Transient receptor potential cation channel,putative

Overview
NameTransient receptor potential cation channel,putative
Smed IDSMED30032899
Length (bp)5265
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel,putative (SMED30032899) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel,putative (SMED30032899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel,putative (SMED30032899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel,putative (SMED30032899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032899

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032899SMESG000041546.1 SmedASXL_003292SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032899SMESG000041546.1 SmedASXL_004025SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032899SMESG000041546.1 SmedASXL_004024SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032899SMESG000041546.1 SmedASXL_016263SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032899SMESG000041546.1 SmedASXL_016262SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30032899SMESG000041546.1 SMESG000041545.1 Contig48178newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032899SMESG000041546.1 SMESG000041545.1 Contig48178uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032899SMESG000079673.1 SMESG000079430.1 SMESG000078509.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000066411.1 SMESG000066165.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000041546.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000024909.1 SMESG000024597.1 SMESG000023611.1 SMESG000022704.1 SMESG000021499.1 SMESG000020698.1 SMESG000019334.1 SMESG000017989.1 SMESG000013635.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000004687.1 SMESG000001234.1 Contig34851newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032899SMESG000079673.1 SMESG000079430.1 SMESG000078509.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000066411.1 SMESG000066165.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000041546.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000024909.1 SMESG000024597.1 SMESG000023611.1 SMESG000022704.1 SMESG000021499.1 SMESG000020698.1 SMESG000019334.1 SMESG000017989.1 SMESG000013635.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000004687.1 SMESG000001234.1 Contig34851uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032899SMESG000041546.1 Contig29701uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032899SMESG000041546.1 Contig29701newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30032899SMESG000041546.1 dd_Smed_v4_17857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032899SMESG000041546.1 dd_Smed_v4_17857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032899SMESG000041546.1 dd_Smed_v4_17857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032899SMESG000041546.1 dd_Smed_v4_17857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032899SMESG000041546.1 dd_Smed_v4_39557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032899SMESG000041546.1 dd_Smed_v4_39557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032899SMESG000041546.1 dd_Smed_v4_39557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032899SMESG000041546.1 dd_Smed_v6_17857_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30032899SMESG000078509.1 SMESG000076652.1 SMESG000066165.1 SMESG000057427.1 SMESG000050587.1 SMESG000050353.1 SMESG000041546.1 SMESG000037212.1 SMESG000031049.1 SMESG000022704.1 SMESG000020698.1 SMESG000019334.1 SMESG000008964.1 SMESG000004687.1 Contig53170newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032899SMESG000078509.1 SMESG000076652.1 SMESG000066165.1 SMESG000057427.1 SMESG000050587.1 SMESG000050353.1 SMESG000041546.1 SMESG000037212.1 SMESG000031049.1 SMESG000022704.1 SMESG000020698.1 SMESG000019334.1 SMESG000008964.1 SMESG000004687.1 Contig53170uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 289.656 bits (740), Expect = 2.980e-78
Identity = 301/1162 (25.90%), Postives = 537/1162 (46.21%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ-------GLRLIGFKKN---NKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         G   I FK N   + R+SL DIG V++YL+G  Y   Y    F+  + +       ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  L
Sbjct:   66 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL 1165          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 286.96 bits (733), Expect = 4.669e-78
Identity = 297/1166 (25.47%), Postives = 541/1166 (46.40%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN----KRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINF-EVKPNLTMSEFSMILYEMFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         KK N     R+SL DIG V++YL+G  Y   Y    F+  + +                 ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   +P+  +++       +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  L
Sbjct:   64 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRD------VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVK--MERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAK------NIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL 1161          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 284.263 bits (726), Expect = 1.420e-76
Identity = 297/1162 (25.56%), Postives = 534/1162 (45.96%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++    +  G    + R+SL DIG V++YL+G  Y   Y    F+  + +                 ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  L
Sbjct:   64 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKK--GNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL 1161          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 267.7 bits (683), Expect = 1.371e-71
Identity = 279/1071 (26.05%), Postives = 506/1071 (47.25%), Query Frame = 3
Query:  963 YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ-------GLRLIGFKKN---NKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         G   I FK N   + R+SL DIG V++YL+G  Y   Y    F+  + +       ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  L
Sbjct:    2 YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL 1010          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 263.077 bits (671), Expect = 3.234e-70
Identity = 279/1081 (25.81%), Postives = 506/1081 (46.81%), Query Frame = 3
Query:  963 YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ-------GLRLIGFKKN---NKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         G   I FK N   + R+SL DIG V++YL+G  Y   Y    F+  + +                 ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  L
Sbjct:    2 YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL 1020          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 209.534 bits (532), Expect = 3.568e-54
Identity = 282/1197 (23.56%), Postives = 514/1197 (42.94%), Query Frame = 3
Query:  759 WIPQNICQFEC--YSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK--------------PTNFFGEIEFSG---LYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFE-GHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDF-TDAYGENQMYGFAITPWSIHNETEYLCSKD---YQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSL-VKNGKPTVIIKGSGGLANII----------GELVYEMKEKNRK--KKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISN--------------------------GTKLARILNQGLRLI-------GFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT-----NVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIV----NFKSLFYLPES--EIVEYKKK-----LKNKQKISTRQCSESE---KKDSNTKKIP--RKRNFTFQLKTY----------------FKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAF---GSGIS--IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMC-PDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYS 4004
            WI     + EC  ++ +P+     +C CG+ ++ H      +  +    +EK               T+ FG I F G    +K++ YVR+S +++      L+   W +  P L+I+++G  S+FE    +  + +KG+LK+A  + T  WIIT G+ + ++  + KA+ +    A   +Q+    I PW +    E L  ++   Y   H    N            +  HS+++  D   T     + +  R   EN ++           N  KVP+   L+ G    +  +H  + +K   P ++  GSG  A+II          G    E+ EK R   K  F E  Q+E  + I                   E +    L+ I+   +    ++D  ILS++L Q +N    PD     QL + +S NR D+AK  +F+ G+KW ++ L      ++  ++V FV+  +E G  +   +++  LENLY  D  N                          G  + +++    +L        G     KR++        + ++    +    + +  +    +     P+ +L IW++LT R  MA+ +W   ++++A  L A  L ++   +      +V   K   D   K  E   E ++++C++ + + T   L  +L ++G +  L +A   N+  F+AH  CQ LL  +W G+L   + S    + ++  +ICP  I F+     + K+   L E   E + Y ++       N+ + S     + E   +K S TKK+     R  +     Y                F++   FY++P+ KF      +LIF+   T + L    +K SK    WI  +   +TV+L +E  R+     GS I+  +K +    +NI    +  FFL+G +G                 F + PM   S     + + +  FS  LF ++I +Y S++  LGP I M   M+ + +    V+LL  L+++G+   ++    +PN+    + +++  +F   YF L+G    +V  GE  +  C +  + C P   G ++ P++  ++++++N+L+LNLL+AIF+N Y      S + W  +RYQ + +    P + PP  IF  +Y     L  ++    + F+  +S
Sbjct:   88 WIENTFEKRECIRFAALPKDPE--RCGCGRPLSAHTPASTFFSTLPVHLLEKEQQTWTIANNTQTSTTDAFGTIVFQGGAHAHKAQ-YVRLSYDSEPLDVMYLMEKVWGLEAPRLVITVHGGMSNFELEERLGRLFRKGMLKAA--QTTGAWIITSGLDSGVVRHVAKALDEAGISARMRSQIVTIGIAPWGVIKRKERLIRQNEHVYYDVHSLSVN------ANVGILNDRHSYFLLAD-NGTVGRFGADLHLRQNLENHIATFG-------CNGRKVPVVCTLLEGGISSINAIHDYVTMKPDIPAIVCDGSGRAADIISFAARYINSDGTFAAEVGEKLRNLIKMVFPETDQEEMFRKI------------------TECVIRDDLLRIFRYGQEEEEDVDFVILSTVL-QKQNLP--PDE----QLALTLSWNRVDLAKSCLFSNGRKWSSDVLEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINSAHSVRNWMENFDSMDPHTYLTIPMIGQVVEKLMGNAFQLYYTSRSFKGKYDRYKRINQSSYFHRKRKIVQKELFKKKSDDQINDNEEEDFSFAYPFNDLLIWAVLTSRHGMAECMWVHGEDAMAKCLLAIRLYKATAKIAEDEYLDVEEAKRLFDNAVKCREDAIE-LLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSN---VRVLTALICPPAILFMAYKPKHSKTARLLSEETPEQLPYPRESITSTTSNRYRYSKGPEEQKETLLEKGSYTKKVTIISSRKNSGVASVYGSASSMMFKREPQLNKFERFRAFYSSPITKFWSWCIAFLIFLTTQTCILLLETSLKPSKYE--WITFI---YTVTLSVEHIRKLMTSEGSRINEKVKVFYAKWYNIWTSAALLFFLVG-YG-----------------FRLVPMYRHS-----WGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAAKMVWS-MCYICVLLLVPLMAFGVNRQAL---TEPNVKDWHW-LLVRNIFYKPYFMLYG----EVYAGE--IDTCGDEGIRCFP---GYFIPPLLMVIFLLVANILLLNLLIAIFNNIYNDSIEKSKEIWLFQRYQQLMEYHDSPFLPPPFSIFAHVYHFIDYLYNLRRPDTKRFRSEHS 1194          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 131.724 bits (330), Expect = 3.112e-30
Identity = 103/417 (24.70%), Postives = 196/417 (47.00%), Query Frame = 3
Query:  909 PTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGS----DFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAE-YNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTAD 2141
            PT+ +G I F G      Y R+S ++       L++  WK+  P LII+I G     D +    +   +KGI+K A  + T  WIIT G+   +++ +  A+ D  +   +N +    I  W +  +      KD   T+    +N      T+ ++ + NHS+++F D   T +   + I  R        +L  +LA        +PL  +++ G    +K++H  +    + P ++  GSG  A+I+    ++   +N       + ++ + + ++           ++ +  I E   N+ L+ I+ + E++  +LD  I+S LL     ++  P+     QL +A++ NR D+A+ +IF  G +W T+DL     +++S +++ FV L +E G  + K +T   LE+LY  D
Sbjct:  192 PTDAYGNIVFEGTAHHAQYARISFDSDPRDIVHLMMKVWKLKPPKLIITINGGLTKFDLQPKLAR-TFRKGIMKIA--KSTDAWIITSGLDEGVVKHLDSALHDHGNHTSKNHVVAIGIASWGMLKQRSRFVGKDSTVTYATNVFNN-----TRLKELNDNHSYFLFSD-NGTVNRYGAEIIMR-------KRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMVHDYVTTIPRIPVIVCDGSGRAADILA-FAHQAVSQN---GFLSDNIRNQLVNIVRRIFGYDPKTAQKLIKQIVECSTNKSLMTIFRLGESSREDLDHVIMSCLLKG--QNLSPPE-----QLQLALAWNRADIARTEIFANGTEWTTQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLYNTD 581          

HSP 2 Score: 85.5001 bits (210), Expect = 3.557e-16
Identity = 50/144 (34.72%), Postives = 76/144 (52.78%), Query Frame = 3
Query: 2298 FQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKN----LTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTL 2717
             +E  + +   + PY +L IW++LT R +MA+L+WT  +E +A AL A+ L  S+       T  I    D  E++ +F   A  V+E C K   + T   L  +L  +G  T L +AA+    KF+AH  CQ LL  +W+G L
Sbjct:  703 LEEEANMDFTFRYPYSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGL 846          

HSP 3 Score: 53.9138 bits (128), Expect = 1.319e-6
Identity = 110/515 (21.36%), Postives = 211/515 (40.97%), Query Frame = 3
Query: 2895 ESEKKDSNTKKIPRKRNFTFQLKT-----YFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYIL---LIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFD--------------ITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGE-------NNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVF------ARLITIKVGQKQPFKISYSS------LPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDII-EENVNTIYDILRKLG 4301
            +++ +  ++++    RN T Q+ T     + KK+ +FY AP+  +                               LW +     LI  T +LL++  R A  S   +  Y+  +W     L     ++ T  I+M  S P++K L    F               I   + +S       + +   +  +++++++ Y S+   LGP I ++  M+   + P  V++   L ++G+L  SI +  +      ++  IL   +FL  YF L+G +    ID    E        N+     N      V G W+ P+   V+M+ +NVL++N++VA  +  +E    S+ + +  ERY  + +  S P + PP  I + + ++F      +R+   K    Q  K+  S         ++E+ +   +R      + S DE+      +T  I+NR                S   ++  +  E I  +E +++ MD   +E +N + D+ +KLG
Sbjct: 1037 DTQTRQKSSREFSSSRNVTVQVYTQRPLSWKKKIMEFYKAPITTYW------------------------------LWFFAFIWFLILLTYNLLVKTQRIASWSEWYVFAYIF-VWT----LEIGRKVVST--IMMDTSKPVLKQLRVFFFQYRNGLLAFGLLTYLIAYFIRLSPTTKTLGRILIICNSVIWSLKLVDYLSVQQGLGPYINIVAEMIPT-MIPLCVLVFITLYAFGLLRQSITYPYE------DWHWILVRNIFLQPYFMLYGEVYAAEIDTCGDEIWQTHEDENIPISMLNVTHETCVPGYWIAPVGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTPWLPPPFTIIYHVIWLFKLIKSSSRMFERKNLFDQSLKLFLSPDEMEKVHTFEEESVEDMKRETEKKNLSSNDERIHRTAERTDAILNR---------------VSHLTQLEFTLKEEIRELEHKMKNMDSRHKEQMNLMLDMNKKLG 1492          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 121.324 bits (303), Expect = 4.275e-27
Identity = 126/543 (23.20%), Postives = 236/543 (43.46%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKY-----------------------DFVDTEN-----------------VEKPTNFFGEIEFSG---LYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGV 2246
            W+ +   + EC   I     L +C CG+    H ++ E                         D ++T+N                 V   TN FG++EF G    YK++ YVR++ +T+     SL    W+I+ P LII+++G  S+F+    +  + +KG+LK+A    T  WIIT G  T +++ +  A+     A   N++    I PW +  + E    +D   T P  Y   SSK  +    +  HS+++ VD   T     + +  R   E  +S+  +    T+     VP+  +++ G    ++ +   +    + P V+  GSG  A+++      + E         + ++++ L ++ T            +  +    ++++L+ I+ + E   +++D  IL++LL       K  +     QL +A++ NR D+A+  +F  G +W    L     +++  ++V FV+L +E+G  + K +T+  L+ LY  D      L  I+   +R+    +   R  L DIG V
Sbjct:  223 WVRETFTRRECSRFIASSRDLHKCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGGPHPYKAQ-YVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAAST--TGAWIITSGCDTGVVKHVAAALEGAQSAQ-RNKIVCIGIAPWGLLKKREDFIGQDK--TVP--YYPSSSKG-RFTGLNNRHSYFLLVD-NGTVGRYGAEVILRKRLEMYISQKQKIFGGTR----SVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGL----LPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALL-------KGQNLSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVRV----RQGYRFKLPDIGLV 736          

HSP 2 Score: 79.337 bits (194), Expect = 2.827e-14
Identity = 51/159 (32.08%), Postives = 83/159 (52.20%), Query Frame = 3
Query: 2337 PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISD------KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFI 2795
            PY EL IW++LT R +MA  +W   +E++A AL A  L +S+   T    D       ++L ++A++F   +  +++ C+  +   T   L  +L  +   T L +A   N+  F+AH  CQ LL  +W G L   T S    + +++G+ICP   PFI
Sbjct:  891 PYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLA--TEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSN---IKVVLGLICP---PFI 1041          

HSP 3 Score: 66.6254 bits (161), Expect = 1.987e-10
Identity = 68/276 (24.64%), Postives = 126/276 (45.65%), Query Frame = 3
Query: 3114 IYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIF-----LFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLR--GENNLRQCANNN-----------LMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQ 3872
            I  +LI +  +  +E+ R+   S        I+ Y+   WN + IL+  F+++G F                              +  F    YG  I      L+T+++L Y S++ KLGP + M   M+ N +   IV+L+  L+S+G+   SI +   P+ T     +++  +FL  YF L+G +  D +   G+    Q   N            L C  V G W+ P++   +++++N+L++++L+AIF++ ++     S Q W  +RY+
Sbjct: 1278 IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFF------------------------------MRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQN-MSYIIVMLVVTLLSFGLARQSITY---PDETW--HWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSC--VPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYK 1515          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 121.324 bits (303), Expect = 4.615e-27
Identity = 126/543 (23.20%), Postives = 236/543 (43.46%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKY-----------------------DFVDTEN-----------------VEKPTNFFGEIEFSG---LYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGV 2246
            W+ +   + EC   I     L +C CG+    H ++ E                         D ++T+N                 V   TN FG++EF G    YK++ YVR++ +T+     SL    W+I+ P LII+++G  S+F+    +  + +KG+LK+A    T  WIIT G  T +++ +  A+     A   N++    I PW +  + E    +D   T P  Y   SSK  +    +  HS+++ VD   T     + +  R   E  +S+  +    T+     VP+  +++ G    ++ +   +    + P V+  GSG  A+++      + E         + ++++ L ++ T            +  +    ++++L+ I+ + E   +++D  IL++LL       K  +     QL +A++ NR D+A+  +F  G +W    L     +++  ++V FV+L +E+G  + K +T+  L+ LY  D      L  I+   +R+    +   R  L DIG V
Sbjct:  183 WVRETFTRRECSRFIASSRDLHKCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGGPHPYKAQ-YVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAAST--TGAWIITSGCDTGVVKHVAAALEGAQSAQ-RNKIVCIGIAPWGLLKKREDFIGQDK--TVP--YYPSSSKG-RFTGLNNRHSYFLLVD-NGTVGRYGAEVILRKRLEMYISQKQKIFGGTR----SVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGL----LPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALL-------KGQNLSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVRV----RQGYRFKLPDIGLV 696          

