK GIY D G  TCGGYPG +L+ IK D  TF  WEVD +K DGCYSN + +  GY + S  LN T RPI++SCSWPAY     + P +    L S CN+WR Y DI DSW SVL II ++  N +     A PG WNDPDMLI G+ GL+Y Q + Q+ +WAI AAP +MSNDLR I+ D+  LL N+ ++ INQD +GKQG  +     ++VW+R+L   + A+AVLN G +D +   Y T +G 
Sbjct:    9 LMTLLALCWCLDNGLVRTPPMGWMTWQRYRCNIDCKSDPDNCIGENLIKSMADKMADSGWRDLGYVYVCIDDCWSRKQRDSNGRLEPDPERFPSGMKALADYVHAKGLKLGIYSDMGNYTCGGYPGTTLDTIKIDADTFASWEVDMLKFDGCYSNSTEKALGYPKMSEALNATGRPILYSCSWPAY--EGGLPPKVNYTQLGSICNMWRNYGDIQDSWDSVLDIIEWYAKNQDVLQPAAGPGRWNDPDMLITGDFGLSYEQSKSQLAIWAILAAPFIMSNDLRTISQDAKDLLQNRLLIYINQDSMGKQGNLILRFGSLEVWKRELMNGQYAVAVLNKG-TDGLPKPYSTSLGL 359          
BLAST of Alpha-galactosidase vs. Ensembl Xenopus
Match: gla (galactosidase alpha [Source:NCBI gene;Acc:100145767])

HSP 1 Score: 300.827 bits (769), Expect = 2.837e-97
Identity = 157/324 (48.46%), Postives = 200/324 (61.73%), Query Frame = 3
Query:  264 NGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            NGLA TPPMGW+ WERF C T+C + P  CISE L +  A  M   G+  AGY+Y+ IDDCWL   R +   L  DP+RFP G+  L+  +HS GL  GIYED G+KTC G+PGS  +   D  TF +W VD +K DGCY     + + GY + S  LN T R IV SC WP Y   R I       +   CN WR + DI DSW SV  +++       +    A PG WNDPDML+IGN GL++NQQ  QM +W+I AAPL+MSNDLRDI  +S  LL +KN+++INQDPLG QG  +F+ +  +VW R L +   A+AV N
Sbjct:   24 NGLALTPPMGWLHWERFLCETNCERNPKNCISEQLFMDMADKMVSEGWLDAGYQYLCIDDCWLAPERDEKNRLQADPVRFPGGIKKLADYVHSRGLLLGIYEDVGSKTCEGFPGSQGYYDIDAQTFAEWGVDLLKFDGCYYGTLDKLEDGYRQMSMALNRTGRKIVLSCEWPLY--ERGIKKINYSEVAEYCNSWRNFGDITDSWGSVKAVMDLSSAVQEEIVPVAGPGSWNDPDMLVIGNFGLSWNQQVTQMALWSIMAAPLMMSNDLRDIPAESKALLQDKNVISINQDPLGAQGYRVFKADYFEVWERPLIKGSLAVAVTN 345          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Naga (N-acetyl galactosaminidase, alpha [Source:MGI Symbol;Acc:MGI:1261422])

HSP 1 Score: 324.709 bits (831), Expect = 1.609e-106
Identity = 171/376 (45.48%), Postives = 238/376 (63.30%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQG-KFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLY--LTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQL 1373
            +NGL RTPPMGW+ WERFRC  DCV+ P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG+ L+ ++ D  TF +W+VD +KLDGC+S+   + +GY + +  LN T RPI FSCSWPAY     + P +    +   CNLWR Y DI DSW SVL I+++   + +     A PGHWNDPDML+IGN GL++++ R QM +W + AAPLLMS DLR I+  ++ +L N  ++ INQDPLG QG + L  K+ I+V++R LS   +A+ V  +  +D  F  +  L ++ +   + Y+  + FT   +   GL T++ F +
Sbjct:   19 ENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLLMSTDLRTISPQNMDILQNPLMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQASAL-VFFSRRTDMPFRFHCSLLELNYPKGRVYEGQNVFT--GDIFSGLQTEVNFTV 388          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Gla (galactosidase, alpha [Source:MGI Symbol;Acc:MGI:1347344])

HSP 1 Score: 303.138 bits (775), Expect = 4.821e-98
Identity = 160/325 (49.23%), Postives = 205/325 (63.08%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            DNGLARTP MGW+ WERF C  DC + P  CISE L +  A  M  +G+  AGY+Y+ IDDCW+   R   G L  DP RFP+G+ +L+  +HS GLK GIY D G KTC G+PGS      D  TF  W VD +K DGC+ +     + GY   +  LN T R IV+SC WP Y    +  P+ T  +Q  CN WR +DD+ DSW S+  I+++  +   +    A PG WNDPDML+IGN GL+++QQ  QM +WAI AAPLLMSNDLR I+  +  LL NK+++AINQDPLGKQG    ++N I+VW R LS    A+AV N
Sbjct:   33 DNGLARTPTMGWLHWERFMCNLDCQEEPDACISEQLFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIKHLANYVHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVVSLENGYKYMALALNRTGRSIVYSCEWPLYLRPFH-KPNYTD-IQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVAGPGSWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSNDLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRKENHIEVWERPLSNLAWAVAVRN 355          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Gla (galactosidase, alpha [Source:MGI Symbol;Acc:MGI:1347344])

HSP 1 Score: 303.138 bits (775), Expect = 4.856e-98
Identity = 160/325 (49.23%), Postives = 205/325 (63.08%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            DNGLARTP MGW+ WERF C  DC + P  CISE L +  A  M  +G+  AGY+Y+ IDDCW+   R   G L  DP RFP+G+ +L+  +HS GLK GIY D G KTC G+PGS      D  TF  W VD +K DGC+ +     + GY   +  LN T R IV+SC WP Y    +  P+ T  +Q  CN WR +DD+ DSW S+  I+++  +   +    A PG WNDPDML+IGN GL+++QQ  QM +WAI AAPLLMSNDLR I+  +  LL NK+++AINQDPLGKQG    ++N I+VW R LS    A+AV N
Sbjct:   35 DNGLARTPTMGWLHWERFMCNLDCQEEPDACISEQLFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIKHLANYVHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVVSLENGYKYMALALNRTGRSIVYSCEWPLYLRPFH-KPNYTD-IQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVAGPGSWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSNDLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRKENHIEVWERPLSNLAWAVAVRN 357          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Naga (N-acetyl galactosaminidase, alpha [Source:MGI Symbol;Acc:MGI:1261422])

HSP 1 Score: 251.906 bits (642), Expect = 1.092e-80
Identity = 120/238 (50.42%), Postives = 154/238 (64.71%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDM 968
            +NGL RTPPMGW+ WERFRC  DCV+ P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG +L+ ++ D  TF +W+VD +KLDGC+S+   + +GY + +  LN T RPI FSCSWPAY     + P +    +   CNLWR Y DI DSW SVL I+++   + +     A PGHWNDPDM
Sbjct:    3 ENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAY--EGGLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDM 237          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Naga (N-acetyl galactosaminidase, alpha [Source:MGI Symbol;Acc:MGI:1261422])