HSP 2 Score: 78.9518 bits (193), Expect = 3.114e-14
Identity = 51/159 (32.08%), Postives = 83/159 (52.20%), Query Frame = 3
Query: 2337 PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISD------KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFI 2795
            PY EL IW++LT R +MA  +W   +E++A AL A  L +S+   T    D       ++L ++A++F   +  +++ C+  +   T   L  +L  +   T L +A   N+  F+AH  CQ LL  +W G L   T S    + +++G+ICP   PFI
Sbjct:  851 PYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLA--TEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSN---IKVVLGLICP---PFI 1001          

HSP 3 Score: 66.6254 bits (161), Expect = 2.083e-10
Identity = 68/276 (24.64%), Postives = 126/276 (45.65%), Query Frame = 3
Query: 3114 IYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIF-----LFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLR--GENNLRQCANNN-----------LMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQ 3872
            I  +LI +  +  +E+ R+   S        I+ Y+   WN + IL+  F+++G F                              +  F    YG  I      L+T+++L Y S++ KLGP + M   M+ N +   IV+L+  L+S+G+   SI +   P+ T     +++  +FL  YF L+G +  D +   G+    Q   N            L C  V G W+ P++   +++++N+L++++L+AIF++ ++     S Q W  +RY+
Sbjct: 1238 IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFF------------------------------MRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQN-MSYIIVMLVVTLLSFGLARQSITY---PDETW--HWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSC--VPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYK 1475          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 121.324 bits (303), Expect = 5.383e-27
Identity = 126/543 (23.20%), Postives = 236/543 (43.46%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKY-----------------------DFVDTEN-----------------VEKPTNFFGEIEFSG---LYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGV 2246
            W+ +   + EC   I     L +C CG+    H ++ E                         D ++T+N                 V   TN FG++EF G    YK++ YVR++ +T+     SL    W+I+ P LII+++G  S+F+    +  + +KG+LK+A    T  WIIT G  T +++ +  A+     A   N++    I PW +  + E    +D   T P  Y   SSK  +    +  HS+++ VD   T     + +  R   E  +S+  +    T+     VP+  +++ G    ++ +   +    + P V+  GSG  A+++      + E         + ++++ L ++ T            +  +    ++++L+ I+ + E   +++D  IL++LL       K  +     QL +A++ NR D+A+  +F  G +W    L     +++  ++V FV+L +E+G  + K +T+  L+ LY  D      L  I+   +R+    +   R  L DIG V
Sbjct:  284 WVRETFTRRECSRFIASSRDLHKCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGGPHPYKAQ-YVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAAST--TGAWIITSGCDTGVVKHVAAALEGAQSAQ-RNKIVCIGIAPWGLLKKREDFIGQDK--TVP--YYPSSSKG-RFTGLNNRHSYFLLVD-NGTVGRYGAEVILRKRLEMYISQKQKIFGGTR----SVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGL----LPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALL-------KGQNLSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVRV----RQGYRFKLPDIGLV 797          

HSP 2 Score: 78.9518 bits (193), Expect = 3.200e-14
Identity = 51/159 (32.08%), Postives = 83/159 (52.20%), Query Frame = 3
Query: 2337 PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISD------KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFI 2795
            PY EL IW++LT R +MA  +W   +E++A AL A  L +S+   T    D       ++L ++A++F   +  +++ C+  +   T   L  +L  +   T L +A   N+  F+AH  CQ LL  +W G L   T S    + +++G+ICP   PFI
Sbjct:  952 PYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLA--TEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSN---IKVVLGLICP---PFI 1102          

HSP 3 Score: 66.6254 bits (161), Expect = 1.898e-10
Identity = 78/319 (24.45%), Postives = 142/319 (44.51%), Query Frame = 3
Query: 3114 IYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIF-----LFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLR--GENNLRQCANNN-----------LMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERY-QLMRQSSSRPPVAPPLIIFWQI---YFVFARLITIKVGQKQPF 3989
            I  +LI +  +  +E+ R+   S        I+ Y+   WN + IL+  F+++G F                              +  F    YG  I      L+T+++L Y S++ KLGP + M   M+ N +   IV+L+  L+S+G+   SI +   P+ T     +++  +FL  YF L+G +  D +   G+    Q   N            L C  V G W+ P++   +++++N+L++++L+AIF++ ++     S Q W  +RY Q+M   S+     P   ++  +    FV  RL   K  ++ P 
Sbjct: 1339 IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFF------------------------------MRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQN-MSYIIVMLVVTLLSFGLARQSITY---PDETW--HWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSC--VPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPM 1619          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 245.358 bits (625), Expect = 7.191e-65
Identity = 287/1146 (25.04%), Postives = 512/1146 (44.68%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSV--FEKYDFVD-----TENVEKPTNFFGEIEF-SGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMN---FEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYL-KMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEE---NNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETW-------------SSNLPLKR-------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLD--------EWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYK-KKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTY-----------FKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGS-GISIKEYLN----DIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIY 3938
            WI  N  + EC   IP  +   +C CGQ    H ++   E     D          +PT+ +G IEF  G + +K  YVR+S +T+ E    L   +W +  P L+I++ G  ++F+  A +K  ++KG+LK+A  + T  WI T G  T + + +G A+          ++    I PW I      L   + +       + ISS  +K    +  H++++ VD           I  R        KL +F++N K++       P+  +++ G  + ++ +   +  +   P V+  GSG  A+++   V++      ++   E +  ++YL   I        D+ E+    + +   N++LI ++ ++E       ELD+ IL++L      S          QL +A++ NR D+A+ +IF  G++W    L     +++  +++ FVKL +E G  + K +T+  LE LY         L  IL      I         +L+DIG V+  L+G  Y   Y   +F+  +             SS    +R                         P+ EL IW++LT R +MA L+WT  +E++A +L +  L ++M +     + +DDLD         +AK+FE+K   +++  ++++ E  +  L  +L  +   + L +A   N    +AH   Q +L  +W G L  T K+ NF   +I+G+  PF I   ++FKS   L  +P++E    + + L N     ++  +E    DS+T +    R F F L  Y            KK Y+FY AP+ KF      Y+ F++ F+F  L    +K  +    W     I +  +L  E+ R+   S  ++I    +    ++WN  D  +   F++G               L F   +         N +   + +Y      + +RIL    +N  LGP++ M+  M+ N +  F+V+L  VL+S+G+   +I +   PN     +S+I  E+    YF L+G    +V  G+ +   C  +      V G W+ PI  ++Y++++N+L++NLL+A+F+N +  + S S Q W  +R+ ++ +   +P + PP I     Y
Sbjct:   15 WIETNFQKRECIKFIPCPKDDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAA--KTTGAWIFTGGTNTGVTKQVGDALL-LEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRR--------KLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA-FVHKYASDGEEQPVLESM--RDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPE-------QLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHI---PKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHE----AAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL-RTRKNTNF--KVILGLAMPFYI-RQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQF---REF-FNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVL----VKMEQMPR-WQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIG---------------LAFRFRE---------NTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIY-FVVLLAVVLMSFGVSRQAILY---PN-KQPTWSLI-KEVTFQPYFMLYG----EVFAGDID-PPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFY 1080          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339075)

HSP 1 Score: 241.121 bits (614), Expect = 2.275e-64
Identity = 288/1181 (24.39%), Postives = 525/1181 (44.45%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSV--FEKYD----FVDTENVE-KPTNFFGEIEF-SGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMN---FEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEE---NNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETW-------------SSNLPLKR-------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLD--------EWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYK-KKLKNKQKISTRQCSESEKKDS----NTK-----KIPRKRNFTFQLKTYF-----------------KKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGS-GISIKEYLN----DIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISY 4001
            WI  N  + EC   IP  +   +C CGQ    H ++   E       ++ T++   +PT+ +G IEF  G + +K  YVR+S +T+ E    L   +W +  P L+I++ G  ++F+  A +K  ++KG+LK+A  + T  WI T G  T + + +G A+          ++    I PW I      L   + +       + ISS  +K    +  H++++ VD           I  R        KL +F++N K++       P+  +++ G  + ++ +   +  +   P V+  GSG  A+++   V++      ++   E  M+   +  I        D+ E+    + +   N++LI ++ ++E       ELD+ IL++L      S          QL +A++ NR D+A+ +IF  G++W    L     +++  +++ FVKL +E G  + K +T+  LE LY         L  IL      I         +L+DIG V+  L+G  Y   Y   +F+  +             SS    +R                         P+ EL IW++LT R +MA L+WT  +E++A +L +  L ++M +     + +DDLD         +AK+FE+K   +++  ++++ E  +  L  +L  +   + L +A   N    +AH   Q +L  +W G L  T K+ NF   +I+G+  PF I  + +FKS   L  +P++E    + + L N     ++  +E+   D+    +TK     K+    + T Q + +F                 KK Y+FY AP+ KF      Y+ F++ F+F  L    +K  +    W     I +  +L  E+ R+   S  ++I    +    ++WN  D  +   F++G               L F   +         N +   + +Y      + +RIL    +N  LGP++ M+  M+ N +  F+V+L  VL+S+G+   +I +   PN     +S+I  E+    YF L+G    +V  G+ +   C  +      V G W+ PI  ++Y++++N+L++NLL+A+F+N +  + S S Q W  +R+ ++ +   +P + PP I     Y +    +    G+    K S+
Sbjct:   15 WIETNFQKRECIKFIPCPKDDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAA--KTTGAWIFTGGTNTGVTKQVGDALL-LEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRR--------KLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA-FVHKYASDGEEQPVLES-MRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPE-------QLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHI---PKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHE----AAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL-RTRKNTNF--KVILGLAMPFYIRQL-DFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVL----VKMEQMPR-WQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIG---------------LAFRFRE---------NTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIY-FVVLLAVVLMSFGVSRQAILY---PN-KQPTWSLI-KEVTFQPYFMLYG----EVFAGDID-PPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRKAKGEPGMSKFSF 1120          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 239.965 bits (611), Expect = 3.737e-63
Identity = 288/1171 (24.59%), Postives = 520/1171 (44.41%), Query Frame = 3
Query:  729 ETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSV--FEKYDFVD-----TENVEKPTNFFGEIEF-SGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMN---FEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYL-KMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEE---NNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETW-------------SSNLPLKR-------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLD--------EWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYK-KKLKNKQKISTRQCSESEKKDS----NTK-----KIPRKRNFTFQLKTYF-----------------KKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGS-GISIKEYLN----DIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIY 3938
            E L + +   WI  N  + EC   IP  +   +C CGQ    H ++   E     D          +PT+ +G IEF  G + +K  YVR+S +T+ E    L   +W +  P L+I++ G  ++F+  A +K  ++KG+LK+A  + T  WI T G  T + + +G A+          ++    I PW I      L   + +       + ISS  +K    +  H++++ VD           I  R        KL +F++N K++       P+  +++ G  + ++ +   +  +   P V+  GSG  A+++   V++      ++   E +  ++YL   I        D+ E+    + +   N++LI ++ ++E       ELD+ IL++L      S          QL +A++ NR D+A+ +IF  G++W    L     +++  +++ FVKL +E G  + K +T+  LE LY         L  IL      I         +L+DIG V+  L+G  Y   Y   +F+  +             SS    +R                         P+ EL IW++LT R +MA L+WT  +E++A +L +  L ++M +     + +DDLD         +AK+FE+K   +++  ++++ E  +  L  +L  +   + L +A   N    +AH   Q +L  +W G L  T K+ NF   +I+G+  PF I   ++FKS   L  +P++E    + + L N     ++  +E+   D+    +TK     K+    + T Q + +F                 KK Y+FY AP+ KF      Y+ F++ F+F  L    +K  +    W     I +  +L  E+ R+   S  ++I    +    ++WN  D  +   F++G               L F   +         N +   + +Y      + +RIL    +N  LGP++ M+  M+ N +  F+V+L  VL+S+G+   +I +   PN     +S+I  E+    YF L+G    +V  G+ +   C  +      V G W+ PI  ++Y++++N+L++NLL+A+F+N +  + S S Q W  +R+ ++ +   +P + PP I     Y
Sbjct:  107 EPLKEHQPRSWIETNFQKRECIKFIPCPKDDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAA--KTTGAWIFTGGTNTGVTKQVGDALL-LEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRR--------KLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA-FVHKYASDGEEQPVLESM--RDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPE-------QLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHI---PKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHE----AAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL-RTRKNTNF--KVILGLAMPFYI-RQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVL----VKMEQMPR-WQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIG---------------LAFRFRE---------NTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIY-FVVLLAVVLMSFGVSRQAILY---PN-KQPTWSLI-KEVTFQPYFMLYG----EVFAGDID-PPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFY 1201          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339076)

HSP 1 Score: 239.58 bits (610), Expect = 4.600e-63
Identity = 286/1161 (24.63%), Postives = 516/1161 (44.44%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSV--FEKYDFVD-----TENVEKPTNFFGEIEF-SGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMN---FEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYL-KMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEE---NNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETW-------------SSNLPLKR-------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLD--------EWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYK-KKLKNKQKISTRQCSESEKKDS----NTK-----KIPRKRNFTFQLKTYF-----------------KKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGS-GISIKEYLN----DIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIY 3938
            WI  N  + EC   IP  +   +C CGQ    H ++   E     D          +PT+ +G IEF  G + +K  YVR+S +T+ E    L   +W +  P L+I++ G  ++F+  A +K  ++KG+LK+A  + T  WI T G  T + + +G A+          ++    I PW I      L   + +       + ISS  +K    +  H++++ VD           I  R        KL +F++N K++       P+  +++ G  + ++ +   +  +   P V+  GSG  A+++   V++      ++   E +  ++YL   I        D+ E+    + +   N++LI ++ ++E       ELD+ IL++L      S          QL +A++ NR D+A+ +IF  G++W    L     +++  +++ FVKL +E G  + K +T+  LE LY         L  IL      I         +L+DIG V+  L+G  Y   Y   +F+  +             SS    +R                         P+ EL IW++LT R +MA L+WT  +E++A +L +  L ++M +     + +DDLD         +AK+FE+K   +++  ++++ E  +  L  +L  +   + L +A   N    +AH   Q +L  +W G L  T K+ NF   +I+G+  PF I  + +FKS   L  +P++E    + + L N     ++  +E+   D+    +TK     K+    + T Q + +F                 KK Y+FY AP+ KF      Y+ F++ F+F  L    +K  +    W     I +  +L  E+ R+   S  ++I    +    ++WN  D  +   F++G               L F   +         N +   + +Y      + +RIL    +N  LGP++ M+  M+ N +  F+V+L  VL+S+G+   +I +   PN     +S+I  E+    YF L+G    +V  G+ +   C  +      V G W+ PI  ++Y++++N+L++NLL+A+F+N +  + S S Q W  +R+ ++ +   +P + PP I     Y
Sbjct:   15 WIETNFQKRECIKFIPCPKDDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAA--KTTGAWIFTGGTNTGVTKQVGDALL-LEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRR--------KLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA-FVHKYASDGEEQPVLESM--RDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPE-------QLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHI---PKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHE----AAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL-RTRKNTNF--KVILGLAMPFYIRQL-DFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVL----VKMEQMPR-WQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIG---------------LAFRFRE---------NTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIY-FVVLLAVVLMSFGVSRQAILY---PN-KQPTWSLI-KEVTFQPYFMLYG----EVFAGDID-PPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFY 1099          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 239.195 bits (609), Expect = 6.944e-63
Identity = 287/1167 (24.59%), Postives = 518/1167 (44.39%), Query Frame = 3
Query:  741 KKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSV--FEKYDFVD-----TENVEKPTNFFGEIEF-SGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYG--SDFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMN---FEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYL-KMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEE---NNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETW-------------SSNLPLKR-------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLD--------EWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYK-KKLKNKQKISTRQCSESEKKDS----NTK-----KIPRKRNFTFQLKTYF-----------------KKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGS-GISIKEYLN----DIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIY 3938
            K +   WI  N  + EC   IP  +   +C CGQ    H ++   E     D          +PT+ +G IEF  G + +K  YVR+S +T+ E    L   +W +  P L+I++ G  ++F+  A +K  ++KG+LK+A  + T  WI T G  T + + +G A+          ++    I PW I      L   + +       + ISS  +K    +  H++++ VD           I  R        KL +F++N K++       P+  +++ G  + ++ +   +  +   P V+  GSG  A+++   V++      ++   E +  ++YL   I        D+ E+    + +   N++LI ++ ++E       ELD+ IL++L      S          QL +A++ NR D+A+ +IF  G++W    L     +++  +++ FVKL +E G  + K +T+  LE LY         L  IL      I         +L+DIG V+  L+G  Y   Y   +F+  +             SS    +R                         P+ EL IW++LT R +MA L+WT  +E++A +L +  L ++M +     + +DDLD         +AK+FE+K   +++  ++++ E  +  L  +L  +   + L +A   N    +AH   Q +L  +W G L  T K+ NF   +I+G+  PF I   ++FKS   L  +P++E    + + L N     ++  +E+   D+    +TK     K+    + T Q + +F                 KK Y+FY AP+ KF      Y+ F++ F+F  L    +K  +    W     I +  +L  E+ R+   S  ++I    +    ++WN  D  +   F++G               L F   +         N +   + +Y      + +RIL    +N  LGP++ M+  M+ N +  F+V+L  VL+S+G+   +I +   PN     +S+I  E+    YF L+G    +V  G+ +   C  +      V G W+ PI  ++Y++++N+L++NLL+A+F+N +  + S S Q W  +R+ ++ +   +P + PP I     Y
Sbjct:   27 KHQPRSWIETNFQKRECIKFIPCPKDDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAA--KTTGAWIFTGGTNTGVTKQVGDALL-LEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRR--------KLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA-FVHKYASDGEEQPVLESM--RDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPE-------QLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHI---PKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHE----AAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL-RTRKNTNF--KVILGLAMPFYI-RQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVL----VKMEQMPR-WQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIG---------------LAFRFRE---------NTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIY-FVVLLAVVLMSFGVSRQAILY---PN-KQPTWSLI-KEVTFQPYFMLYG----EVFAGDID-PPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFY 1117          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 319.316 bits (817), Expect = 3.669e-88
Identity = 373/1549 (24.08%), Postives = 680/1549 (43.90%), Query Frame = 3
Query:  732 TLDKKKLNLWIPQNICQFEC-YSIIPRKESLIQC------ECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGL-YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSD---FEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYG--ENQMYGFAITPWS-IHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELV------YEMKEKNR--------KKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVE-LLENLYT-----------ADISNGTKLARILNQ--GLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXN--------------PEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKD--DLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLK--TYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAF----GSGI--SIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANN-----NLMCP-------DVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKLWKSKFVDHLICRFVPI----------FTAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDS--ETLCWVDV 5108
            +  +  L  WI +NI + EC + +   +E + +C       C + +     + E++D       E PT+ FG+I F GL  K+  YVR+S +T  E    L+ +QWK+  P+L+IS+ G     +    +KD  ++G++K A  + T  WI+T G    +++ +G A+RD+T + G  E Q+    + PW  IHN +  +     +G  PA Y+       +    D NH+H++ VD   T+      I+ R   E  +SKL+  L N +     +P+  +++ G    L  ++ S++ N  P V+++GSG LA++I  +         M   NR        + K+F E+   E+ K I   +                     HL+ ++ ++E+   ++D  IL +LL    +      H    QL +A++ NR D+A+ +IFTE  +W + DL P    ++  +K  FV+L +E G  + + +  E  L  LY+           A    G K+ R      G R +     ++ V  + +G   + L     Y    +              P   E WS++  +  P R+LF+W+++    E+A++ W   ++ IAAAL A+ +LR +   +     ++  ++ E A  +E +A GV  EC   + +  +  LIR    +GRST L +A + +   FIAH   Q LL  +W G L         ++       C    P I  +         E ++ + +   +QK++       +  D   K+  R  +   +LK      ++  F  +P +KF + I  Y  F+  F  + +  +     + S  W  +LL  W  SL+ EE RQ +    GSG     K Y+ D+WNI+D+LS   F+ G                      +   +  S  +    K +      +F +R++  FSI+  LGP I+++R M+ +      ++ + V V+YG+    I  E +  L     + I+       Y  +FGN   ++     ++  C+ N        CP        V+  WL  ++  VY++ +N+L+LNLL+AIF+ T++ +Q ++   W  +RY+L+++  SRP + PP I+   +  +F R + ++   ++           +E++L+ WE    ++Y+ S      ++++++  + +R       +G M +  E  +  +  +  +R++ +E   +++    + +  I D L+  G    +   +  SK +       +    +S  E  D   P +  + L+     + D  + RF P+          F+  QP  + + DS ES    L +           NP       GK  L   G N  +H + +RW+        D    +L+ L +      E  + ++    + ++ L  +  LE+I+     ++N+K    KT L   E          +VY+GY+ D RN+DN+W+ETS   +H + N      + HM++   S  + L W +V
Sbjct:   30 SFQRCSLASWIKENIKKKECCFYVEDGREGICKCGYPKVQHCDEAIKPEDYMGEQWD-KHRHVRETPTDAFGDISFGGLGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVA--QTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLI---HPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVD-DGTQGHYGVEIELRARLEKLISKLS--LGNRESGV-TIPVVCVVLDGGPGTLNTIYNSML-NHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMP------------------HLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVR-HLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADT-VWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLL-------CMIFFPLI--YTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQS-DGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDF-----QTSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAG----------------------LICRLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWV-VAYGVAKQGILIENEERL-----NWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPFILLSHL-ILFIRGVFLRDLPQRHKNFRQELEQTEEEELLSWEAYMKDNYLAS------TRQDESQSVEHRIHDTAEKVGAMSELLEREQEMVSATMAKRLARLE---EQVSESAKALRWIIDALKSQGCKSKVQPPLMRSKSS------DRDDGDSSGQETDDEEAPHMFARQLQ-----YPDSTVRRF-PVPEEKVSWEVNFSPYQPPVYNQQDSSESDTSALDKHR---------NPGGRTGIRGKGALNTLGPNHILHPIFTRWR--------DAEHKVLEFLAV--WEDAEKRWALLGGPAQPDEPL--AQVLERILGK---KLNEK---TKTLLKAGE----------EVYKGYVDDSRNTDNAWVETSIITLHCDKNTPLMADLNHMVESSLSSHQPLQWREV 1445          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Zebrafish
Match: hrc (histidine rich calcium binding protein [Source:ZFIN;Acc:ZDB-GENE-041008-189])

HSP 1 Score: 293.893 bits (751), Expect = 9.480e-81
Identity = 304/1198 (25.38%), Postives = 549/1198 (45.83%), Query Frame = 3
Query:  744 KKLNL-WIPQNICQFECYSIIPRKESLI-QCECGQNVADHHSVFEKYDFVDT---------ENVEKPTNFFGEIEFSGLYKSKPY-VRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAI-----KDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGE---NQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEE----IMQ-KEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNP--------EFQETWSSNLP----------------LKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNF------------KSLFYLPESEI-VEYKKKL----KNKQKISTRQCSESEKKDS-NTKKI---------PRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSG-----ISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRI-DVLRGENNLRQCANNNLM-------CPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFAR-LITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYI 4067
            KK +L WIP+   +  C + +    S   +C+CG    DH S+    +F               E+PT+ +G++EF G+ +   Y +R+S  T       L+ + WK+ +P+L++S+ G   EG ++     +D+L++G++K+A  + T  WIIT G+   +   +G+A++D   A      N++    I PW +    + L   + +G+ PA Y  + + +  S   D NH  ++ VD   T       + +R   E+ +S+      N  ++   +P+  +L++G+   L+ L  SL KN  P +++ GSGGLAN++ ++V  ++       S EE    IM+ +E L   + + +   ++ ++ V  +  I +N+ +I IY+ ++    + +  +L  L+   + +V    +    +L +A++ NR D+AK ++F     WK E+L+   T ++  NK  FV+L ++ G  +   +T   LE LY + IS+ T LA+ L   L  +  + +   V +Y I       L         +P        E   T   ++                  K P+  LFIW++L  R EMA   W +  ES+  AL    LL  +         K  + E A  FE  A  V   C+      +   LIR+   +G +T LEMA   ++  F +H   Q LL  +W G ++  T     ++ +I   +C        NF            KS+   P SEI  +Y++ +     NK +      +E+E KDS N ++          P+K +F         +   F+ APV  F   +  Y +F+  + ++ L  +         +  Y+L  FW  +L+ +E ++AF +G      ++  Y  D+WN  D+L+ S F+ G                         M S S N+ R    +      +FT+R++  F+I+ +LGP I+++  M+ +       +L+  L++YG+   ++ ++  P+     F  +LY      Y  +FG++ + ++  G++  R C +N  +       C D    WL  I+  ++++++N+L++NLL+A FS T+  +Q  S +YW  +RY L+ +  SRP +APP IIF  I  +  R L  +   + Q F +     P   K L++WE  +  +Y+
Sbjct:   16 KKTDLSWIPKFFKKRLCTTFVEDSFSYGGRCQCGAMRDDHRSMALGDNFSTAVVSQWLSSQHTSEQPTDAYGDLEFDGIGRRHSYFLRLSSTTDPARVFDLMKEHWKLQQPNLVVSVVGG--EGRSVVKSWVRDVLRQGLVKAA--QSTGAWIITGGLRQGISRCVGEAVKDNAAAVSSITLNKVLPIGIAPWGLVENRQQLV--NLEGSFPARY-MVRNISPDSCSLDNNHKAFLLVD-DGTSGRKGGELAFRACLEDYISRQRP--GNASID---IPVLNMLIAGDTSMLEFLEMSL-KNSTPCLVLAGSGGLANLVSDIVENVQSAAMPGASEEEDASPIMELREQLAAKVKKYFPAENDTDKLVDKVLSIYQNKDIISIYNAKQEGAEDFEIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNGNIDWKYEELVDSMTDALENNKPQFVRLLIDSGLNILSYLTYGRLEKLYNS-ISD-TCLAKTLL--LHHLDERMHESNVQIYSISLYEVSQLLTDLLGEVCHPFYWTELKLEASSTRRKSMKKACRILMGSCKYRDEMCKHPWFCLFIWAVLQNRSEMAIFCWEMCDESVLTALAGCKLLLELSKQEIETEAKLSMKELALKFERMAHDVFGTCYLSKASHSYKLLIRKSKLWGDATCLEMAIAADAQIFFSHDGVQSLLSQIWWGDIERGTPLWRILLVIICPPVC------YSNFIEYRKTDQAEKEKSVMAPPCSEIDRQYEETVFSFNDNKHQ------NEAEHKDSENIRRTAKGAPAFIKPKKSSFVVS------RWKQFWYAPVTSFIGNLLMYFLFLFLYAYVLLVDFKPPPPDGPAVSEYVLY-FWVFTLVCQEIQEAFIAGNKKFPQTLFLYAQDVWNKFDVLAISLFITGL---------------------CCRMFSWSFNMGR---GILCVDYMVFTLRLIYIFAIHKELGPKIIILGKMIKHAFFFLFFLLVW-LIAYGVANQALLYQYDPS-PARVFRRVLYR----PYLHIFGDIPVEEIDTGKHWERDCTDNLTLINEGIEPCRDTSHNWLVVILLVIFLLVTNILLINLLIATFSYTFTKVQEHSDKYWKFQRYNLIVEYHSRPTLAPPFIIFSHINILIKRYLRKVPSAKTQRFALRVKG-PEANK-LVKWENQQKENYL 1144          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Zebrafish
Match: trpm4b.2 (transient receptor potential cation channel, subfamily M, member 4b, transient receptor potential cation channel, subfamily M, member 4b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-061214-2])