HSP 1 Score: 252.677 bits (644), Expect = 2.014e-80
Identity = 120/239 (50.21%), Postives = 155/239 (64.85%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDML 971
            +NGL RTPPMGW+ WERFRC  DCV+ P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG +L+ ++ D  TF +W+VD +KLDGC+S+   + +GY + +  LN T RPI FSCSWPAY     + P +    +   CNLWR Y DI DSW SVL I+++   + +     A PGHWNDPDM+
Sbjct:   19 ENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDMV 254          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|Q90744|NAGAB_CHICK (Alpha-N-acetylgalactosaminidase OS=Gallus gallus OX=9031 GN=NAGA PE=1 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 3.393e-113
Identity = 179/359 (49.86%), Postives = 235/359 (65.46%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFY--LYLTDVGFSIDKQYDVSDAFT 1322
            +NGLARTPPMGW+ WERFRC  +C + P +CISE L +  A  +  +G+   GY+YI IDDCW  K R  +G L+PDP RFP G+  L+  +H+ GLK  IY D G  TCGGYPG +L+ ++QD  TF +W VD +KLDGCYS+   Q QGY + +  LN T RPIV+SCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+++   N +    +A PGHWNDPDMLIIGN GL+Y Q R QM +W I AAPLLMS DLR I+  + K+L N+ ++ INQDPLG QG+ +  E + I+V+ R LSQ+ +A+ V  +  +D  F     L  +GF +   Y+V D ++
Sbjct:    2 ENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLDIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNSTGRPIVYSCSWPAYQG--GLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASAL-VFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYS 357          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|P17050|NAGAB_HUMAN (Alpha-N-acetylgalactosaminidase OS=Homo sapiens OX=9606 GN=NAGA PE=1 SV=2)

HSP 1 Score: 330.487 bits (846), Expect = 4.820e-108
Identity = 176/388 (45.36%), Postives = 238/388 (61.34%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVG---FSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            DNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPLLMS DLR I+  ++ +L N  ++ INQDPLG QG+ +  EK+LI+V+ R LS   +A+   +      + Y Y + +G   F+    Y+  D ++      +   T  T  +  + + + Y+Y
Sbjct:   19 DNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSC--RTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLY 401          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|Q66H12|NAGAB_RAT (Alpha-N-acetylgalactosaminidase OS=Rattus norvegicus OX=10116 GN=Naga PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.257e-107
Identity = 169/387 (43.67%), Postives = 243/387 (62.79%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFE-KNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLY--LTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            +NGL RTPPMGW+ WERFRC  +C + P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG+ L+ ++ D ATF +W+VD +KLDGCYS P  + +GY + +  LN T RPI FSCSWPAY     + P +    +  +CNLWR Y DI DSW SVL I+++   + +     + PGHWNDPDML+IGN GL++++ R QM +W + AAPL MS DLR I+  ++ +L N  ++ INQDPLG QG+ +F+ K+ I+V++R+LS   +A+ V  +  +D  ++ +  L ++ +     Y+  + FT      +   T  T  +  + + + Y+Y
Sbjct:   19 ENGLLRTPPMGWLAWERFRCNINCEEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDATGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAATFAEWKVDMLKLDGCYSTPKERAEGYPKMAAALNATGRPIAFSCSWPAY--EGGLPPKVNYTEVAGTCNLWRNYKDIQDSWKSVLSILDWFVKHQDILQPVSGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLFMSTDLRTISPQNIDILQNPLLIKINQDPLGIQGRLIFKSKSHIEVFKRNLSDDASAL-VFFSRRTDMPYHFHCSLLELNYPKGSVYEGQNVFTGDIISGLHPETNFTVIINPSGVVMWYLY 401          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|Q58DH9|NAGAB_BOVIN (Alpha-N-acetylgalactosaminidase OS=Bos taurus OX=9913 GN=NAGA PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 6.244e-107
Identity = 173/387 (44.70%), Postives = 238/387 (61.50%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQG-KFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLY--LTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            +NGL R PPMGW+ WERFRC  DC + P  CISE L +  A  +  +G+   GY Y+ IDDCW+    AK G+L+PD  RFP+G+ +L+   HSLGLK GIYED G  TC GYPG+ L+ + QD  TF +W+VD +KLDGCYS P  + +GY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR +DDI DSW SVL ++++   + +     A PGHWNDPDML+IGN GL++ Q + QM +W + AAPL MS DLR I+  ++ +L N  ++ INQDPLG QG + L EK+ I+V+ R L+   +AI V  +   D  ++ +  L  + FS    Y+  D +T      +   T  T  +  + + + Y+Y
Sbjct:   19 ENGLLRKPPMGWLAWERFRCNIDCSEDPKNCISEQLFMEMADRLAQDGWRDLGYVYLNIDDCWIGGRDAK-GNLVPDRKRFPHGIAFLADYAHSLGLKLGIYEDLGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCYSTPQERAEGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPKVNYTLLADICNLWRNFDDIQDSWRSVLSVLDWFVTHQDVLQPIAGPGHWNDPDMLLIGNFGLSFEQAQAQMALWTVLAAPLFMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRILKEKSHIEVYLRPLASEASAI-VFFSRRMDMPYHYHSSLARLNFSSSVVYEAQDVYTGDIISGLQDKTNFTVIINPSGVVMWYLY 401          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|Q9QWR8|NAGAB_MOUSE (Alpha-N-acetylgalactosaminidase OS=Mus musculus OX=10090 GN=Naga PE=1 SV=2)