HSP 1 Score: 287.345 bits (734), Expect = 1.015e-78
Identity = 304/1156 (26.30%), Postives = 537/1156 (46.45%), Query Frame = 3
Query:  828 CECGQNVADHHSVFEKYD----------FVDTENVEKPTNFFGEIEFSGLYKSKPY-VRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHA---IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGE---NQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEE----IMQ-KEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARIL---NQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPL------------------KRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNF---------KSLFYLPESEI-VEYKKKLKNKQKISTRQCSESEKKDS-----NTKKIPRKRNFTFQLKTYF--KKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRI-DVLRGENNLRQCANNNLM-------CPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYK---EKQLIQWERMRANDYI 4067
            C+CG    DHH      D          F    + E+PT+ +GE++F+   K   Y +R+S  T       L+ + WK+ +P+L++S+ G +        + DIL++G++K+A  + T  WIIT G+   +   IG+A++D   A      N++    I PW +    ++L +   +G+ PA   K++++   S   D NH  ++ VD   T       + +R   E+ +S+  +   N  ++   +P+  +L++G+   L+ L  SL KN  P +++ GSGGLAN++ ++V  ++       S +E    IM+ +E L   + + +    + ++ V  +  I +N+ +I IY+ E+    + D  +L  L+   + +V    +    +L +A++ NR D+AK ++F     WK E+L    T ++  NK  FV+L ++ G  +   +T   LE LY + IS+ T LA+ L   +   R+    K   ++SLY++  +L  L G++  P Y      E  +    L                  K P+  LFIW++L  R EMA   W +  ES+  AL    LL  +         K  + E A  FE  A  V   C++     +   LIR+   +G +T L+MA   ++  F +H   Q LL  +W G   D  +   F   L++ +  P      + F         KS+   P S     Y+K + + + I  +  +E E +DS     NTK  P    F   +K+ F   +   F+ APV  F   +  Y +F+  + ++ L  +         +  Y+L  FW  +L+ EE R+A  +G       +  Y  D+WN  D+L+ S F+ G                         M S S N+ R    +      +FT+R++  F+I+ +LGP I+++  M+  D   F+  LL  L +YG+   ++ ++  P+   + F  +LY      Y  +FG + + ++  G +  R C +N  +       C D    WL  ++  ++++++N+L++NLL+A FS T+  +Q  S  YW  +RY L+ +  SRP +APP II   I  +  R    K+ + Q  K+   +L  K   +K+L++WE ++  +Y+
Sbjct:   44 CQCGA-ARDHHPSVALGDNFSTAVVSQWFSTQHSSEQPTDAYGELDFNNSRKRDSYFLRLSSTTDPAKVFDLMKEHWKLQQPNLVVSVVGGEGRSEVKSWVLDILRQGLVKTA--QSTGAWIITGGLRQGISRCIGEAVKDNATAVSSITLNKVLPIGIAPWGLVENRQHLVNS--EGSFPA---KVTTQ--DSCNLDNNHKAFLLVD-DGTTGRKGGELAFRARLEDYISR--QRPGNASID---IPVLNMLIAGDTSMLEFLEMSL-KNSTPCLVLAGSGGLANLVSDIVENVQSAAMPGASEKEDASPIMELREQLAAKVKKYFPAEKKTDKLVDKVLSIYQNKDIISIYNAEQEGAEDFDIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNGHIDWKYEELKDSMTDALENNKPQFVRLLIDNGLNISTYLTYNRLEILYNS-ISD-TCLAKTLLLHHLNERIHQSIKQIYKISLYEVSQLLTDLFGEVCLPFYKAELKLEATTKRKALKNACDVLNGSCTYRDEKCKHPWLCLFIWAVLQNRREMAIFFWEMCGESVLTALAGCKLLLELSKQEIETEAKLSMKELALKFEQMAHDVFGTCYQTKASHSYKLLIRKSKLWGDATCLKMAIAADARIFFSHDGVQSLLSQIWWG---DIERGTAFWRLLLVMICPPLCYTNCIEFRKTDPAKEEKSMTAPPSSPTDSHYEKTVYSFKDI--KHQNEGENEDSNHIRQNTKGEP---AFIESMKSSFVVSRWKQFWYAPVTSFIGNLLMYFLFLFLYAYVLLVDFKPPPPDGPAVSEYVLY-FWVFTLVCEEIREASIAGNKKFPQMLFVYAQDMWNKFDVLAISLFITGL---------------------CCRMFSWSFNMGR---GILCVDYMVFTLRLIHIFAIHRQLGPKIIILGKMI-KDAFFFLFFLLVWLSAYGVANQALLYQYDPSPART-FRRVLYR----PYLHIFGQIPVEEIDTGRHWERDCTDNLTLINEGIEPCRDTSHNWLVVVLLVIFLLVTNILLVNLLIATFSYTFSKVQERSDTYWKFQRYNLIVEYHSRPTLAPPFIILSHINLLIKR----KIRKVQSAKVQRFALKIKGQEKKELVKWENLQKENYL 1137          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Zebrafish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 251.136 bits (640), Expect = 1.330e-66
Identity = 275/1086 (25.32%), Postives = 501/1086 (46.13%), Query Frame = 3
Query:  963 YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN----KRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR---------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPF--IVNFKSLFYLPESEIVEYKKK------------LKNKQKISTRQCSESE----------KKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  KD     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         KK N     R+SL DIG V++YL+G  Y   Y    F+  + +                 ++P++R                           P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L++ +++F   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I      N   + Y+P+ +    ++K             +   + + R   E++            +++ KK   +     +L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    +  S     WI I  IF      IE+ R+   S        +K +L + WNI D+++    L+ + G+++ L DP                     L+ + + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I   + PN   S   M+   +F   Y+ ++G +   +ID   G+N   +      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  I  V   L
Sbjct:    2 YVRVSYDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAA--MTTGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLVGKDV--VRP--YQTMSNPLSKLTVLNSLHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GIINESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQSMLDALVLDRVDFVKLLIENGVSMHRFLTLSRLEELYNTRHGPSNTLYHLVRD------VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNQNSREFGQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQDQDTYLQEKDVDEPEKQAKEKEEEDMEFTVRSYCETQYNSVAMLGNVSSEASRKKQVEEVQNRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQE--WIVIAYIFTNG---IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMA---ILIFSIGMVLRLQDP--------------------PLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAI---LNPNEDPS--WMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTEEGVVMPLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHL 1021          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 244.588 bits (623), Expect = 3.247e-65
Identity = 273/1140 (23.95%), Postives = 529/1140 (46.40%), Query Frame = 3
Query:  921 FGEIEFSGLYKSK-PYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHA---IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGEN--QMYGFAITPWS-IHNETEYLCSK-DYQGTHPAE---YNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMK--SFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLL-SQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARIL---NQ------GLRLIGFKKNNK------RVSLYDIGGVXXXXXXXXXXXXXXN-PEFQETW-SSNLP-----LKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIV-EYKKKLKNKQKISTRQC-----SESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAF--GSGISI----KEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLM---------CPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYK-EKQLIQWERMRANDYIRSFD-EQSKSKRNKTTLIVNRGPAAIGSIGGMK 4163
             G+I+F+G+ +++  +VR++ +T       +L  QW +  P L++++ G D        ++D L+KG++K+A  + T  WI+T G+   + + +G+A+RD + A      ++    I PW+ I N    L +K D+  T+P E   Y  + S        D NHSH+I VD    ED  +  +  + R+     +S        T     ++P+  +LV G    L+ ++ + ++N  P +I+ GSGG+A+I   LV  M          +E++   +   + +       +  + ++       + HL+ ++  E+++  ELD  IL +L+ +    S +  D L+  +L +A++ NR D+AK +IF+   +W  +DL  +  +++  +K  FV+LFV+ G  + + +T   L+ LY + +S    L  +L   NQ        + +    NN+      R + +++  VLK  L D     Y   P   +     NLP      + P+R+LF+W++L  R EMA   W +  E++AAAL    +++ M +L         +      +E  A  +  EC+  + +     L+R+   + ++T L +A    +  F AH   Q LL  VW G +   T         I  ++  F IP +V    + + PE ++  +  +       + T Q       +    + + +   R  + TF ++   ++   F++APV  F   +  Y  F++ F+++ L  +        +    I+L FW  +L++EE RQ+F     +SI    K Y+ D WN  D+++ S F++G       LS                   ++++     + +      +FT+R++  F+I+ +LGP I+++  M+  D+  F+  L   L++YG+   ++     P +    F   LY      Y  +FG + ++ +            ++          CP+++  WL  ++  +Y++++NVL+LNLL+A+FS T++++Q ++  +W  +RY L+ +  SRP +APP II   I  +   L++     +    +    LP   +++L+ WE ++  +Y+   + E  +S   +     ++    +  +GG K
Sbjct:   17 LGDIDFTGVSRTRGKFVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAA--QSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYS-------LDCNHSHFILVD----EDPKRPGATGEMRVKMLKHISLQRTGYGGT--GSIEIPVLCLLVHGEPRILQKMYKN-IQNSIPWLILAGSGGVADI---LVTLMDRGCWDADIVQELLINTFPDGLHSTEITSWTKLIQRILD------HGHLLTVHDPEQDS--ELDTVILKALVKACKSQSQEAQDFLD--ELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELYCS-VSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAVSKALHQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLATEAESARSMKN--AKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTS--------ISRLVLTFFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATF-IRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYGPSA-AEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVG-------LS-----------------CRMAMSTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMI-KDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWV-FRRALYR----PYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFII---ISHITQALLSFIKKTENTQDLLGKELPSGLDQKLMTWETVQKENYLAKLEHEHRESSGERLRYTSSKVQTLLRMVGGFK 1081          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 291.197 bits (744), Expect = 4.597e-79
Identity = 289/1111 (26.01%), Postives = 520/1111 (46.80%), Query Frame = 3
Query:  837 GQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVS--KLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKK--NNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKR---------------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTN---VISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSL----FYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILL--------------IFWTVSLLIEEARQAFGS-----GISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSI-NFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            G+      +V EK+       +  PT+ FG +EF G   S    Y+R+S ++K ++   L++ +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D + +    ++    I PW I    E L  KD   T P  Y  +S+  +K    + +H+H+I  D   T     + +  R   E  +S  K+N  L       + VP+  ++V G  + + ++   L +    P V+  GSG  ++I+    ++  E+        E ++ + L  I        ++  + ++++ E ++ + LI ++ +      +++  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G  W    L      ++  ++V FVKL +E G  + + +T+  LE LY   +     L  I+ + ++ +GF     +  VSL DIG VL+YL+G  Y   Y    F+  +++    KR                                 P+ EL +W++L  R +MA  LW   +E++A AL A  L +SM + ++   ++ D   DLD  +KDF   A  ++++ +K + +     L  +L  +  ST L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I F+  F+S     F+  +      +K+ +N  + +T +  + E  +   K IP              K+Y+FYNAP++KF                     Y I Y     L+ Y++L              I + V+L +E+ R+   S        +K +L + WNI D+++ S FL+G   I+   + P                      + + + +Y   I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I + + +P+  ++    I Y  +   Y ++F + +ID   GEN   +  +   + P + G WL P + A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PP+IIF  +Y +  R+
Sbjct:    7 GEECKQLEAVPEKWSISKHTQL-SPTDAFGILEFQGGGHSNKAMYIRVSYDSKPDSLLHLMVKEWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMT--TGAWIFTGGVSTGVIRHVGDALKDHS-SKSRGRICAIGIAPWGIVENKEDLIGKDV--TKP--YQTMSNPLSKLSVLNSSHTHFILAD-NGTLGKYGAEVKLRRQLEKHISLQKINTRLG------QGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMS-FAHKYSEEG---GIISESLRDQLLVTIQKTFNYSRNQAHQLLVVLMECMKKKELITVFRMGSEGQQDIEMAILTALLKGTNASA--PD-----QLSLALAWNRVDIARSQIFVFGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTRLGPPNTLHYIV-RDVKKVGFGNLPPDYHVSLIDIGLVLEYLMGGAYRCHYTRKTFRTLYNNLFGPKRDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHESSESELVDDISQDLDNNSKDFGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNPGLKVIMGILFPPTILFL-EFRSQDDLSFHTSKEYEEGKEKEDENMVRNTTSRKGDEENGNRKQKSIP-----------IGTKIYEFYNAPIVKF-------------------WFYTISYLAYLMLFNYVILVKMERWPSVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQEYWNITDLVAISVFLIG--AILRLQNQP---------------------YMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLAR--NIFYMPYWMIYGEVFAD-QIDPPCGENLYDE--DGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIIFSHLYIILKRI 1027          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 286.574 bits (732), Expect = 1.414e-78
Identity = 303/1187 (25.53%), Postives = 556/1187 (46.84%), Query Frame = 3
Query:  750 LNLWIPQNICQFECYSIIP-RKESLIQ--CECGQNVADHHSVFEKYDF----VDTEN-----VEKPTNFFGEIEFSGL-YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHA---IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQ--MYGFAITPWSI-HNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLL-SQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARIL--------------NQGLRLIGFKKNNKRVSLYDI--------GGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMI-PFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFT-FQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHI---KYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGI-----SIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGEN-NLRQCANNNLM--------CPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNR 4127
            L  WIP+   +  C + I   K+S     C+CG  + +H SV  + +F    V T N      E+PT+ +G++EF G   K   ++R+S +T   +  SL+   WKI  P+L++S+ G D +      +KDIL+KG++K+A  + T  WI+T G+   + + +G+A+RD   A   ++  +    I PW I HN    +  K   G+ PA Y  + +    +   D N+S ++  D   T   M     +R   E  +S+  +  A  K + E +P+  +L++G    L  ++ +  K+  P +++ GSGG+A+ + E++             EE +  E ++ ++ E  +     E    M++ I+ENR L+ +YS + +   + +  IL +L+ +  ++S    ++L+  +L +A++ NR D+AK ++F     WK  DL    T ++  NK  FVKLFV+ G  +   +T   LE LY++ + N T L ++L              +  L  +      +   LY++        G V       +   +  +   + + S++     P+ +LFIW++L  R EMA   W +  E++ +AL A  +L+ +  + +   +   + + A  FE  A GV  EC++ +       L+R+   +G +T L++A + ++  F A    Q +L   W G +   T     +  +++   CP +I   ++ F       E      ++K  N +++  ++ S    K S TKK P        Q   + ++   F++APV  F   +  Y  F+  F+++ L  + +       NS   +Y    FW  +++ EE RQ+F  G       +K+YL D WN +DI++   F++G               L+  +F+ +             + +  F   +FT+R++  F++N +LGP I+++R M+  D+  F+  L   L++YG+    +   + P  T    S I   +F   Y Q+FG +  +           C N+ +         C + +  WL  ++  V+++++N+L+LNLL+A+FS T+  +Q +S  YW  +RY L+ +  +RP +APP II   I     R I     QK      Y+       +++ WE ++  +Y+ S    +K KR+  T  + R
Sbjct:    9 LQSWIPKLFKKKTCTTFIEDTKDSSPTKLCQCGALMINHVSVAMEDNFGAAMVSTWNSAEHTTEEPTDAYGDVEFVGAGRKHSKFIRLSNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRKGLVKAA--QSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPK---GSFPATY-YMDNVDGPTYSLDNNYSVFLLAD-DGTHGQMGGETSFRFRLEEHISR-QKTGAGGKGSIE-IPVLCMLIAGESKMLGRVYNA-TKSPIPCLLVAGSGGVADCLAEIL-------------EESIALESIRGLIEEKLKHYFPNENLTKMVERIVENRDLVTVYS-DADGIEDFETVILKALVKACKKHSSDAVEYLD--ELKLAVAWNREDIAKTELFHGEILWKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDN-TLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVLGNMKGSVNKRNSGSTS-----PWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKELSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTP----VWAMVLTFFCPPLIYTDLITFNRTLSSEELYFSFREEKDDNAEEVPLKKMS---VKKSKTKKAPEAEIIKEKQRPRWMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILY----FWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIG---------------LICRMFNES---------FEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMM-KDVFFFLFFLGVWLIAYGVTTEGL---LHP--TDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYANWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHINTFIKRKIRKVASQKIRHFSEYN-------RMLIWEAVQKENYMVSV---AKHKRDSDTERLRR 1112          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 283.878 bits (725), Expect = 1.047e-77
Identity = 309/1190 (25.97%), Postives = 562/1190 (47.23%), Query Frame = 3
Query:  750 LNLWIPQNICQFECYSIIP-RKESLIQ--CECGQNVADHHSVFEKYDF----VDTEN-----VEKPTNFFGEIEFSGL-YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHA---IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQ--MYGFAITPWSI-HNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLL-SQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARIL--------------NQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLK--RPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMI-PFIVNFKSLFY--LPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHI---KYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGI-----SIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGEN-NLRQCANNNLM--------CPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQK-----QPFKI---SYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNR 4127
            L  WIP+   +  C + I   K+S     C+CG  + +H SV  + +F    V T N      E+PT+ +G++EF G   K   ++R+S +T   +  SL+   WKI  P+L++S+ G D +      +KDIL+KG++K+A  + T  WI+T G+   + + +G+A+RD   A   ++  +    I PW I HN    +  K   G+ PA Y  + +    +   D N+S ++  D   T   M     +R   E  +S+  +  A  K + E +P+  +L++G    L  ++ +  K+  P +++ GSGG+A+ + E++             EE +  E ++ ++ E  +     E    M++ I+ENR L+ +YS + +   + +  IL +L+ +  ++S    ++L+  +L +A++ NR D+AK ++F     WK  DL    T ++  NK  FVKLFV+ G  +   +T   LE LY++ + N T L ++L              +  L  +      +   LY++  +L+ LLGD+    Y +    E +    P K   P+ +LFIW++L  R EMA   W +  E++ +AL A  +L+ +  + +   +   + + A  FE  A GV  EC++ +       L+R+   +G +T L++A + ++  F A    Q +L   W G +   T     +  +++   CP +I   ++ F S+     PE+EI++ K++                         PR          + ++   F++APV  F   +  Y  F+  F+++ L  + +       NS   +Y    FW  +++ EE RQ+F  G       +K+YL D WN +DI++   F++G               L+  +F+ +             + +  F   +FT+R++  F++N +LGP I+++R M+  D+  F+  L   L++YG+    +   + P  T    S I   +F   Y Q+FG +  +           C N+ +         C + +  WL  ++  V+++++N+L+LNLL+A+FS T+  +Q +S  YW  +RY L+ +  +RP +APP II   I     R I     QK     + F+I   S  +L   + +++ WE ++  +Y+ S    +K KR+  T  + R
Sbjct:    9 LQSWIPKLFKKKTCTTFIEDTKDSSPTKLCQCGALMINHVSVAMEDNFGAAMVSTWNSAEHTTEEPTDAYGDVEFVGAGRKHSKFIRLSNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRKGLVKAA--QSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPK---GSFPATY-YMDNVDGPTYSLDNNYSVFLLAD-DGTHGQMGGETSFRFRLEEHISR-QKTGAGGKGSIE-IPVLCMLIAGESKMLGRVYNA-TKSPIPCLLVAGSGGVADCLAEIL-------------EESIALESIRGLIEEKLKHYFPNENLTKMVERIVENRDLVTVYS-DADGIEDFETVILKALVKACKKHSSDAVEYLD--ELKLAVAWNREDIAKTELFHGEILWKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDN-TLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHQIAVEKYQ---PRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKELSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTP----VWAMVLTFFCPPLIYTDLITFNSVEQNGAPEAEIIKEKQR-------------------------PR----------WMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILY----FWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIG---------------LICRMFNES---------FEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMM-KDVFFFLFFLGVWLIAYGVTTEGL---LHP--TDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYANWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHINTFIKRKIRKVASQKIRHFSECFRIHRPSTLALFTLDNRMLIWEAVQKENYMVSV---AKHKRDSDTERLRR 1092          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 285.034 bits (728), Expect = 1.696e-77
Identity = 298/1163 (25.62%), Postives = 533/1163 (45.83%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVE--------------------KPTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ----GLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLP-----------ESEIVEYKKKLKNKQK--------ISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNL--WIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEV-KPNLTMSEFSMILYEMFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIF 3926
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                     PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G +++D   +    ++    I PW I    E L  KD     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L  N   P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++       +R  G    + R+SL DIG V++YL+G  Y   Y    F+  + +                 ++P++                           P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  +++F   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   +P           E E+ E  K +K K++        ++      S KKD +    PR R     L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    +K  +  ++  WI I  IF   +L IE+ R+   S         K +L + WN+ D++S    LL + G+++ L +    S                    + + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   +P+  +++       +F   Y+ ++G +   +ID   G N   +      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF
Sbjct:   35 WIERAFHKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISIIQNEKNEGRHRNDIQSEKWSIGKHTQLSPTDAFGTIEFQGGGHSNKAMYVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDSLKDHA-SKSRGKICTIGIAPWGIVENQEDLVGKDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKVRVRHQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPIRSGRKTTKKREEEIDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSSLKVILGILLPPSI-LSLEFKNKDEMPYMSQANEMDLQEKEVEEPDKTVKEKEEDDMELTAMLARGNGDSSRKKDEDEH--PRHR-----LIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVL----VKMDRWPSMQEWIVISYIF---TLGIEKMREILMSEPGKLLQKFKVWLQEYWNLADLVS---ILLFSIGMVLRLQEQPFSS--------------------YGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAK------NIFYMPYWMIYGEVFADQIDPPCGYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIF 1126          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 285.034 bits (728), Expect = 7.458e-77
Identity = 300/1160 (25.86%), Postives = 535/1160 (46.12%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVE--------------------KPTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ----GLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLP-----------ESEIVEYKKKLKNKQK--------ISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNL--WIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEV-KPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                     PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G +++D   +    ++    I PW I    E L  KD     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L  N   P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++       +R  G    + R+SL DIG V++YL+G  Y   Y    F+  + +       ++P++                           P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  +++F   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   +P           E E+ E  K +K K++        ++      S KKD +    PR R     L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    +K  +  ++  WI I  IF   +L IE+ R+   S         K +L + WN+ D++S    LL + G+++ L +    S                    + + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   +P+  +++   I Y  +   Y ++F + +ID   G N   +      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF     +   L
Sbjct:   64 WIERAFHKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISIIQNEKNEGRHRNDIQSEKWSIGKHTQLSPTDAFGTIEFQGGGHSNKAMYVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDSLKDHA-SKSRGKICTIGIAPWGIVENQEDLVGKDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKVRVRHQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPIRSGRKTTKKREEEIDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSSLKVILGILLPPSI-LSLEFKNKDEMPYMSQANEMDLQEKEVEEPDKTVKEKEEDDMELTAMLARGNGDSSRKKDEDEH--PRHR-----LIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVL----VKMDRWPSMQEWIVISYIF---TLGIEKMREILMSEPGKLLQKFKVWLQEYWNLADLVS---ILLFSIGMVLRLQEQPFSS--------------------YGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAK--NIFYMPYWMIYGEVFAD-QIDPPCGYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHFTMICKHL 1155          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 291.582 bits (745), Expect = 1.167e-79
Identity = 312/1227 (25.43%), Postives = 564/1227 (45.97%), Query Frame = 3
Query:  600 SNVETCIILTSDGNYDLQLQDENEKSPLQYG--KMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ-------GLRLIGFKKN---NKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
               + C  L+S  N +  +   +   PL +   K+    F+   +  L  +K   WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         G   I FK N   + R+SL DIG V++YL+G  Y   Y    F+  + +                 ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  +
Sbjct:   12 GTAQICSFLSSRWNLEGVMNQTDASRPLNWTIRKLCHAAFLPS-VRLLKAQKS--WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVK--MERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHV 1173          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 291.967 bits (746), Expect = 3.354e-79
Identity = 300/1162 (25.82%), Postives = 537/1162 (46.21%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ-------GLRLIGFKKN---NKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         G   I FK N   + R+SL DIG V++YL+G  Y   Y    F+  + +       ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  +
Sbjct:   66 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHV 1165          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 291.197 bits (744), Expect = 5.815e-79
Identity = 306/1207 (25.35%), Postives = 554/1207 (45.90%), Query Frame = 3
Query:  600 SNVETCIILTSDGNYDLQLQDENEKSPLQYG--KMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
               + C  L+S  N +  +   +   PL +   K+    F+   +  L  +K   WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++    +  G    + R+SL DIG V++YL+G  Y   Y    F+  + +       ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  +
Sbjct:   12 GTAQICSFLSSRWNLEGVMNQTDASRPLNWTIRKLCHAAFLPS-VRLLKAQKS--WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKK--GNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHV 1151          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 290.041 bits (741), Expect = 1.405e-78
Identity = 298/1153 (25.85%), Postives = 533/1153 (46.23%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN----KRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVF 3947
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         KK N     R+SL DIG V++YL+G  Y   Y    F+  + +       ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F
Sbjct:   66 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRD------VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIF 1150          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 288.5 bits (737), Expect = 4.146e-78
Identity = 300/1169 (25.66%), Postives = 536/1169 (45.85%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQ-------GLRLIGFKKN---NKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVF 3947
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         G   I FK N   + R+SL DIG V++YL+G  Y   Y    F+  + +                 ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F
Sbjct:   66 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIF 1172          
BLAST of Transient receptor potential cation channel,putative vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 1.603e-114
Identity = 405/1574 (25.73%), Postives = 725/1574 (46.06%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADH-HSVFEKYDFVDTENV-----EKPTNFFGEIEFSGL--YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYG---SDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYG-ENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXX--XXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXX-------------------XXXXXXXXXXNPEFQETWSSNL----PLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFT------------------FQLKTYFKKMYD---------------------FYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLW----IYILLIFWTVSLLIEEARQ-AFGSGISIKE----YLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSL---PYKEKQLIQWERMRANDYIR--------SFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDI-IEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKL------WKSKFVDHLICRFVPIFTAEQPVEFIED---------------DSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGT--TNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDV 5108
            WI +N  + EC   +P+   + +C+CG+    H     E     +  NV     + PTN +GEI+F G    K  PY+RMS +T      +L++ +W +  P+L+IS+ G   S      ++++ ++G++K+A  + T  WIIT G  T +++ +G+A+++    +G + Q+    I  W I ++   L S+   G +PA Y+   +   +    D NHSH+  VD   TE      I  R   E  + K+    + ++     VP+  +++ G  + +  ++  L+K   P V+I GSG  A+++G       ++N   ++   ++  +Y   +  ++ E+  +   ++   MI++++E+  +I +YS++     ++D  IL +LL  + +S        + QL +A++ NR D+AK  IFTE ++W TE L      ++ ++K  F +LF++ G  + + +++++L  LY A++   T +  +L + +     K+  K + +  +G V++ L                          +  N +  +   +N+    PL  PY ++F+W++L  R E+A++LW   +E +AAAL A+ LL+ M +     N I+D   DL + A+ FE +A GV++ECF EN   ++  L+R+LD+Y R T LE+A    S  FIAH SCQ LL  +W GT+   T+    ++ L + V+   +I F+ + +      E E   ++K L  K   S++  S  EK D+    + R +                     FQL+ Y  ++ +                     FY+AP  KF   +  YL FI  + ++ L  +  ++     L       I+L FW  ++LIEE RQ A      IK+    Y +D WN +DI S + F++    II+        S +F+                 S+ +    I  F VR LQ FS+N  LGP +VMI+ M+  DL  FI+IL    ++YGI L ++ F        +   + +  +    Y+Q++G L +D ++GE    +      + PD  G WL P++ A+YMV +N+L+LNLL+AIF+ T+E +Q  S + W  +RY L+++  SRP  APPL++   I  +F R +        P + S   +   P + +Q+  WE   A  YI         + +E+ ++  ++   I ++    + S+ G +    +  N +     E     E RL +M++ +  N  ++  IL  L    P+  +  +  +  L+   A+         ++ Y  PG   K   +      W+  F D+    +        PV   +D               D   + N V         +G+P+NP       G+ LL  +G N     +++RWK           K +L+ + I     N   +P  +V+      Q L +    E + +   + +++++ +      E+ F+     +  ++Y+GY+ D RN+DN+W+ET A N H +    F    L     DD+  + W  V
Sbjct:   35 WIARNFSRRECIRFVPKSHDVSRCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDFEGYGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAA--KTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDLISEK-NGKYPALYSMEPTPGHQGAMLDPNHSHFFLVD-DGTEGKYGVEIGMRSRIEEAIMKVKTD-SRSEAGSIGVPVVLLVLEGGPNTVATMY-ELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTIN-VIDPQYEDEVRAKVVEVFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKANRSS-------PVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLY-AEVPGNTTIKPLLQKEMG----KRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIFPIIYFVPDEQHERQAAERE---HQKSLNQK---SSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFP-RFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIA---IILRF---FTNSRIFTA----------------SRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMM-QDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGE----KPKEFGEVDPD--GRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHI-LIFIRWVWRMCRCGHPPRGSTMKIGLSPAEMEQMDNWEFQAAEMYIHQQQQKNSGTLEERVRALGDRVDCINSQLNRVLDSMSGTRAHALTDGNGL-----EGGHDSEGRLARMEVELSSNSESLQKILALLQQQPPVKGQAAVPIQLTLLHYKAR---------SSPY--PGSTAKRFAVQDNMVDWQVPFPDYKPVNYTAPVVLANPVWADKDLMAMSPRPELPYNQMDHTCNVNRVSYNGTYVVKDGLPLNPMGRTGMQGRGLLGRFGPNHAADPVVTRWKRTSAGVMLQGGKKVLEFVAIQRKDNNQWAIPGGMVEPGQLVTQALKAEFGEEAMAK---LNVSQEEKERIAKQIERLFQ-----QGQEIYKGYVDDPRNTDNAWMETVAVNFHDDKGDLFGDITLQA--GDDAAAVRWQRV 1526          
BLAST of Transient receptor potential cation channel,putative vs. UniProt/SwissProt
Match: sp|A0A0R4IMY7|TRPM2_DANRE (Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 2.770e-87
Identity = 373/1549 (24.08%), Postives = 680/1549 (43.90%), Query Frame = 3
Query:  732 TLDKKKLNLWIPQNICQFEC-YSIIPRKESLIQC------ECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGL-YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSD---FEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYG--ENQMYGFAITPWS-IHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELV------YEMKEKNR--------KKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVE-LLENLYT-----------ADISNGTKLARILNQ--GLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXN--------------PEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKD--DLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLK--TYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAF----GSGI--SIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANN-----NLMCP-------DVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKLWKSKFVDHLICRFVPI----------FTAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDS--ETLCWVDV 5108
            +  +  L  WI +NI + EC + +   +E + +C       C + +     + E++D       E PT+ FG+I F GL  K+  YVR+S +T  E    L+ +QWK+  P+L+IS+ G     +    +KD  ++G++K A  + T  WI+T G    +++ +G A+RD+T + G  E Q+    + PW  IHN +  +     +G  PA Y+       +    D NH+H++ VD   T+      I+ R   E  +SKL+  L N +     +P+  +++ G    L  ++ S++ N  P V+++GSG LA++I  +         M   NR        + K+F E+   E+ K I   +                     HL+ ++ ++E+   ++D  IL +LL    +      H    QL +A++ NR D+A+ +IFTE  +W + DL P    ++  +K  FV+L +E G  + + +  E  L  LY+           A    G K+ R      G R +     ++ V  + +G   + L     Y    +              P   E WS++  +  P R+LF+W+++    E+A++ W   ++ IAAAL A+ +LR +   +     ++  ++ E A  +E +A GV  EC   + +  +  LIR    +GRST L +A + +   FIAH   Q LL  +W G L         ++       C    P I  +         E ++ + +   +QK++       +  D   K+  R  +   +LK      ++  F  +P +KF + I  Y  F+  F  + +  +     + S  W  +LL  W  SL+ EE RQ +    GSG     K Y+ D+WNI+D+LS   F+ G                      +   +  S  +    K +      +F +R++  FSI+  LGP I+++R M+ +      ++ + V V+YG+    I  E +  L     + I+       Y  +FGN   ++     ++  C+ N        CP        V+  WL  ++  VY++ +N+L+LNLL+AIF+ T++ +Q ++   W  +RY+L+++  SRP + PP I+   +  +F R + ++   ++           +E++L+ WE    ++Y+ S      ++++++  + +R       +G M +  E  +  +  +  +R++ +E   +++    + +  I D L+  G    +   +  SK +       +    +S  E  D   P +  + L+     + D  + RF P+          F+  QP  + + DS ES    L +           NP       GK  L   G N  +H + +RW+        D    +L+ L +      E  + ++    + ++ L  +  LE+I+     ++N+K    KT L   E          +VY+GY+ D RN+DN+W+ETS   +H + N      + HM++   S  + L W +V
Sbjct:   30 SFQRCSLASWIKENIKKKECCFYVEDGREGICKCGYPKVQHCDEAIKPEDYMGEQWD-KHRHVRETPTDAFGDISFGGLGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVA--QTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLI---HPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVD-DGTQGHYGVEIELRARLEKLISKLS--LGNRESGV-TIPVVCVVLDGGPGTLNTIYNSML-NHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMP------------------HLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVR-HLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADT-VWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLL-------CMIFFPLI--YTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQS-DGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDF-----QTSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAG----------------------LICRLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWV-VAYGVAKQGILIENEERL-----NWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPFILLSHL-ILFIRGVFLRDLPQRHKNFRQELEQTEEEELLSWEAYMKDNYLAS------TRQDESQSVEHRIHDTAEKVGAMSELLEREQEMVSATMAKRLARLE---EQVSESAKALRWIIDALKSQGCKSKVQPPLMRSKSS------DRDDGDSSGQETDDEEAPHMFARQLQ-----YPDSTVRRF-PVPEEKVSWEVNFSPYQPPVYNQQDSSESDTSALDKHR---------NPGGRTGIRGKGALNTLGPNHILHPIFTRWR--------DAEHKVLEFLAV--WEDAEKRWALLGGPAQPDEPL--AQVLERILGK---KLNEK---TKTLLKAGE----------EVYKGYVDDSRNTDNAWVETSIITLHCDKNTPLMADLNHMVESSLSSHQPLQWREV 1445          
BLAST of Transient receptor potential cation channel,putative vs. UniProt/SwissProt
Match: sp|Q9HCF6|TRPM3_HUMAN (Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=2 SV=4)

HSP 1 Score: 277.33 bits (708), Expect = 8.055e-74
Identity = 297/1183 (25.11%), Postives = 536/1183 (45.31%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK---------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVS--KLN---------------EFLANTKMNF----EKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR--------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYE-MFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  IIP  +   +C CG+ +  H  +      +  E  E                      PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  +D     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S  K+N                F  + +++     + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++    +  G    + R+SL DIG V++YL+G  Y   Y    F+  + +                 ++PL+R                          P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  ++DF   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I   + FK+   + Y+ +++ +  ++K   + +  T++  E + +          +S+ KK   +     +L    +K+Y+FYNAP++KF    +          F  +    ++   ++  WI I  IF   +L IE+ R+   S        +K +L + WN+ D+++    LL + G+I+ L D   +S                      + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I F   PN    E S  L + +F   Y+ ++G +   +ID   G+N  R+      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  +F  L
Sbjct:   64 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLIGRDV--VRP--YQTMSNPMSKLTVLNSMHSHFILAD-NGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKK--GNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGILLPPSI-LSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKF--WFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIF---TLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIA---ILLFSVGMILRLQDQPFRS--------------------DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILF---PN---EEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL 1186          
BLAST of Transient receptor potential cation channel,putative vs. UniProt/SwissProt
Match: sp|E9PTA2|TRPM2_RAT (Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3)