HSP 1 Score: 324.709 bits (831), Expect = 1.126e-105
Identity = 171/376 (45.48%), Postives = 238/376 (63.30%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQG-KFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLY--LTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQL 1373
            +NGL RTPPMGW+ WERFRC  DCV+ P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG+ L+ ++ D  TF +W+VD +KLDGC+S+   + +GY + +  LN T RPI FSCSWPAY     + P +    +   CNLWR Y DI DSW SVL I+++   + +     A PGHWNDPDML+IGN GL++++ R QM +W + AAPLLMS DLR I+  ++ +L N  ++ INQDPLG QG + L  K+ I+V++R LS   +A+ V  +  +D  F  +  L ++ +   + Y+  + FT   +   GL T++ F +
Sbjct:   19 ENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLLMSTDLRTISPQNMDILQNPLMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQASAL-VFFSRRTDMPFRFHCSLLELNYPKGRVYEGQNVFT--GDIFSGLQTEVNFTV 388          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: V5GMA3 (Alpha-galactosidase (Fragment) OS=Anoplophora glabripennis OX=217634 GN=NAGAB PE=3 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 2.323e-124
Identity = 181/314 (57.64%), Postives = 231/314 (73.57%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLS 1202
            DNGLA TPPMGWM W+RFRC TDCV YP ECISE L  + A ++  +G+  AGYEYI+IDDCW +K R  D  L PDP RFPNG+  L+  IH  GLKFGIY DYGTKTC GYPGS++H++ D  TF +W VDY+KLDGCY++ ST  +GYA+  HYLN T RPIV+SCSWPAY +   I  + TKL + +CNLWR +DDIDD+W++V  I+N+   N ++ + ++ PGHWNDPDMLIIGN GL+Y Q + QM +WAI AAPL+MS DLR I      +LLNK+I++INQDPLG QG+ +  KN I +W + ++
Sbjct:   21 DNGLALTPPMGWMHWQRFRCLTDCVAYPDECISEKLFRTMADHLVCDGYLEAGYEYIIIDDCWASKQRDNDSRLQPDPERFPNGIKALADYIHDKGLKFGIYGDYGTKTCAGYPGSIDHLELDAQTFAEWGVDYLKLDGCYADQSTMEEGYAKMGHYLNATGRPIVYSCSWPAYQEPLGIKSNYTKLAE-TCNLWRNWDDIDDAWSNVTNILNWFSKNQDRLAKFSGPGHWNDPDMLIIGNFGLSYEQSKAQMAIWAIMAAPLIMSVDLRSIEPQFKNILLNKDIISINQDPLGIQGRLVLTKNKIDIWTKPVT 333          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: A0A2P8ZLY1 (Alpha-galactosidase OS=Blattella germanica OX=6973 GN=NAGA PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 2.001e-122
Identity = 177/329 (53.80%), Postives = 228/329 (69.30%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQS-----RTAIAVLN 1232
            DNGLA TPPMGW+ WERFRC TDC  YP ECISE L    A  M   G+++AGYEY++IDDCWL   R  +G L PDP RFPNG+  L+  +HSLGLKFGIYEDYGT TC GYPG L H++ D  TF +W+VDY+KLDGCY+ P     GY  + +YLN T RP+++SCSWP Y +   I P+  +LL+  CNLWR Y DIDDS+  V  I++Y   N ++ +  A PGHWNDPDMLIIGN GL+++Q + QM +WAI AAPLLMS +LRD+  ++  +L N  ++A+NQD LG QG+ +F  N I+VW R +S         A+A++N
Sbjct:   20 DNGLALTPPMGWLAWERFRCITDCEGYPDECISEQLFRRTADLMVSEGYAAAGYEYVIIDDCWLAPERDSEGKLQPDPYRFPNGIKALADYVHSLGLKFGIYEDYGTYTCAGYPGVLGHLEVDANTFAEWDVDYVKLDGCYAEPEDMNDGYPAFGNYLNQTGRPMIYSCSWPVYQEQSGIPPNF-ELLKRYCNLWRNYGDIDDSFEDVKSIMDYFAENQDRIAEHAGPGHWNDPDMLIIGNYGLSFDQSKTQMAIWAILAAPLLMSTELRDVKPEAKAILQNAAVIAVNQDVLGIQGRRVFSANEIEVWTRPISPQVGDNYSYAVAIVN 347          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: K1PB46 (Alpha-galactosidase OS=Crassostrea gigas OX=29159 GN=CGI_10011661 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.414e-121
Identity = 200/423 (47.28%), Postives = 264/423 (62.41%), Query Frame = 3
Query:  141 PRAGSLCKYKTYH---HHKFLFFTMKSLLYISLFILIPLCL-GSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFSI-DKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDI 1394
            PR    C+   Y    H  ++   M   + + + IL    L G DNGL  TPPMGW+TWERFRC  DC + P  CISE+LI + A  M  NG+  AGYEY++IDDCWL   R  +G L+PDP RFP+G+  LS  +HS  LKFGIY+D+GTKTCGG+PGS  +++ D  TF  W VDY+K DGC SN    P GY     +LN T R I +SC WP Y  V  +     K ++ +CNLWR Y D+ DSW+SVL I+N+   N   F+ +A PG WNDPDM+I+GN GL+Y ++RVQM MWAI AAPL+MSNDLR I   S  LLLN+N++AINQD LG QG  L ++N IQ+W RDLS +RTA+A LN  +     +L  + V   +    Y+ ++AF M TN  +     +  ++    I++
Sbjct:    3 PRNIHCCRLNLYPGVPHMYWVEVQMTCWILVVVAILAVRGLHGLDNGLGLTPPMGWLTWERFRCNMDCDRDPDNCISEHLIKAMADIMAANGYRDAGYEYVIIDDCWLGPERDTNGRLVPDPNRFPSGIKNLSAYVHSKNLKFGIYQDFGTKTCGGFPGSEFYMQTDAETFADWGVDYLKFDGCNSNLYDFPSGYEAMGFFLNKTGRSIFYSCEWPFYKIVSGLQVDFAK-VRKTCNLWRNYYDVQDSWSSVLDIVNFWGSNSKIFTKYAGPGGWNDPDMIILGNFGLSYEEERVQMAMWAILAAPLIMSNDLRHIRSSSKALLLNRNLIAINQDKLGIQGILLQKQNGIQIWSRDLSFNRTAVAFLNENSDGMPRFLSFSLVDLKLTSSTYNFTEAFDMKTNILVTRQRPLKIKVNPHGINL 424          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: A0A0X3Q2B0 (Alpha-galactosidase OS=Schistocephalus solidus OX=70667 GN=TR128540 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.663e-121
Identity = 202/398 (50.75%), Postives = 259/398 (65.08%), Query Frame = 3
Query:  231 FILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSR-AKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNIT-PSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQ-----IFYLYLTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYV 1403
            FI+   CL  DNGLARTPPMGWM+W+R+RC TDCV YP+ECI+E+LI   A +M  +G+ S GY+YIVIDDCW    R      L P+  RFP+GM  LS  +HSLGLKFGIY D+GTKTC GYPGS++ ++ D  T   W+VDYIK+DGCYS+ S Q  GY  +S +LN T RPIVFSCS+PAY   +    P    +LQ  CNLWRM DD+ DSW SVLGII  ++      +  A PGHWNDPDML++GN GL+ +QQRVQMGMW +FAAPLL+S DL  I+D+S +LL +  +L INQDPLG Q  F +    I++W R LS +  AIA LN  +S       +  L   +V F  D  Y ++DAF+      + L T    ++  + I +L V
Sbjct:   22 FIMEVECL--DNGLARTPPMGWMSWQRYRCQTDCVNYPTECINEDLIRRTAEHMARDGWLSKGYQYIVIDDCWPEMERDPSTKRLRPNSSRFPSGMKNLSDFVHSLGLKFGIYLDFGTKTCEGYPGSMDFLEIDAQTMADWDVDYIKMDGCYSDASVQALGYHAFSRFLNGTGRPIVFSCSYPAYEPWKEPAFPFNWTMLQEDCNLWRMLDDVQDSWASVLGIIGAYEKYHITLALNAGPGHWNDPDMLLLGNYGLSSDQQRVQMGMWVMFAAPLLISTDLGAISDESKQLLQSDLLLQINQDPLGLQALFHYTIGGIKIWTRRLSNNGVAIAFLNPSDSSGGPVRIVVALKQLEV-FETDPPYCLTDAFSGKIFAIVDLDTPFEVRINPSGIILLIV 416          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: A0A437B3G7 (Alpha-galactosidase OS=Chilo suppressalis OX=168631 GN=evm_010456 PE=3 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.750e-120
Identity = 184/394 (46.70%), Postives = 252/394 (63.96%), Query Frame = 3
Query:  210 SLLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQ-YDVSDAFTMSTNRTIGLTTQITFQLPSTSI 1388
            +LL++ +   +      DNGLA TPPMGW+TWERFRC TDC  YPSECISE+LI      M + G+  AGY+Y+ IDDCWL K+R  DG ++PD  RFP+GM  L+  IHS GLKFGIY+DYG  TC GYPG L   + D+ TFV W+VDYIKLDGCY N +    GY  +   LN + RPI++SCSWPAY +   + P    +    CNLWR +DDIDDSW S+  I+++   N  + +  A PGHWNDPDML+IGN GL+ +Q RVQM +WA+ AAPLL+S DL  +  +   +LLN++ILA++QDP+GKQG  ++++  I +W R+L     A+A ++       +        F + +Q YDV D +   +NR++G   +   +L  T +
Sbjct:    2 ALLWLVILCGVSSATALDNGLALTPPMGWLTWERFRCITDCKTYPSECISEDLIKRTVDMMVIEGYRDAGYDYVGIDDCWLEKTRGPDGRMVPDRERFPSGMNALADYIHSRGLKFGIYQDYGNLTCAGYPGVLGSEQLDVDTFVSWDVDYIKLDGCYINATEMDSGYPAFGKLLNDSGRPILYSCSWPAYQEDIKMMPDYASIAH-HCNLWRNWDDIDDSWWSLERIMDWFGDNQERLAPHAGPGHWNDPDMLLIGNFGLSEDQARVQMAVWAVLAAPLLISADLATMKPEFKSILLNRDILAVDQDPMGKQGLRVYKEKKIAIWTRELFDGSYAVAFVSHRTDGAAYVFRYKLKDFKLPEQIYDVQDLYKEESNRSVGPNEEFAVKLNPTGV 394          
BLAST of Alpha-galactosidase vs. Ensembl Cavefish
Match: NAGA (alpha-N-acetylgalactosaminidase-like [Source:NCBI gene;Acc:103035758])