HSP 1 Score: 275.404 bits (703), Expect = 2.040e-73
Identity = 345/1414 (24.40%), Postives = 636/1414 (44.98%), Query Frame = 3
Query:  741 KKKLNLWIPQNICQFECYSIIPRKE----SLIQCECGQNVADHHSV------FEKYDFVDTENV-EKPTNFFGEIEFSGL-YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGH-AIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFT--DAYGENQMYGFAITPW-SIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLL----SQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELL----ENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPL----------------KR----------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAF----GSGI--SIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNL-----MCPD--------VWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMD-IIEENVNTIYD----------ILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKLWKSKFVDHLICRFVPIFTAEQPVEFIED---DSKESQNEV---LTEDLIEFPN---------GIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWK 4691
            ++ L+ WIP+NI + EC   +   +      + CECG     H  V      F+  ++   ++V E PT+ FG+I F+GL  K   YVR+S +T       L+   W +  PSL+IS+ G   +F     +K I ++G++K A  + T  WIIT G  T +++ +G+A+RDF+   +  E  +    I  W +IHN    +      G  PAEY             D NHSH+I VD   T       I  R   E  +S+  +      +   K+P+  +++ G    L  ++ + + NG P VI++GSG +A++I ++          + +   I QK  +           ++  E    IQ+I+  R L+ ++   ++   ++D  IL +LL    SQD    ++ DH    QL +A++ NR D+A+ +IFT+  +WK  DL P+ T ++  NK  FV+LF+E G  L + +T + L    ENL  + + + +KL ++L +    + +     R+ ++ +  VL+ LLGD    LY  P + +    +LP+                KR          P R+L IW+++    E+A ++W   ++  AAAL  + +L+ +          +++   A +FE +A GV  EC++++ E  +  L+R  + +G++T L++A +   +KF++H   Q  L  VW G L      ++  ++ II  +C  M+ F + F                       IS R     EK+     ++ R R               F+NAPV+ F   I  Y  F+  F ++ +  +     + S  W   L+  W  SL+ EE RQ F    G G+      Y +D WN +D+ +   F+ G       L+  L+ + L+                   + +      +F +R++  F+I+  LGP I++++ M+  D+  F+ +L   +VS+G+   +I    +  +    F  ++Y  +LT    +FG +   +     ++ QC+ N        CP+         +  WL   +  +Y++ +N+L+LNLL+A+F+ T++ +Q  + Q W  +R+ L+ +   RPP  PPLI+   +  +  R++ +K+  K+  ++       +E  L+ WE     +Y+++   Q K +  +    ++     +  +  M +   S   E      +R++ +E ++ +M   +   V T+ D           L +   + P + E+ I KK E   E      V++   +  Y    I++  +   K  +    +    P +TAE+    + D   D+ E  +++   + + L++  +         G P+NP       G+  L ++G N  +  +++RWK
Sbjct:   55 QENLSSWIPENIKKKECVYFVESSKLSDAGKVVCECGYTHEQHIEVAIKPHTFQGKEWDPKKHVHEMPTDAFGDIVFTGLSQKVGKYVRLSQDTSSIVIYQLMTQHWGLDVPSLLISVTGGAKNFNMKLRLKSIFRRGLVKVA--QTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGDVITIGIATWGTIHNREALIHP---MGGFPAEYMLDEEGQGNLTCLDSNHSHFILVD-DGTHGQYGVEIPLRTKLEKFISEQTKERGGVAI---KIPIVCVVLEGGPGTLHTIYNA-ITNGTPCVIVEGSGRVADVIAQVA----ALPVSEITISLIQQKLSVFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDH----QLKLAVAWNRVDIARSEIFTDEWQWKPSDLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFH-SKLQKVLAEEHERLAYASETPRLQMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSLPMPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAIIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEEDTDSSEEMLALADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQL-----CVDNGLWRII--LC--MLAFPLLFTGF--------------------ISFR-----EKRLQALCRLARVRA--------------FFNAPVVIFYLNILSYFAFLCLFAYVLMVDF-----QPSPSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIAG-------LTCRLIPATLYP-----------------GRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKRMM-KDVFFFLFLLAVWVVSFGVAKQAILIHNESRVDWI-FRGVIYHSYLT----IFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPEWLTVTLLCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGRPPAPPPLILLSHLQLLIKRIV-LKIPAKRHKQLKNKLEKNEEAALLSWELYLKENYLQNQQYQHKQRPEQKIQDISEKVDTMVDLLDMDRVKRSGSTE------QRLASLEEQVTQMGRSLHWIVTTLKDSGFGSGAGALTLAQRAFDEP-DAELSIRKKGE---EGGDGYHVSA--RHLLYPDARIMRFPVPNEKVPWEAEFLIYDPPFYTAEKKDATLTDPVGDTAEPLSKINYNVVDGLMDRCSFHGTYVVQYGFPLNPMGRTGLRGRGSLSWFGPNHTLQPVVTRWK 1353          
BLAST of Transient receptor potential cation channel,putative vs. UniProt/SwissProt
Match: sp|Q7TN37|TRPM4_MOUSE (Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 6.385e-70
Identity = 303/1226 (24.71%), Postives = 544/1226 (44.37%), Query Frame = 3
Query:  759 WIPQNICQFECYSII---PRKESLIQCECGQNVADHHSVFEKYDF---------VDTENVEKPTNFFGEIEFS-GLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAI-----KDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDF-TDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQ-KFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEM-----------KEKNRKKKSFE----EIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKN--NKRVSLY--DIGGVXXXXXXXXXX---------------XXXXNPEFQETWSSNLPL------KRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCS-----ESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----------------IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNL---RIDV---LRGENNLRQCANNNL------MCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQK---------QPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNR 4127
            WIP+   +  C + I           C+CGQ    H SV  +  F          D    EKPT+ +G+++F+    K   ++R+S  T   T  SL+   W    P+L++S+ G    G  +     +D+L++G++++A  + T  WI+T G+ T +   +G A+RD  T + G +++    + PW +    + L +   +G+ PA Y          +   D N+S +  VD   T   +     +RL FE+ V++    +  T ++   +P+  +L+ G+   LK +  +  +   P +++ GSGG A+ + E + +            + ++R ++ F     E++Q + ++ IMT                      + L+ +YS E+ +  E +  +L +L+ +   S +   +L+  +L +A++ NR D+A+ ++F    +W++  L      ++  ++  FV+L +  G  LG  +T   L  LY+A +S  + +  +L+Q       K    N  V L   ++G VL+ LLG+                      N      W++  P       + P+ +L IW+LL  R +MA   W     S+A+AL A  LLR M  L +   +     + A  FE+ +  +  EC+  + E     L+R+   +G +T L++A   ++  F A    Q LL   W G +D TT     I  L++   CP +I     + +L    +SE    +K L      S          E   K +  ++  R+         + K+  DF+ APV  F   +  YL+F+L F  + L  +       S L    LL FW  +LL EE RQ  G G                   +  YL+D WN  D+L+ + FLLG  G  +T            LFD+              + +      +FT+R+L  F++N +LGP IV++  M+  D+  F+  L   LV+YG+    I   ++P         IL  +F   Y Q+FG +    +DV   + G  ++ + +  +        C   +  WL  ++  V+++++N+L+LNLL+A+FS T+  +  +S  YW  +RY L+R+  SRP +APPLII   +  +   L   +  ++         + F++  S     E++L+ WE +   +++ +   Q++ KR+  +  + R
Sbjct:   10 WIPKIFRKKVCTTFIVDLSDDAGGTLCQCGQPRDAHPSVAVEDAFGAAVVTEWNSDEHTTEKPTDAYGDLDFTYSGRKHSNFLRLSDRTDPATVYSLVTRSWGFRAPNLVVSVLGG--SGGPVLQTWLQDLLRRGLVRAA--QSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGVVRNRDMLINP--KGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVD-DGTYGRLGGENRFRLRFESYVAQQKTGVGGTGID---IPVLLLLIDGDEKMLKRIEDA-TQAQLPCLLVAGSGGAADCLVETLEDTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQ-VERIMT---------------------RKELLTVYSSEDGS-EEFETIVLRALV-KACGSSEASAYLD--ELRLAVAWNRVDIAQSELFRGDIQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSA-VSPNSLIRNLLDQASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAARRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTP----IWALLLAFFCPPLI-----YTNLIVFRKSEEEPTQKDLDFDMDSSINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPTKPSVSEL----LLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGV-GCRLTP----------GLFDL-------------GRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMM-KDVFFFLFFLCVWLVAYGVATEGI---LRPQ--DRSLPSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRCRRCRRANLPASPVFEHFRVCLSK--EAERKLLTWESVHKENFLLA---QARDKRDSDSERLKR 1149          
BLAST of Transient receptor potential cation channel,putative vs. TrEMBL
Match: A0A0A8IBU0 (Transient receptor potential ion channel Ma DjTRPMa (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 1050.81 bits (2716), Expect = 0.000e+0
Identity = 575/973 (59.10%), Postives = 728/973 (74.82%), Query Frame = 3
Query: 2298 FQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIE-----------PAKKIEVTSMLENTDYLPPGIVKKTLKLWKSKFVDHLICRFVPIFTAEQ--PVEFIEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDVDKSHWTNPSNIILLSFLSNFHGF 5177
            FQ   + N+PLKRP RELFIW LLT RM MAQ++W LE+ESIAAALFAANLLR MK LT+VI+DKDDLDEW+  FET AEGVVEECF ENPEFTR+NL+R+L+YYG+STYLE+A+DG+SIKFIAHRSCQELLD VWR TLD++TK   F+ YL IG++CP ++PFIV FK+L+YLPE+EI EYK+K+K  +K +      +E      +K+ ++R   FQLK YFKK+YDFY+ PVIKFSYTIFFYLIFILYFTFLNLT YH+KY  +SN+ IYI LI WT+SLLIEE RQAF SGIS+KEYL+D+WNIIDILSH FF++GTF I++TL D   K L FSL DITP+ SI + L+R SKF YGFSIFLFT+RILQYFSINV +GPIIVMIRNM++NDLGPF+ IL+TVLVSY ILL S+NFEVKPNLT  EFS+I YEM    YFQLFG+LR+D+LRGEN L QC  NNL+CPD+WGVWLGPII+A+YMV+SNVLMLNLLVAIFSNTYEIIQSS+TQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYF+F +L +IK+    PF++ Y + P KEKQL+QWERMRAN++IRS DE+ K  R KTTL+VNRG  ++ SI G+KKDF+  KNEI+Q+F E+++IVE RL+K++II ENVN IY+IL+KLG N     + +I K+++   E              K+  TSM  + D +       + KLW  +  +H+I R VP+    Q   ++FI ++  ES      +D I+  +  P+NP E LN+ GKPLLPFWG+N CIH++ISR+   EK+  N   K  LQV+ I   ++IELPF    HN+ C  N CSS+ ++ I + Y   I+ +K +N + LN  +F+  N    +++Y GY+ DFRN++NSW+ET+A NIH  +  + +   L + + D+ E  CW +V+   WTNPSN  LLS LS +H +
Sbjct:    2 FQVNLNKNVPLKRPCRELFIWCLLTQRMRMAQIIWALERESIAAALFAANLLRQMKYLTDVIADKDDLDEWSSKFETNAEGVVEECFIENPEFTRENLVRELEYYGKSTYLELASDGDSIKFIAHRSCQELLDVVWRNTLDESTKPGTFVAYLFIGILCPLLLPFIVKFKTLYYLPENEIEEYKRKMKAHKKNAIMDDKNNEIMIDLKQKL-KERFSRFQLKIYFKKIYDFYSTPVIKFSYTIFFYLIFILYFTFLNLTGYHVKYLNSSNVLIYIFLIVWTISLLIEEFRQAFDSGISLKEYLHDMWNIIDILSHFFFIIGTFAILITLGDSYAKFLFFSLMDITPLQSIYIYLIRLSKFFYGFSIFLFTLRILQYFSINVNMGPIIVMIRNMISNDLGPFLAILMTVLVSYSILLASVNFEVKPNLTAKEFSIITYEMLRIAYFQLFGDLRMDILRGENKLAQCTMNNLLCPDIWGVWLGPIISAIYMVMSNVLMLNLLVAIFSNTYEIIQSSATQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFLFTKLFSIKIKTNNPFRVCYENSPNKEKQLVQWERMRANEFIRSTDEECKKNRTKTTLVVNRGAGSLSSIEGIKKDFDLIKNEIMQNFQEKVTIVEMRLEKLEIISENVNIIYEILQKLGINKSNKQKFQIIKESDNHGEMFSQIIDDKNTREDKMRKTSMRLSDDMIDDN----STKLWCCQIENHIILRLVPLVNLNQILKMKFINENEMESMTIQNLKDEIKIFDVAPVNPFENLNQFGKPLLPFWGINHCIHIIISRFIG-EKESGNISNKPELQVVAIRRHDNIELPF----HNSFCLNNSCSSNNMKSIPKQYLNLISNQKQENSSKLN--DFDLFNTVDMNEIYRGYICDFRNTNNSWMETTACNIHQTEIHKLSDDFLMLFEQDEFEEGCWFNVNNELWTNPSNKDLLSKLSIYHDY 962          
BLAST of Transient receptor potential cation channel,putative vs. TrEMBL
Match: A0A267F4T8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025325g2 PE=3 SV=1)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 576/1877 (30.69%), Postives = 927/1877 (49.39%), Query Frame = 3
Query:  228 LKSVEKWDLKEFLSIYEFENLSPDSLFDYKLEE--------------TLKVSSNFLSYLDNCNLLHYAALYRATRIVRVLL--SSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELL--THGANKNLLDQK-GRIALHYAVCSNVETCI---ILT--------SDGNYD------LQLQDENEKSPLQY---------GKMEDKPFIAKYLETLDKKKLNLWIPQNI--CQFECYSIIPRKESLIQ----------CECGQNVADHH----SVFEKYDFV-DTENVEKPTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDT-MKSFIDYRLTFENQVSKLNEFLANTKMNFE-----KVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKE---KNRKKKSFE---EIMQKEYLKMIMTX--XXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLL-SQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETW----------------------------------SSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLD-DTTKSMNFIMYLIIGVICPFMIPFIVNFK-----SLFYLPE--SEIVEYKKKLKNKQK-----------ISTRQCSESEKKDSNTK-KIP--RKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIF-------WTV----------SLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENN--LRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQK----QPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNN-------EIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTL----------------KLWKSKFVDHLICRFVP-------IFTAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIPINPH----------ETLNKIGKP------LLPFWGVNSCIHLLISRWKPWEKDDENDIYKS----ILQVLGI-GTTNHIELPFIIVQHN-TEC-----------EQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEF----ESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILH--MLQHDDSETLCWVDVDKSHWTNPSNIILLSFLSNFHGFEF 5183
            + SV + D   F  +   + LSP + F  +L E              T    S   + LD+C L+H A + R   ++R L+  + QF+  VD   + G  PLH++   GD  ++R L   T  A + L D+  GR  LH+A+ +   +C+   IL         +DG  D      L L D   K+ L Y         G++     +   L + +   L   +P  +   +  C   +P +  L            C CGQ    H      +  ++ +  + + VE   N FGE+EFSGL  +  Y R+S +T  E   S+L   W + KPSL+IS+YG++ +  A K + +KG+ K+AG   +  W++TDG +  L E+ G+A+RD+ DAYGE+ +    I+PW        L S  Y G +PA+Y  + S    S   D NHSH++  D  R  D  +     +R  FE  V       ++ ++         VP+CG+L  G+R  L+ +H SL +N  P V+IKG+GGLA+++  L+ ++ E      KKK+ E   +I++   L+ +M +     +  + + EV  + +I+  +  IEI+S++E+ P++LD  IL+SLL S   +  +  +  N  QL +A++++R DVAK+K+F E KKW+  DL      ++ +NKV FVKLFV++GF L + +T++LLE+LYT D++ G++   IL  GL++   K     V++ DIG VL +++G  Y P YL+ EFQ  +                                   S++ ++RP  +LF WSLLT R  +A+  W+LEKE IA ALFAA LLR  +  ++ +++K+ L+  A  FE +AEGV+EEC+++N   T++NL+R+L +YG+ST   +AA+G SIKFI+HR CQE+LD +W+G L      S+ F   L  G+ CP ++  ++ F       +   PE  SE          +QK              +   +  K D  T  ++P   +R      + +  ++ DFY APV++F                 +  AY I       ++ Y++L         W+           SL +EE RQA  SG S + Y++D+WNI+DI++   FL+G+   IM   D +V+ L  +  D+  + S    L+R S+     ++F+F +RILQ FSI+V LGP +VMI+NM+  DL PF+VI L  +++Y I+  SI F  K +L+++E    L  +  T YFQ+FG L++D++ G+      QC  +++ CPD+WG WL PI+  V++VL+NVL+LNLL+A FS+TYE IQSSSTQ+WTL+RY +MR+ + R P+APPLII W + FV   L+    G +     PFK SYS    +E+QL+QWE +RA +++R  D+  + +++ T  IV  G    G+   MKK+ +S +  +   F + I  VE  ++++D +E  +  + +++  L  ++   +       + +  +  E     A  +   S  +      P  V   L                ++W+ K   H + R VP          AE P  +   D  +        +  +  +G     H            +N  GKP       LP WG N C+HL ++RW+   +DD  +I K     +LQV  +      ++LP+  V+H    C             +      L+ ++R +  E  + +A +   L  K      E++  +    VY G L D  N DN+W+ET   N+H   N  F   ++   + +    E + W+DV        S+  LL  ++  HG  F
Sbjct:   46 IGSVLRGDNDAFQELERQQLLSPGASFRLELTEDERARLACRGAPALTEGSQSPPPAVLDDCPLMHAAVVTRNYHVIRRLIERNEQFSNQVD---QAGQLPLHVACRTGDPVSLRLLAPATRPAGRALADRSHGRTPLHWALAAESASCVAELILACCRSCSTGTDGLADEARLLPLDLPDSEGKTILNYLEDERSDDGGEINPAVQLLGQLVSPETGALLTQMPAQLRLTRLVCTYRMPPQPLLEAGLDNGSTSPVCPCGQPADTHELPASQLPSRHAWSREGDTVELVNNCFGEMEFSGLGNTAQYFRVSQSTADEALMSVLTGHWGLVKPSLVISVYGTEIDKTAFKSVWQKGLWKAAGG--SGAWVVTDG-YGGLSELSGQAVRDYCDAYGEDSILAIGISPWGRVANRPSLASDTYMGCYPAKY-LMESDDQSSISLDHNHSHFLLPDSGRYGDAAIDDARSFRSRFELLVKDWPSVTSSDRIGSSVNLDGTVPICGLLSGGSRHALRGVHASLCRNQVPLVLIKGTGGLADLLAVLIDDLAEVEHAKHKKKNIEREQDILEFNRLRNLMLDIWTLPLGTDLDREVATLVDILRRKQSIEIFSLDEDAPSDLDAKILASLLNSAGTDGHEESERFNKAQLKIALALDRSDVAKQKVFGENKKWRKGDLDNFMRDALRDNKVAFVKLFVQQGFSLEQFVTIQLLEDLYTEDVTTGSQTIGILRNGLQVAVGKTGVVNVTMEDIGRVLLHMMGSFYKPFYLSKEFQRDFRIGDSAKGKRGLGFSNAAYVKFSSNEIDRKTSDAGSHISMERPALDLFTWSLLTQRTALAEFFWSLEKECIAGALFAAMLLRESRAFSDDLTEKEQLEALANAFEARAEGVLEECYRDNQSNTQENLVRELPFYGQSTCFVLAAEGGSIKFISHRCCQEMLDIIWKGNLSTKKNSSLRFFCGLGCGLACPPLLALVIKFSCDELDGVGGSPERPSETSGGGSAGAARQKSIAAAAAAATATGRKSGLKKNKVDPETGDRLPDRSRRCRCLSPREFATRILDFYFAPVVRF---------------IYSTLAYLIFL----GIYSYVMLFLFDNGMDNWSAIHLLLLVWVVSLGLEEIRQAALSGTSFRSYVSDMWNIMDIMAVLLFLIGSCFFIMRSMDSVVQQLFVTGTDVAALKSAKETLIRLSRICLCIALFIFYIRILQVFSIHVSLGPKVVMIQNMIVKDLLPFLVIFLLFILAYAIMWSSILFP-KSSLSIAESMSELMAIMKTSYFQVFGELKVDMMSGDVTTLTEQCKTSSVGCPDIWGKWLAPILLGVHIVLTNVLLLNLLIATFSHTYEEIQSSSTQHWTLQRYMIMREYTERSPIAPPLIIVWHLVFVLYVLVQRCRGHRVFENGPFKRSYSGNRQRERQLMQWEHIRAVEFLRGQDDPKRRRKSDTRTIVRAGGVG-GNATNMKKELDSVQEGLGDLFRDSIREVEVNVKRIDNVERRLEELAEMVANLAKSMGERHYEMVTIIQNQYEQSEERTRRQAMTLSGGSRSDRRTTSQPVAVDDDLSVHLGSEDSTEEEQRPRVWRGKLQHHQLARLVPYQLDSGSARVAEMPEVWSSSDWPDRAEAAGAFNGFDSSSGFHRGSHAGRYVTDEAGRPMNPSGKPGAPDRNRLPLWGPNHCLHLAVTRWR---RDDRQNIAKKAGRPVLQVAAVLDRRGGMQLPWYHVKHCLPSCIGPASVSASSASSSTVGQCGLQNLLRAWLRE--RIEALDAGRLGAKRLHIQQEAVTAAACSTVYTGLLDDRVNGDNAWLETDLVNLHEHFNYNFEDDVVTECLREGGSGERVAWIDVANRRLMRQSHNTLLRLVAQQHGAYF 1889          
BLAST of Transient receptor potential cation channel,putative vs. TrEMBL
Match: A0A267FQS8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003066g3 PE=3 SV=1)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 499/1653 (30.19%), Postives = 808/1653 (48.88%), Query Frame = 3
Query:  366 NCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANK--NLLDQKGRIALHYAVCSNVETCI--ILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQ----NHSHYIFVDIP---RTEDTMKSFID--YRLTFENQVSKLNEFLANTK--------------MNFEKVPLCGILVSG-NRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXX-------XXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFT-EGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDD-TTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKK----------KLKNKQKISTRQCSESEKK-----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLW--IYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIY----FVFARLITIKVGQKQ-----PFKISYSSLPYKEKQLIQWERMRANDYIRSFDE----QSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNN-EIKISKKN-ELMIEPAKKIEVTSMLENTDYLPPGIVKK--------------------------TLKLWKSKFVDHLICRFVPI---------------FTAEQPVEFIED-----DSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKP---LLPFWGVNSCIHLLISRWKPWEKDDENDIYK----SILQVLGIGTTNHIELPFIIVQHNT-ECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNS 4937
            +C LLH A        VR LL         S ++  + P+H++  +        LL   + +  N LD +GR  LH+AV      C+  +L SD   DL L D + +S L   + E  P     L  L+                          L + E  ++     S    +     ++     N FGE+EF GL  +  + R++        + LL+  W +++PSL++S++GS+ +  + K   +KG+ K+A    +  WI+TD   + L    G+A RDF DAYG + +    +  W      E L S+ + G +PA Y   S     S         NHSH + VD     R  D  +S     +R  FE  +       A  +                    PLC +L  G +   L  LH S+  N  P +II G+GGLA+++ +L+ ++ E   +  S             +T   + +          EE  ++ Q ++E++H I++++++ ++ ++LD  IL+ LL+         D  N  QL +A++++R D+AKEK+F+  G++W+  +L      ++ EN+V F +LFV++GF L   +TV LLE LYT D  +GT+  RI    L     ++N   V L DIG +L+ L G  Y   Y   E         P++RP R+LFIW LLT R E+A+  WTLEKE + AAL AA LLR +++ ++ IS+K++L+E A DFE+KAEGV+  C +++   ++ NL+RQL +YG ST L +AA+G+SI+FI+H+ C +LLD  W G+L +    S+ F + LI G++CPF++P +V++KS      S  V   +          K   KQ  ++R  S++  +           D++ +K  R+R        Y +++ DFY+APV++FSYT   YL F+  +++  L     K+  +   W   ++LL  W +SL++EE RQA  S IS   Y++D WNI DI++   F +G    I+ L+ P+V++L     D   + S    LLR S+     ++F+F +RILQ+FSI+V LGP +VMI+NM+TNDL PF+VILLT    YGI + SI F    + ++SE  +++  +    YFQ++G + +D++ G      CA +   C DVWG W+ PI+  ++M+L+N L+ NLL+A+FS+TYE++ +S  Q+W+L+RY LMR+ S R P+APPL+  W +     F+  R     VG        PFK SY+    KE+QL+QWER+RA +++R+ +E    QS              P  +    G+ K+ E+ ++++ +SF E +  V+ R++++D +E  +  + D+L  L   L   + E+  S KN  +     +    T  ++ +D + P    K                              W      H +CR +PI               +   +  + IED     D     +           N  P NP+++      P    LP WG N C  L ++RWK   +DD  +  K     +LQ   I   N  E P  +V+H +  C    C+   L   ++ +  +  +  AD+    +E +  +L +S
Sbjct:   95 SCRLLHAAVAADNRDGVRGLLEMAPGLAELSNSRREL-PIHVACRLNRPLPAALLLPAMSREAVNSLDGRGRAPLHWAVELGEADCLAELLVSD-LCDLALPDSSGRSALDCAR-EAGPKARACLRLLESAAS-------------APSALAPLRLRRLEPARSHGCRDSEPRAWGAA-CDSALLANNCFGEVEFPGLGNTAQFCRVAQTCSDADISQLLLGCWALSRPSLVLSVHGSNCDKASFKAAWQKGLWKTAAG--SGAWIVTD-CCSGLARKTGQAARDFCDAYGPDSVRAIGVYSWGRSAGRECLRSESFAGCNPAHYKSDSPSDGDSDSSADSLDPNHSHLLLVDCAHRDRGCDCCRSDTSWLFRSRFEALLKDWPTLAAGARDSGVGGISETDLSDAASSVSPLCCLLACGMDSSSLYGLHASVHLNRTPLLIIAGTGGLADLLAKLLKDVNESAAEADSMPAAGGDPLSSASLTSRLQEAWDLPPDTPLDEEVRLLRQLVVESQHRIDLFTLDVDSASDLDGRILACLLNSAGGGCGD-DGFNGEQLRMAMALDRSDIAKEKVFSGSGRQWRDGELDKFMLAALRENRVAFARLFVQQGFGLDSFVTVRLLETLYTEDYCSGTEPTRIFRNCLDASTGRRNMGSVCLPDIGRLLQRLAGKRYQTPYPVDEASRQ-GGEQPMERPARDLFIWCLLTQRKELAEFFWTLEKECVPAALLAALLLRQIRDFSDDISEKEELEEIAYDFESKAEGVLNACAEDDQAKSQANLVRQLQHYGESTSLLLAAEGDSIRFISHKICHQLLDNAWMGSLSEKKNGSLKFALQLIAGLLCPFLLPLLVHYKSDNETDISSTVGADRGGEVSADESSKSHKKQTFASRIWSKAGGRVDPELGDGIIVDAD-EKTSRQRRCCLPFGEYRRRILDFYSAPVVRFSYTTISYLAFLCLYSYTLL----FKFGPSLPNWSASHLLLYVWVLSLVLEELRQALLSKISFSAYISDTWNIFDIVAILLFNIGAISFILRLATPVVEALFGVQGDQAGISSSQETLLRLSRLCLALALFVFFLRILQFFSISVTLGPKVVMIQNMITNDLMPFMVILLTFTFGYGIAMWSITFPTN-DPSISEAMVMIVRLMRVSYFQIYGEMNMDLITGLAP--TCATDPSTCADVWGAWIAPILLGIHMILANGLLFNLLIAMFSHTYELVDASGRQHWSLQRYLLMREFSERSPIAPPLVALWHLAWPLRFLAKRCCVGDVGGDAHSGDTPFKTSYADDRQKERQLMQWERIRALEFLRNLEESPSGQSAGVSGTAAASAEAKPMVL-RAAGVNKELEAVRSQLEESFKESLREVDGRVRRLDSMEAQLGQLKDLLEGLRDRLSERHIEVVTSIKNCSIRAAAPESPSATHEVQPSDSVSPSAKSKRKAGDWHWPQSGHFDEELDDPAASDVQPSAWLVALHQHKLCRLLPIGCLSSRKSAALSLCGWADPESTDAIEDSFNGFDQAGGFSRKSHGGRYAVANSAPRNPYKSCTSTTAPDRGGLPLWGPNHCAVLAVTRWK---RDDRQNAVKRGGRPVLQAATIVRANRQEFPSFLVKHRSHRCSATCCN---LANELKAWLSDRVESVADSANARSEIQAAALKHS 1710          
BLAST of Transient receptor potential cation channel,putative vs. TrEMBL
Match: A0A267GI71 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003066g1 PE=3 SV=1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 501/1649 (30.38%), Postives = 810/1649 (49.12%), Query Frame = 3
Query:  366 NCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANK--NLLDQKGRIALHYAVCSNVETCI--ILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQ----NHSHYIFVDIP---RTEDTMKSFID--YRLTFENQVSKLNEFLANTK--------------MNFEKVPLCGILVSG-NRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXX-------XXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFT-EGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDD-TTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKK----------KLKNKQKISTRQCSESEKK-----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLW--IYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIY----FVFARLITIKVGQKQ-----PFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNN-EIKISKKN-ELMIEPAKKIEVTSMLENTDYLPPGIVKK--------------------------TLKLWKSKFVDHLICRFVPI---------------FTAEQPVEFIED-----DSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKP---LLPFWGVNSCIHLLISRWKPWEKDDENDIYK----SILQVLGIGTTNHIELPFIIVQHNT-ECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNS 4937
            +C LLH A        VR LL         S ++  + P+H++  +        LL   + +  N LD +GR  LH+AV      C+  +L SD   DL L D + +S L   + E  P     L  L+           +       + P +     C  G+  A   +          ++     N FGE+EF GL  +  + R++        + LL+  W +++PSL++S++GSD +  + K   +KG+ K+A    +  WI+TD   + L    G+A RDF DAYG + +    +  W      E L S+ + G +PA Y   S     S         NHSH + VD     R  D  +S     +R  FE  +    +  A  +                    PLC +L  G +   L  LH S+  N  P +II G+GGLA+++ +L+ ++ E   +  S             +T   + +          EE  ++ Q ++E+RH I++++++ ++ ++LD  IL+ LL+         D  N  QL +A++++R D+AKEK+ +  G++W+  +L      ++ EN+V F +LFV++GF L   +TV LLE LYT D  +GT+  RI    L     ++N   V L DIG +L+ L G  Y   Y   E         P++RP R+LFIW LLT R E+A+  WTLEKE + AAL AA LLR +++ ++ IS+K++L+E A DFE+KAEGV+  C +++   ++ NL+RQL +YG ST L +AA+G+SI+FI+H+ C +LLD  W G+L +    S+ F + LI G++CPF +P +V++KS      S  V   +          K   KQ  ++R  S++  +           D++ +K  R R        Y +++ DFY+APV++FSYT   YL F+  +++  L     K+  +   W   ++LL  W +SL++EE RQA  S IS   Y++D WNI DI++   F +G    I+ L+ P+V++L     D   + S    LLR S+     ++F+F +RILQ+FSI+V LGP +VMI+NM+TNDL PF+VILLT    YGI + SI F    + ++SE  +++  +    YFQ++G + +D++ G      CA +   C DVWG W+ PI+  ++M+L+N L+ NLL+A+FS+TYE++ +S  Q+W+L+RY LMR+ S R P+APPL+  W +     F+  R     VG        PFK SY+    KE+QL+QWER+RA +++R+  E+S S ++         P  +    G+ K+ E+ ++++ +SF E +  V+ R++++D +E  +  + D+L  L   L   + E+  S KN  +     +    T  ++ +D + P    K                              W      H +CR +PI               +   +  + IED     D     +           N  P NP+++      P    LP WG N C  L ++RWK   +DD  +  K     +LQ   I   N  E P  +V+H +  C    C+   L   ++ +  +  +  AD+    +E +  +L +S
Sbjct:   95 SCRLLHAAVAADNRDGVRGLLEMASGLAELSNSRREL-PIHVACRLNRPLPAALLLPAMSREAVNSLDGRGRAPLHWAVELGEADCLAELLVSD-LCDLALPDSSGRSALDCAR-EAGPKARACLRLLESAASAP---SALAPLRLRRLEPARSH--GCRDGEPRAWGAAC---------DSALLANNCFGEVEFPGLGNTAQFCRVAQTCSDADISQLLLGCWALSRPSLVLSVHGSDCDKASFKAAWQKGLWKTAAG--SGAWIVTD-CCSGLARKTGQAARDFCDAYGPDSVRAIGVCSWGRSAGRECLRSESFAGCNPAHYKSDSPSDGDSDSSADSLDPNHSHLLLVDCAHRDRGCDCCRSDTSWLFRSRFEALLKDWPKLAAGARDSGVGGISETDLSDAASSVSPLCCLLACGMDSSSLYGLHASVHINRTPLLIIAGTGGLADLLAKLLKDVNESAAEADSTPAAGGDPLSSASLTSRLQEAWDLPPDTPLDEEVRLLRQLVVESRHRIDLFTLDVDSASDLDGRILACLLNS-AGGGGGDDGFNGEQLRMAMALDRSDIAKEKVLSGSGRRWRDGELDKFMLAALRENRVAFARLFVQQGFGLESFVTVRLLETLYTEDYCSGTESTRIFRNCLDASTGRRNMGSVCLPDIGRLLQRLAGKRYQTPYPVDEASRQ-GGEQPMERPARDLFIWCLLTQRKELAEFFWTLEKECVPAALLAALLLRQIRDFSDDISEKEELEEIAYDFESKAEGVLNACAEDDQAKSQANLVRQLQHYGESTSLLLAAEGDSIRFISHKICHQLLDNAWMGSLSEKKNGSLKFALQLIAGLLCPFFLPLLVHYKSDNETDISSTVGADRGGEVSADESSKSHKKQTFASRIWSKAGGRVDPELGDGIIVDAD-EKTSRPRRCCMSFGEYRRRILDFYSAPVVRFSYTTISYLAFLCLYSYTLL----FKFGPSLPNWSASHLLLYVWVLSLVLEELRQALLSKISFSAYISDTWNIFDIVAILLFNIGAISFILRLATPVVEALFGVQGDQAGISSSQETLLRLSRLCLALALFVFFLRILQFFSISVTLGPKVVMIQNMITNDLMPFMVILLTFTFGYGIAMWSITFPTN-DPSISEAMVMIVRLMRVSYFQIYGEMNMDLITGLAP--TCATDPSTCADVWGAWIAPILLGIHMILANGLLFNLLIAMFSHTYELVDASGRQHWSLQRYLLMREFSERSPIAPPLVALWHLAWPLRFLAKRCCVGDVGGDAHSGDTPFKTSYADDRQKERQLMQWERIRALEFLRNL-EESPSGQSAAAASAEAKPMVL-RAAGVNKELEAVRSQLEESFKESLREVDGRVRRLDSMEAQLGQLKDLLEGLKDRLSERHIEVVTSIKNCSIRAAAPESPSATHEVQPSDSVSPSAKSKRKAGDWHWPQSGHFDEELDDPAASDVQPSAWLVALHQHKLCRLLPIGCLSSRKSAALSLCGWADPESTDAIEDSFNGFDQAGGFSRKSHGGRYAVANSAPRNPYKSCTSTTAPDRGGLPLWGPNHCAVLAVTRWK---RDDRQNAVKRGGRPVLQAATIVRANRQEFPSFLVKHCSHRCSATCCN---LANELKAWLSDRVESVADSANTRSEIQTAALKHS 1705          
BLAST of Transient receptor potential cation channel,putative vs. TrEMBL
Match: A0A267DJL1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003066g2 PE=3 SV=1)

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 459/1462 (31.40%), Postives = 744/1462 (50.89%), Query Frame = 3
Query:  915 NFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATK----SQKFDQNHSHYIFVDIP---RTEDTMKSFID--YRLTFENQVSKLNEFLANTK--------------MNFEKVPLCGILVSG-NRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXX-------XXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFT-EGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDD-TTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIV----------EYKKKLKNKQKISTRQCSESEKK-----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLW--IYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIY----FVFARLITIKVGQKQ-----PFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNN-EIKISKKN-ELMIEPAKKIEVTSMLENTDYLPPGIVKK--------------------------TLKLWKSKFVDHLICRFVPI---------------FTAEQPVEFIED-----DSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKP---LLPFWGVNSCIHLLISRWKPWEKDDENDIYK----SILQVLGIGTTNHIELPFIIVQHNT-ECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNS 4937
            N FGE+EF GL  +  + R++        + LL+  W +++PSL++S++GS+ +  + K   +KG+ K+A    +  WI+TD   + L    G+A RDF DAYG + +    +  W      E L S+ + G +PA Y   S         +   D NHSH + VD     R  D  +S     +R  FE  +       A  +                    PLC +L  G +   L  LH S+  N  P +II G+GGLA+++ +L+ ++ E   +  S             +T   + +          EE  ++ Q ++E++H I++++++ ++ ++LD  IL+ LL+         D  N  QL +A++++R D+AKEK+F+  G++W+  +L      ++ EN+V F +LFV++GF L   +TV LLE LYT D  +GT+  RI    L     ++N   V L DIG +L+ L G  Y   Y   E         P++RP R+LFIW LLT R E+A+  WTLEKE + AAL AA LLR +++ ++ IS+K++L+E A DFE+KAEGV+  C +++   ++ NL+RQL +YG ST L +AA+G SI+FI+H+ C +LLD  W G+L +    S+ F + LI G++CPF +P +V++KS      S  V          +   K   KQ  ++R  S++  +           D++ +K  R R        Y +++ DFY+APV++FSYT   YL F+  +++  L     K+  +   W   ++LL  W +SL++EE RQA  S IS   Y++D WNI DI++   F +G    I+ L+ P+V++L     D   + S    LLR S+     ++F+F +RILQ+FSI+V LGP +VMI+NM+TNDL PF+VILLT    YGI + SI F    + ++SE  +++  +    YFQ++G + +D++ G      CA +   C DVWG W+ PI+  ++M+L+N L+ NLL+A+FS+TYE++ +S  Q+W+L+RY LMR+ S R P+APPL+  W +     F+  R     VG        PFK SY+    KE+QL+QWER+RA +++R+  E+S S ++         P  +    G+ K+ E+ ++++ +SF E +  V+ R++++D +E  +  + D+L  L   L   + E+  S KN  +     +    T  ++ +D + P    K                              W      H +CR +PI               +   +  + IED     D     +           N  P NP+++      P    LP WG N C  L ++RWK   +DD  +  K     +LQ   I   N  E P  +V+H +  C    C+   L   ++ +  +  +  AD+    +E +  +L +S
Sbjct:  265 NCFGEVEFPGLGNTAQFCRVAQTCSDADISQLLLGCWALSRPSLVLSVHGSNCDKASFKAAWQKGLWKTAAG--SGAWIVTD-CCSGLARKTGQAARDFCDAYGPDSVRAIGVCSWGRSAGRECLRSESFAGCNPAHYKSDSPSDGDSDGSANSLDPNHSHLLLVDCAHQDRGCDCCRSDTSWQFRSRFEALLKDWPTLAAGARDSGVGGISETDLSDAASSVSPLCCLLACGMDSASLYGLHASVHINRTPLLIIAGTGGLADLLAKLLKDVNESAAEADSTPAAGGDPLSSASLTSRLQEAWDLPPDTPLDEEVRLLRQLVVESQHRIDLFTLDVDSASDLDGRILACLLNS-AGGGGGDDGFNGEQLRMAMALDRSDIAKEKVFSGSGRQWRDGELDKFMLAALRENRVAFARLFVQQGFGLDSFVTVRLLETLYTEDYCSGTEPTRIFRNCLDASTGRRNMGSVCLPDIGRLLQRLAGKRYQTPYPVDEASRQ-GGEQPMERPARDLFIWCLLTQRKELAEFFWTLEKECVPAALLAALLLRQIRDFSDDISEKEELEEIAYDFESKAEGVLNACAEDDQAKSQANLVRQLQHYGESTSLLLAAEGESIRFISHKICHQLLDNAWMGSLSEKKNGSLKFALQLIAGLLCPFFLPLLVHYKSDNETDISSTVGADRGGEVSADESSKSHKKQTFASRIWSKAGGRVDPELGDGIIVDAD-EKTSRPRRCCMSFGEYRRRILDFYSAPVVRFSYTTISYLAFLCLYSYTLL----FKFGPSLPNWSASHLLLYVWVLSLVLEELRQALLSKISFSAYISDTWNIFDIVAILLFNIGAISFILRLATPVVEALFGVQGDQAGISSSQETLLRLSRLCLALALFVFFLRILQFFSISVTLGPKVVMIQNMITNDLMPFMVILLTFTFGYGIAMWSITFPTN-DPSISEAMVMIVRLMRVSYFQIYGEMNMDLITGLAP--TCATDPSTCADVWGAWIAPILLGIHMILANGLLFNLLIAMFSHTYELVDASGRQHWSLQRYLLMREFSERSPIAPPLVALWHLAWPLRFLAKRCCVGDVGGDAHSGDTPFKTSYADDRQKERQLMQWERIRALEFLRNL-EESPSGQSAAAASAEAKPMVL-RAAGVNKELEAVRSQLEESFKESLREVDGRVRRLDSMEAQLGQLKDLLEGLKDRLSERHIEVVTSIKNCSIRAAAPESPSATHEVQPSDSVSPSAKSKRKAGDWHWPQSGHFDEELDDPAASDVQPSAWLVALHQHKLCRLLPIGCLSSRKSAALSLCGWADPESTDAIEDSFNGFDQAGGFSRKSHGGRYAVANSAPRNPYKSCTSTTAPDRGGLPLWGPNHCAVLAVTRWK---RDDRQNAVKRGGRPVLQAATIVRANRQEFPSFLVKHCSHRCSATCCN---LANELKAWLSDRVESVADSANTRSEIQAAALKHS 1705          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Cavefish
Match: hrc (transient receptor potential cation channel subfamily M member 4-like [Source:NCBI gene;Acc:103047479])