HSP 1 Score: 329.331 bits (843), Expect = 1.915e-108
Identity = 171/327 (52.29%), Postives = 218/327 (66.67%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQG-KFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            DNGLARTPPMGWM+WERFRC  DC   P  CISE L    A  +  +G+   GYEY++IDDCW   SR   G L+PDP+RFPNG+  L+  +H LGLK GIY D GT TC GYPG +L  I+ D  TF +W+VD +K DGC SN   Q QGY   S  LN T RPIV++CSWP Y     + PS+   LL   CNLWR Y DI+DSW SVL I+++   + +     + PG WNDPDMLIIGN GL+  Q + QM +WAI AAPL+MSNDLR ++ ++  +L NK ++AINQDPLG QG + L ++  I+V+ R LS+S +A+  L+
Sbjct:   19 DNGLARTPPMGWMSWERFRCNIDCRNDPKNCISEALYKDMAERLVEDGWLKLGYEYLIIDDCWSFTSRDSRGRLMPDPVRFPNGIPKLAHYVHQLGLKLGIYADMGTHTCAGYPGTTLEQIQTDAQTFAEWQVDMLKFDGCNSNAEEQQQGYPLMSKALNATGRPIVYACSWPVYRG--GLPPSVNYTLLGEICNLWRNYYDIEDSWDSVLNIVDWFFQSQDYLQPASGPGRWNDPDMLIIGNFGLSLEQSKAQMALWAIMAAPLIMSNDLRTLSSEARNILQNKAVIAINQDPLGIQGRRILKDEGHIEVFWRPLSKSASALVFLS 343          
BLAST of Alpha-galactosidase vs. Ensembl Cavefish
Match: naga (alpha-N-acetylgalactosaminidase-like [Source:NCBI gene;Acc:103026015])

HSP 1 Score: 318.931 bits (816), Expect = 3.785e-104
Identity = 181/406 (44.58%), Postives = 231/406 (56.90%), Query Frame = 3
Query:  204 MKSLLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGF--SIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            M+    + L          DNGL RTPPMGW+ WERFRC  DC   P  CISE+L    A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+  L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN + Q  GY   +  LN T RPI +SCSWPAY     + P++   LL   CNLWR Y DI DSW SVL I+++   + +     A PG WNDPDMLIIG+ GL+ +Q R QM +WAI AAPL MSNDLR +N  +  +L NK  +AINQDPLG QG+ L  EK+ I V+ R LS   +A+   +      + Y Y T +         Y + D F   +   +   T     +  T + + YVY
Sbjct:    1 MQKTAVVLLLAFSATTFALDNGLMRTPPMGWLAWERFRCDIDCDNDPKNCISESLFKDMADRLAEDGWRELGYVYVNIDDCWSSKQRDAQGRLQPDPKRFPGGIANLARYVHDRGLKLGIYGDLGTYTCGGYPGTTLDKIEIDAQTFADWGIDMLKLDGCYSNATDQEMGYPLMTKALNATGRPIGYSCSWPAY--QGGLPPAVNYTLLGEICNLWRNYGDIQDSWDSVLNIVDWFTDHQDILQPAAGPGQWNDPDMLIIGDYGLSTDQSRSQMALWAIMAAPLFMSNDLRTLNSGARAILQNKGAIAINQDPLGIQGRRLIKEKSGIDVFWRPLSNGASALVFFS--RRTDMPYRYQTSLKALNYTPGTYKLYDVFLEKSLPEVKDATDFVVSVNPTGVVMWYVY 402          
BLAST of Alpha-galactosidase vs. Ensembl Sea Lamprey
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 334.339 bits (856), Expect = 4.045e-111
Identity = 184/404 (45.54%), Postives = 246/404 (60.89%), Query Frame = 3
Query:  213 LLYISLFILIPLC-LGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLF-EKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLY---LTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYV 1403
            LL +   ++  LC LG DNGL RTPPMGW+ WERFRC  DC   P  CISE L  + A  +  +G+   GY Y+ IDDCW+++ R   G L  DP RFP+G+  L+  +H+ GLK GIYED GT TCGGYPG +L  ++ D  TF +WEVD +KLDGCYSN S + +GY   S  LN T RPI +SCSWPAY     + P +    L   CNLWR YDDI+DSW SV  I+++   +       AAPG WNDPDMLI+G+ GL+Y+Q R QM +WA+ AAP  MSNDLR ++  + +LL N+ ++ INQDPLG QG+ +  EK+ I+VW R+L+    A+A   A     + Y Y   L  +G     QY V D F+     T+    + T  +  +  ++ Y+
Sbjct:    3 LLRVLCALVSTLCVLGMDNGLMRTPPMGWLAWERFRCNVDCKNDPDNCISERLFKAMADRLAEDGWRELGYVYVNIDDCWMSRQRDARGRLQADPERFPSGIKALADYVHARGLKLGIYEDLGTLTCGGYPGTTLADVQTDATTFAEWEVDMLKLDGCYSNSSEKAEGYPSMSRALNATGRPIAYSCSWPAYEG--GLPPKVNYTQLGDICNLWRNYDDIEDSWDSV-SIMDWWGDHQEVLIPAAAPGRWNDPDMLIVGDFGLSYDQSRAQMAIWAVLAAPYFMSNDLRSMSAAARELLQNRLLIQINQDPLGHQGRRIIKEKSHIEVWSRNLTDGAWALAF--ASRRVDMPYPYSATLAALGAPAGSQYWVIDVFSGKQIGTLKSEEKFTVSINPSGAEMWYL 401          
BLAST of Alpha-galactosidase vs. Ensembl Sea Lamprey
Match: gla (galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041010-207])

HSP 1 Score: 296.975 bits (759), Expect = 3.243e-96
Identity = 160/344 (46.51%), Postives = 212/344 (61.63%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGC-YSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFE-KNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFS 1286
            DNGLA TPPMGW+ WERF C T C   P  CISE L +  A  M   G+  AGYEY+ IDDCW +  R   G L  DP RFP+G+  L+  +H+ GLK GIY D G  TC GYP S    + D  TF +W VD +K DGC   N S   +GY   S  LN T RP+V+SC WP Y     I P+ T+ ++  CN WR   D++DSW SV  + ++   + +     A PG WNDPDML+IGN GL+++QQ  QM +WAI AAPL+MSNDLR+++  S  +LLN + +A+NQDPLG+QG  + + KN + +WRR+L+    A+A++   N +QI    L +V  S
Sbjct:   35 DNGLALTPPMGWLHWERFMCNTYCRSDPDNCISEKLFMEMADIMATEGWLDAGYEYVCIDDCWPSAKRDARGRLQADPERFPSGIKALADYVHARGLKLGIYSDVGPTTCAGYPASYGSYELDARTFAEWGVDLLKFDGCNLQNISVLVEGYTNMSIALNGTGRPMVYSCEWPLYSWGEYIKPNYTQ-VRRYCNQWRNSADVEDSWESVRSLADWAANHQSLIVPVAGPGGWNDPDMLVIGNFGLSHSQQVTQMALWAIMAAPLIMSNDLRNLDGFSRNVLLNPHAIAVNQDPLGRQGTLVAKLKNNVDMWRRELAGGGMAVALV---NRNQIGGPVLVNVSLS 374          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO37440 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR2])

HSP 1 Score: 347.051 bits (889), Expect = 6.780e-116
Identity = 175/344 (50.87%), Postives = 226/344 (65.70%), Query Frame = 3
Query:  204 MKSLLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGK-FLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            +  L  I+L+  +      DNGLA TPPMGWM WERFRC  DC   P+ CISE+L +  A  M  +G+  AGYE+I IDDC+ NK R K+G+L  +  RFP+G   L+  IH  GLK G+Y DYG  TC GYPGS  +I+QD  TF  W  DY+KLDGCYS+P T  +GY E+   LN T RPIV+SC WP+Y   RN+T + T + + +CN WR YDDI DSW SV+ I++Y   N + F   A PGHWNDPD LIIGN GL+ +Q R QM +WAI A+PL+MS DLR I     ++LLNK ++A+NQD LGK G+ ++  K+  +VW R LS    A+ +LN
Sbjct:    4 LAVLFCIALYSFVRTGYALDNGLALTPPMGWMDWERFRCNIDCEHDPNNCISEHLFMEIADRMAEDGYRGAGYEFISIDDCYTNKKRDKNGNLQLNTTRFPSGPHALAQYIHGKGLKLGVYADYGVLTCAGYPGSYYYIEQDAKTFASWGADYLKLDGCYSDPKTMNKGYPEFRRALNATGRPIVYSCEWPSYMIGRNLTVNYTDIAE-NCNTWRNYDDIQDSWASVMHIVDYFAANQDTFIAAAGPGHWNDPDELIIGNFGLSDDQSRAQMALWAIMASPLIMSTDLRSIKPRHKEILLNKEVIAVNQDKLGKMGRQWIKSKDNTEVWARPLSDGSVAVVLLN 346          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO42026 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L8])

HSP 1 Score: 327.405 bits (838), Expect = 1.631e-108
Identity = 163/329 (49.54%), Postives = 213/329 (64.74%), Query Frame = 3
Query:  261 DNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFE-----KNLIQVWRRDLSQSRTAIAVLN 1232
            D+GLA TPPMGWM WERFRC  DC   P ECI E L ++ A  M  +G+  AGY+Y+ IDDCW +K R  +G L  DP RFP+G+  L+  +HS GLK GIY DYGT TC  YPGS++ +++D+ TF  W+VDY+K+DGC+++PS    GY   S YLN T RPI+FSCSWP Y  ++   P   K +   C+LWR Y DI+DSW  V  I++++  N       A PGHWNDPD LIIGN GL+  Q + QM +WAI AAPL MSNDLR I   +  +LLN  ++A+NQDPLGKQG  +++     +   +VW R L     A+ + N
Sbjct:    2 DDGLALTPPMGWMAWERFRCNVDCDNDPDECIHERLFMAMADEMMCDGYLEAGYKYVCIDDCWTSKDRGPNGELQADPNRFPSGIKELAKYVHSKGLKLGIYADYGTMTCERYPGSIDRLEKDMRTFASWDVDYLKMDGCFADPSKMDTGYPLASKYLNATGRPIMFSCSWPFYQVLKGQKPDY-KNIAKHCHLWRNYIDIEDSWEWVTKIVDHYAENQEVLIPVAGPGHWNDPDQLIIGNFGLSPEQSKSQMALWAILAAPLFMSNDLRKIPQFAKDVLLNTEVIAVNQDPLGKQGWRVWKGQNGWEKYTEVWARHLVNGNVAVVLFN 329          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO30461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0R0])

HSP 1 Score: 110.538 bits (275), Expect = 3.280e-28
Identity = 70/182 (38.46%), Postives = 94/182 (51.65%), Query Frame = 3
Query:  834 CNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVG-----------FSIDKQYDVSDAFTMSTNRTIG 1346
            CNLWR YDDI DSW SVL IINY+  + +     A PGHWNDPD LIIG++ L  +Q + QM +W+I A+           N     L   + I+A+NQD LGK G   F  N IQVW R L+    A+AV+N  +S     +   ++G           F+     D ++ FT +  R  G
Sbjct:   10 CNLWRNYDDIQDSWGSVLSIINYYGDSQDDLVPVAGPGHWNDPDQLIIGDS-LTVDQAKAQMAIWSIMAS-----------NKQCYFLFPCREIIAVNQDKLGKMGSRRFMNNAIQVWSRPLADGSVAVAVINVASSAHTVPVSFEEIGLRASTASVRDLFAFQNLGDFTNGFTTAAIRPTG 179          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO28386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6L9])

HSP 1 Score: 76.2554 bits (186), Expect = 1.617e-17
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 3
Query:  636 TFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAY 782
            TF KW VDY+KLDGCYS+P T   GY + +  LN+T RPIVFSCSWPAY
Sbjct:    3 TFAKWGVDYLKLDGCYSDPKTYDTGYPKVTTALNVTGRPIVFSCSWPAY 51          
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Match: naga (alpha-N-acetylgalactosaminidase [Source:NCBI gene;Acc:101155483])

HSP 1 Score: 314.694 bits (805), Expect = 1.534e-102
Identity = 171/342 (50.00%), Postives = 210/342 (61.40%), Query Frame = 3
Query:  228 LFILIPLC---LGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQ--SSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQG-KFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            L     LC   L  +NGL RTPPMGW+ WERFRC  DC   P  CISENL +  A  +  +G+   GY Y+ IDDCW +  R ++G L PDP RFP G+  L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  T   WEVD  K DGCYSN + Q QGY   S  LN T RPI +SCSWPAY   R   P      Q    CNLWR YDDI DSW SVL II++   N +     A PG WNDPDMLIIG+ GL+ +Q R QM +W+I AAPL MSNDLR I+  +  +L NK  + INQD +G  G + L EK+ I+V+ R LS + +A+   +
Sbjct:    6 LLFACALCGSTLALNNGLMRTPPMGWLAWERFRCDIDCQNDPKNCISENLFMDMADRLSEDGWRELGYVYVNIDDCWSSMERDENGRLQPDPKRFPGGIRKLARYMHDRGLKLGIYGDMGTHTCGGYPGTTLDKIEIDAQTIADWEVDMFKFDGCYSNATEQEQGYPLMSKALNATGRPIGYSCSWPAY---RGGLPPKVNYTQLGEICNLWRNYDDIQDSWDSVLNIIDWFFDNQDALQPAAGPGRWNDPDMLIIGDFGLSLDQSRSQMALWSIMAAPLFMSNDLRTISSGARSILQNKIAIGINQDAMGMPGRRILKEKSGIEVFWRPLSNNASALVFFS 344          
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Match: gla (galactosidase alpha [Source:NCBI gene;Acc:101169044])

HSP 1 Score: 302.753 bits (774), Expect = 6.419e-98
Identity = 163/340 (47.94%), Postives = 208/340 (61.18%), Query Frame = 3
Query:  216 LYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAY-FDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            L + + ++ P     DNGLA  P MGW+ WERF C TDC   P  CISE L +  A  M   G+  AGYEY+ IDDCW +  R   G L  DP RFP G+  L+  IHS GLK GIY D G  TC GYPGSL + + D  TF  W+VD +K DGC+   +   +GY   S  LN T R I++SC WP Y + ++   P+ T  ++  CN WR ++DI DSW+S+  I+ +   N       A PG WNDPDML+IGN GL+++QQ+ QM +WAI AAPLLMSNDLRDI   S +LL N+ I+AINQDPLG+QG          VW R L  +R AIA++N
Sbjct:    7 LLVVVGLMCPTAEALDNGLALKPTMGWLHWERFTCNTDCDTDPRNCISEQLYMQMADVMVKEGWKEAGYEYVCIDDCWPSHKRDAKGRLQADPNRFPGGIKKLADYIHSKGLKLGIYADVGKNTCAGYPGSLGYYETDAQTFADWDVDLLKFDGCFMERTLIAEGYMNMSKALNKTGRSILYSCEWPLYEWAIKQ--PNYTA-IREYCNHWRNFNDIFDSWSSLKTILEWTASNQKIIVPAAGPGGWNDPDMLVIGNFGLSHDQQQSQMALWAIMAAPLLMSNDLRDICPRSKELLQNRMIIAINQDPLGQQGYHTARLMDFDVWERPLFGNRLAIAIMN 343          
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Match: naga (alpha-N-acetylgalactosaminidase [Source:NCBI gene;Acc:101155483])

HSP 1 Score: 301.212 bits (770), Expect = 5.619e-97
Identity = 171/367 (46.59%), Postives = 210/367 (57.22%), Query Frame = 3
Query:  228 LFILIPLC---LGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-------------------------GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQ--SSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQG-KFLFEKNLIQVWRRDLSQSRTAIAVLN 1232
            L     LC   L  +NGL RTPPMGW+ WERFRC  DC   P  CISENL +  A  +  +G+   GY Y+ IDDCW +  R ++G L PDP RFP G+  L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  T   WEVD  K DGCYSN + Q Q                         GY   S  LN T RPI +SCSWPAY   R   P      Q    CNLWR YDDI DSW SVL II++   N +     A PG WNDPDMLIIG+ GL+ +Q R QM +W+I AAPL MSNDLR I+  +  +L NK  + INQD +G  G + L EK+ I+V+ R LS + +A+   +
Sbjct:    6 LLFACALCGSTLALNNGLMRTPPMGWLAWERFRCDIDCQNDPKNCISENLFMDMADRLSEDGWRELGYVYVNIDDCWSSMERDENGRLQPDPKRFPGGIRKLARYMHDRGLKLGIYGDMGTHTCGGYPGTTLDKIEIDAQTIADWEVDMFKFDGCYSNATEQEQGMEVLGELGSCFRSLFDCKCILALAGYPLMSKALNATGRPIGYSCSWPAY---RGGLPPKVNYTQLGEICNLWRNYDDIQDSWDSVLNIIDWFFDNQDALQPAAGPGRWNDPDMLIIGDFGLSLDQSRSQMALWSIMAAPLFMSNDLRTISSGARSILQNKIAIGINQDAMGMPGRRILKEKSGIEVFWRPLSNNASALVFFS 369          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000009913.1 (SMESG000009913.1)

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 372/401 (92.77%), Postives = 385/401 (96.01%), Query Frame = 3
Query:  204 MKSLLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 1406
            MKSLLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDC  YP ECISE+LIISQA+N+  NGF SAGYEYIVIDDCWLNKSRAKDGSLIPDP+RFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLN+I QDI TFV+WEVDYIKLDGCYS+ +TQPQGYAEYSHYLNLT RPIVFSCSWPAYFDVRNI  +L  LLQ+SCNLWRMYDDIDDSW+SVLGIINY+K+N N FSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVKLLLNKNILAINQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY
Sbjct:    1 MKSLLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCDAYPKECISEDLIISQAYNLAKNGFLSAGYEYIVIDDCWLNKSRAKDGSLIPDPVRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNYINQDITTFVQWEVDYIKLDGCYSDTTTQPQGYAEYSHYLNLTKRPIVFSCSWPAYFDVRNINSTLASLLQNSCNLWRMYDDIDDSWSSVLGIINYYKINYNNFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVKLLLNKNILAINQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYVY 401          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000009912.1 (SMESG000009912.1)

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 328/372 (88.17%), Postives = 344/372 (92.47%), Query Frame = 3
Query:  288 MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYV 1403
            MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPL MSNDLR+I+  SV+LLLNKNILAINQD LGKQG FLFE++ +QVWRRDLS+SRT +AVLN GN+ +  Y  L D GFSI K+Y V DAF+M +N T+ LTT I F    TSID++ V
Sbjct:    1 MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVV 372          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000016213.1 (SMESG000016213.1)

HSP 1 Score: 370.163 bits (949), Expect = 3.973e-125
Identity = 185/371 (49.87%), Postives = 250/371 (67.39%), Query Frame = 3
Query:  288 MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLSQ----SRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQYDVSDAF-----TMSTNRTIGLTTQITFQL 1373
            MGW++W R+RCT +C  YP++CISENLI++ A  M    +  AGYEY++IDDCWL K RA +GSL+PDP RFP GM +L+  +HS GLKFGIYEDYGTKTC GYPGSL H+K D  TF  W +DY+K DGC S PSTQP G   +S +LN T RPI  +  WP Y  V +IT S  +LLQ + N+ R++DDI D W S+L +IN++K N N F+ WA PG++NDPDML+IGN  + YNQ+++QM MWAIFA PL+MSNDLR+I++ S  +L NKN+++INQD LG QG+F+     +  W R LS      + AIA+LN  N +   +  L ++      +Y +++ F      +S+N T+ +    T  L
Sbjct:    1 MGWLSWLRYRCTINCKSYPNDCISENLIMAMADKMSQE-YKEAGYEYVMIDDCWLAKDRAANGSLLPDPGRFPRGMKFLADYVHSKGLKFGIYEDYGTKTCAGYPGSLGHLKMDAVTFASWGIDYVKFDGCNSVPSTQPFGIQMFSKFLNDTGRPIFLNVEWPLYLGVDHITQSQVELLQDTTNMARVFDDIQDDWKSLLNVINFYKNNENNFAAWARPGYFNDPDMLLIGNNYITYNQEKLQMAMWAIFAGPLIMSNDLRNISEASKSILTNKNVISINQDKLGIQGQFITTIGKLDYWVRQLSPVLGFQQVAIAILNLSNKNINDWFALENLNIKGTGKYSLTEVFDNQNYVVSSNETLSVMVDSTSAL 370          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000016280.1 (SMESG000016280.1)

HSP 1 Score: 361.688 bits (927), Expect = 2.197e-121
Identity = 182/373 (48.79%), Postives = 248/373 (66.49%), Query Frame = 3
Query:  216 LYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVXXXXXXXXXXXXQDPLGKQGKFLFEKNLIQVWRRDLS----QSRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQYDVSDAFT 1322
            + +S F+L   CL  DN + +TPPMGW++W RFRCT DC   P++CISENLI++ A  M + G+  AGYEY++IDDCWL K RA +GSL+ DP RFP G+ YL+  +H  GLKFGIYED+G KTC GYPGS  H+K D  TF  W VDY+K DGC+S    QP G   +S YLN T R I  +  WP Y  V++++     LL+ + N+ R+++DI+DSW S+L ++N++K N   F++WA PG++NDPDML+IGN  + YNQ+++QM +WAIFA PL+MSNDLR+I++ S  +LLNKNI++INQD  G QG+F+        W R LS      R AIAVLN GN     Y  + ++         + + FT
Sbjct:    6 IVLSFFLLQCHCL--DNEVGQTPPMGWLSWLRFRCTVDCKTLPNDCISENLIMAMADKMAV-GYKDAGYEYVMIDDCWLAKDRAANGSLMSDPERFPRGIKYLADYVHRRGLKFGIYEDFGLKTCAGYPGSFGHLKMDAFTFASWGVDYVKFDGCWSFAFMQPLGIELFSKYLNETGRQIFLNVEWPLYMGVKHMSNERISLLKRTTNMARVFNDIEDSWDSLLSVVNFYKKNDRNFASWARPGYFNDPDMLLIGNKYITYNQEKLQMALWAIFAGPLIMSNDLRNISEASKSILLNKNIISINQDKFGIQGRFIKTIGEQDYWMRPLSPILGHQRVAIAVLNLGNQASTSYFTIDNLNVISSGNLTLLNVFT 375          
The following BLAST results are available for this feature:
BLAST of Alpha-galactosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAGA1.004e-10845.36alpha-N-acetylgalactosaminidase [Source:HGNC Symbo... [more]
NAGA1.004e-10845.36alpha-N-acetylgalactosaminidase [Source:HGNC Symbo... [more]
NAGA1.004e-10845.36alpha-N-acetylgalactosaminidase [Source:HGNC Symbo... [more]
GLA2.928e-10049.40galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4... [more]
GLA6.645e-9243.97galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gana-19.822e-9143.77Alpha-galactosidase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG79971.241e-12047.49gene:FBgn0034117 transcript:FBtr0087172[more]
CG79971.241e-12047.49gene:FBgn0034117 transcript:FBtr0087171[more]
CG57314.942e-11352.83gene:FBgn0032192 transcript:FBtr0079959[more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naga1.548e-11147.96N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
naga1.548e-11147.96N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
naga1.856e-10847.78N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
gla1.802e-10048.97galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041... [more]
naga2.335e-7653.88N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naga2.188e-11450.56N-acetylgalactosaminidase, alpha- [Source:NCBI gen... [more]
gla2.837e-9748.46galactosidase alpha [Source:NCBI gene;Acc:10014576... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naga1.609e-10645.48N-acetyl galactosaminidase, alpha [Source:MGI Symb... [more]
Gla4.821e-9849.23galactosidase, alpha [Source:MGI Symbol;Acc:MGI:13... [more]
Gla4.856e-9849.23galactosidase, alpha [Source:MGI Symbol;Acc:MGI:13... [more]
Naga1.092e-8050.42N-acetyl galactosaminidase, alpha [Source:MGI Symb... [more]
Naga2.014e-8050.21N-acetyl galactosaminidase, alpha [Source:MGI Symb... [more]
back to top
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90744|NAGAB_CHICK3.393e-11349.86Alpha-N-acetylgalactosaminidase OS=Gallus gallus O... [more]
sp|P17050|NAGAB_HUMAN4.820e-10845.36Alpha-N-acetylgalactosaminidase OS=Homo sapiens OX... [more]
sp|Q66H12|NAGAB_RAT1.257e-10743.67Alpha-N-acetylgalactosaminidase OS=Rattus norvegic... [more]
sp|Q58DH9|NAGAB_BOVIN6.244e-10744.70Alpha-N-acetylgalactosaminidase OS=Bos taurus OX=9... [more]
sp|Q9QWR8|NAGAB_MOUSE1.126e-10545.48Alpha-N-acetylgalactosaminidase OS=Mus musculus OX... [more]
back to top
BLAST of Alpha-galactosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5GMA32.323e-12457.64Alpha-galactosidase (Fragment) OS=Anoplophora glab... [more]
A0A2P8ZLY12.001e-12253.80Alpha-galactosidase OS=Blattella germanica OX=6973... [more]
K1PB461.414e-12147.28Alpha-galactosidase OS=Crassostrea gigas OX=29159 ... [more]
A0A0X3Q2B01.663e-12150.75Alpha-galactosidase OS=Schistocephalus solidus OX=... [more]
A0A437B3G71.750e-12046.70Alpha-galactosidase OS=Chilo suppressalis OX=16863... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NAGA1.915e-10852.29alpha-N-acetylgalactosaminidase-like [Source:NCBI ... [more]
naga3.785e-10444.58alpha-N-acetylgalactosaminidase-like [Source:NCBI ... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naga4.045e-11145.54N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
gla3.243e-9646.51galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO374406.780e-11650.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420261.631e-10849.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304613.280e-2838.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283861.617e-1767.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
naga1.534e-10250.00alpha-N-acetylgalactosaminidase [Source:NCBI gene;... [more]
gla6.419e-9847.94galactosidase alpha [Source:NCBI gene;Acc:10116904... [more]
naga5.619e-9746.59alpha-N-acetylgalactosaminidase [Source:NCBI gene;... [more]
back to top
BLAST of Alpha-galactosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000009913.10.000e+092.77SMESG000009913.1[more]
SMESG000009912.10.000e+088.17SMESG000009912.1[more]
SMESG000016213.13.973e-12549.87SMESG000016213.1[more]
SMESG000016280.12.197e-12148.79SMESG000016280.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032907 ID=SMED30032907|Name=Alpha-galactosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1488bp
TAGTTAATTAAAAAATGTTTGATAATTAAACTTTACAGTTGTTTTAATCA
TAAATACCTTCAAAAGCTTATTGAAATCACCTGATTTCACTTGGCCGCAT
TTTATCAGCACATTTTATCAGTGCAAACCCATTAACGAGGCCACGTGCTG
GATCATTATGCAAATATAAGACATATCATCATCATAAATTTTTATTTTTT
ACAATGAAATCATTACTTTACATATCATTATTCATTCTTATTCCTTTATG
CTTGGGTTCAGATAACGGGTTGGCAAGAACCCCACCGATGGGATGGATGA
CTTGGGAAAGGTTCCGATGCACGACTGATTGCGTCAAGTATCCGAGTGAA
TGCATCAGTGAAAATTTAATCATATCTCAAGCTTTCAATATGAGAATGAA
CGGGTTTTCCAGTGCAGGATATGAATACATTGTCATTGATGATTGTTGGC
TGAACAAATCCCGGGCTAAAGACGGAAGTCTTATTCCAGATCCAATTAGA
TTTCCAAATGGAATGGTTTACTTGAGTACAGTCATTCACAGTCTGGGACT
AAAATTCGGAATTTATGAAGATTACGGAACAAAGACGTGTGGAGGTTATC
CTGGAAGCCTGAATCATATTAAACAGGATATTGCTACATTTGTTAAATGG
GAGGTTGATTACATTAAACTTGATGGCTGCTACAGTAATCCTTCAACACA
GCCCCAAGGCTACGCTGAGTACAGCCACTATCTCAATTTAACTAACCGAC
CGATTGTATTCTCATGTAGCTGGCCAGCTTATTTCGACGTACGTAATATT
ACCCCATCGTTAACTAAACTTCTGCAGAGCTCCTGCAATCTCTGGCGAAT
GTATGACGACATCGACGACTCCTGGACTTCGGTTCTCGGAATAATAAATT
ATCATAAACTCAATTTAAACAAATTTTCTACATGGGCCGCTCCTGGTCAT
TGGAATGATCCGGATATGCTGATCATAGGGAACACGGGACTGAACTATAA
CCAACAGAGAGTTCAAATGGGAATGTGGGCAATATTCGCGGCGCCATTGT
TGATGTCAAACGATCTGAGAGATATTAACGACGACTCTGTGAAACTGTTA
TTGAATAAAAATATCCTAGCAATTAACCAGGACCCTTTGGGTAAGCAAGG
CAAGTTTTTGTTTGAGAAAAATCTTATCCAAGTATGGCGAAGGGATTTGT
CACAATCAAGAACTGCGATTGCCGTATTGAATGCCGGCAATAGCGATCAA
ATATTTTATTTATATTTAACGGATGTCGGATTCTCCATTGACAAACAATA
TGATGTTTCTGACGCTTTCACAATGTCAACTAACAGAACAATCGGTTTGA
CAACGCAAATCACTTTCCAGCTTCCGTCAACCTCAATTGACATACTCTAT
GTCTATTAATTGTCAAGGTTTTGTAATTTTAGACAATTATTATATATTGC
AAGTTTCCTTATACGTAAAGGTTTATAATAGTAATAAC
back to top

protein sequence of SMED30032907-orf-1

>SMED30032907-orf-1 ID=SMED30032907-orf-1|Name=SMED30032907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MKSLLYISLFILIPLCLGSDNGLARTPPMGWMTWERFRCTTDCVKYPSEC
ISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRF
PNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWE
VDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNIT
PSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHW
NDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVKLLL
NKNILAINQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQI
FYLYLTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYV
Y*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035373Melibiase/NAGA_C
IPR002241Glyco_hydro_27
IPR013785Aldolase_TIM
IPR013780Glyco_hydro_b
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003824catalytic activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002241Glycoside hydrolase, family 27PRINTSPR00740GLHYDRLASE27coord: 245..264
score: 56.0
coord: 266..287
score: 38.18
coord: 67..82
score: 56.56
coord: 108..129
score: 47.05
coord: 169..187
score: 42.89
coord: 21..40
score: 58.25
coord: 142..159
score: 51.94
IPR002241Glycoside hydrolase, family 27PFAMPF16499Melibiase_2coord: 26..310
e-value: 6.3E-124
score: 412.7
IPR002241Glycoside hydrolase, family 27PANTHERPTHR11452ALPHA-GALACTOSIDASE/ALPHA-N-ACETYLGALACTOSAMINIDASEcoord: 9..376
IPR002241Glycoside hydrolase, family 27CDDcd14792GH27coord: 27..310
e-value: 6.18733E-129
score: 369.962
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 313..401
e-value: 1.1E-9
score: 40.2
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 19..312
e-value: 8.5E-116
score: 388.7
IPR035373Alpha galactosidase A, C-terminal beta-sandwich domainPFAMPF17450Melibiase_2_Ccoord: 313..388
e-value: 8.6E-11
score: 41.9
NoneNo IPR availablePANTHERPTHR11452:SF58coord: 9..376
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.889
NoneNo IPR availableSUPERFAMILYSSF51011Glycosyl hydrolase domaincoord: 312..400
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 21..311