HSP 1 Score: 282.337 bits (721), Expect = 3.931e-77
Identity = 291/1167 (24.94%), Postives = 545/1167 (46.70%), Query Frame = 3
Query:  828 CECGQNVADHHSVFEKYDFVDTENV----------EKPTNFFGEIEFSGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHA---IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGEN---QMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEF-LANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGEL--------VYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNG----TKLARILN--QGLRLIGFKKNN--KRVSLYDIGGVXXXXXXXXXXXXXXNP-EFQETWSSNLPLKR-----------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVE----------------YKKKLKNKQKISTRQCSESE----KKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSG-----ISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRG--------ENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRS 4073
            C+CG +  D H+     D+  +  V          E PT+ FGE+EF G+ K    ++R+S +T   T  ++L   W + KP+L++S+ G          ++++L++G++++A  + T  WI++ G+   +   +G+A+RD T A   +   ++    + PW + N  + L +   +G++PA Y  +++ +  S   D NH  ++ VD   T         +R   EN +S+     L +  M+   +P+   LVSG    L+ L  SL K   P +++ GSGGLA+++ ++        V        + ++  +I  +E +   + + +    + ++ V  +  + +++ LI IY +E+  P + D  +L +L+   +  +     L+  +L +A++ NR D+A+ ++FT   +WK E L    T ++  +K  FV+LF+E G  + + +T   LE LY + IS+     T L R L+  QG+   G+   +  K ++LY++  +L+ LLGD+  P Y +  + Q   S    +K+                 P+  LF W++L  R EMA   W +  ES+ +AL A  LLR +  L N    K  L E A  FE  A  V  +C++ +   +   L ++   +  +T L+MA + ++  F +H   Q LL  +W G +D  T++   ++ L I  +C         + SL    E E  E                Y + + +   I   Q  + E     K + TKK P+K+ F         +   F+ APV  F   +  Y +F+L F ++ L  +     K  +  + +LL FW  +++ EE R  F  G       I++Y  D+W+  D+++ + FL+G               L   +F  +           F++        +FT+R++  F+I+ +LGP I+++  M+  D+  F+  L   +++YG+    + +   P+        IL  +F   Y  +FG +  + +            N+ +   N   C D    W+  I+  +Y++++N+L++NLL+A+FS T+  +Q  S  YW  +R++++ +  SRP +APP IIF   +    R I  KV  ++  + +   +     +++ WE ++  + + +
Sbjct:   50 CQCGGS-RDSHATVSLNDYFSSAIVSHWDSALHSSEAPTDAFGEVEFGGVSKRHSNFLRLSSDTPPATAYTILTSNWGLPKPNLVLSVVGGVGRSKVKPKLREVLRQGLVRAA--QSTGAWILSGGLREGIDRCLGEAVRDHTTAASSDSLTKVVAIGVAPWGLVNLRDELVNP--EGSYPAGYF-VTNTSRDSYCLDTNHQAFLLVDDGST-GRRGGEARFRAGLENYISQQRTGKLGSGSMD---IPVLCTLVSGELYMLERLDLSL-KKCIPWMVLAGSGGLADLVTDVLENVAAAPVLPAGGAEGEGEATTKINLRERVAEKVVKHFPSEPDVDKLVDKLLNVHKSQDLISIYHLEQEGPEDFDTVLLKALVRASKQRLSSDASLSTEELKLAVTWNRVDIARSELFTGDIQWKNESLESFMTDALVNDKPQFVRLFIENGLNVQEYMTFGRLEELYRS-ISDSSVAYTLLQRHLSERQGVAGTGWPAADPAKGLTLYEVAQLLEDLLGDVCQPFYDDKLKIQGITSRRKTIKKLTTVLQEGEYRQQRCVFPWASLFTWAVLQNRSEMAVFFWEMTPESVLSALSACKLLRELCKLENETETKHSLKELAMKFENLAHDVFSKCYQSSESRSFVLLKKKSVVWRGATCLQMAMEADARHFFSHDGVQTLLSQIWWGDMDRNTENWKLVLTLFIPPLC---------YTSLISFREVEEAEDGTPEEAPKARDIDWLYAETVFSFADIKRIQTKQEELRFTPKGNPTKKSPQKQCF------LLSRWKQFWYAPVTAFLGNMLMYFLFLLLFAYVLLVDFKPPPPKGPSP-MELLLYFWVFTIVCEEIRGTFFIGNMTVRQRIRQYTQDLWHKCDLIAITLFLIG---------------LCCRMFRRS---------FWFARAALCLDYMVFTLRLIHIFAIHKQLGPKIIIVGKMM-KDVFFFLFFLAVWMMAYGVANQGLIYSFDPSA-----DRILRRVFYRPYLHIFGQIPYEQMDSGFEWNVTCTTNVTEIDENMEPCRDTRYNWMVVILLMIYLLVTNILLINLLIAMFSYTFTKVQERSDVYWKFQRFKVIIEYHSRPCLAPPFIIFSHFHQFIKRNIR-KVPSEKIHQFAVDLIDKANNRMMTWENIQKENLLSA 1157          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Cavefish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 260.381 bits (664), Expect = 1.308e-69
Identity = 271/1063 (25.49%), Postives = 497/1063 (46.75%), Query Frame = 3
Query:  963 YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILN------QGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR---------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPF--IVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESE----------KKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  KD     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++       + L L G    + R+SL DIG V++YL+G  Y   Y    F+  + +       ++P++R                           P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  +++F   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I      N   + Y+P+ +    ++K  ++     +   E +            +++ KK+  +     +L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    +  S     WI I  IF      IE+ R+   S        +K +L + WNI D+++    L+ + G+++ L DP                     L+ + + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I   + PN   S   M+   +F   Y+ ++G        G+N   +      + P   G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  +  V   L
Sbjct:    3 YVRVSYDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLVGKDV--VRP--YQTMSNPLSKLTVLNSLHSHFILAD-NGTTGKYGAEVKLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GLINESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTLSRLEELYNTRHGPSNTLYHLVRDVKKSEETLYLQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFSFPFHELMVWAVLLKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVEDISQELNHNSREFGQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQEQEAYLQEKDSDEADKPAKDKDEEDMEFTAMLGNVSSEASRKKVVEEVQHRHRLIPVGRKIYEFYNAPIVKFWFHTMAYVGYLMLFNYIVLVKMDLWPSPQE--WIVIAYIFTNG---IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMA---ILIFSIGMVLRLQDP--------------------PLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAI---LNPNEDPS--WMLARNIFFMPYWMIYGEAPC----GQNITTEDGTIVPLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMVLKHL 1001          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Cavefish
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:103047602])

HSP 1 Score: 250.366 bits (638), Expect = 5.241e-67
Identity = 297/1206 (24.63%), Postives = 555/1206 (46.02%), Query Frame = 3
Query:  777 CQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSK-PYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHA---IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGEN--QMYGFAITPWS-IHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFI--DYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLL-SQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARIL---------------NQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLP-----LKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMI-PFIVNFKSLFYLPESEIVEYK---KKLKNKQKISTRQCSESEKKDSNTKKI---PRKRNFTFQLKTYFKKMYD-FYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISI------KEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGEN--------NLRQCANNNL-MCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISY--SSLPYK-EKQLIQWERMRANDYI----RSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEI 4193
            CQ  CYS+    ES+ Q       A H  V + +     E         G+I+F G  +++  + R+S  T       LL +QW ++ P L++++ G D        ++D ++KG++++   + T  WI+T+G+   + + +G+A+RD + A   +  ++    I PW+ IHN+   L +K  Q   PA Y             D +HSH+I V+    E+  +S    D R+     +S L         +FE +P+  +LV G    L+ ++ + ++N  P +++ GSGG+A+I+  L+Y        +  ++  M +E L  + T     S +    V +IQ+I+EN HL+ ++  E+    +LD  IL +L+ +    S +  D L+  +L +A++ NR D+AK +IF    +W  +DL  +   ++  +K  FV+LFV+ G  LG+ +T   L+ LY + +S  + L  +L                 G   +       R +L+++  VLK  L D     Y     +            +LP      + P+R+LF+W++L  R +MA   W +  E++AAAL    +L+ M +L +       + E    +E  A  +  EC+  + +     L+R+   + +ST L +A + ++  F AH   Q LL  +W G +   T     I  L++   CP +I   ++ F         EI++ +   ++      + T +       D +  +    P  ++ +     +  + +  F++APV  F   +  Y  F++ FT++ L  +        ++   IL  FW  +L++EE RQ+F +   +      K Y+ D WN  D+++ S F++G    +M                         N     + +      +FT+R++  F+I+ +LGP I+++  M+  D+  F+  L   L++YG+   ++     P L    F  +LY      Y  +FG + ++ +            +L+      L  CP+++  WL  ++  +Y++++NVL+LNLL+A+FS T++++Q ++  +W  +RY L+ +  SRP +APP II   +       I + + +K   KI +    LP   +++L+ WE ++  +Y+    R   E S+ +   T+  V      +G I   +K   S + E+
Sbjct:   36 CQ--CYSV--EDESVAQ-------AVHQKVQQGH-----EKAHWTGGRLGDIDFIGSSRTRGKFARVSSMTDPVLIYQLLTEQWGLSPPHLVVALVGGDELDQMKPWLRDTVRKGLVRA--TQSTGAWILTNGLQFGITKHLGQAVRDHSLASTSSKVRVVAIGIAPWTMIHNKEMLLTAKPDQ---PAAYPTEDLPHGSVYSLDCHHSHFILVE----EEQHRSGATGDMRVKLLKHIS-LQRTGYGGPGSFE-IPVLCLLVHGEPKILQRMYKT-IQNATPWLLLAGSGGVADILVTLIY--------RGCWDTEMVQELL--LETFTGLHSTDITSWVKVIQKILENGHLLTVHDPEQTA--DLDTVILKALVKACKSQSQEAQDFLD--ELKLAVAWNRVDIAKSEIFNGDVEWSPQDLEEVMMDALVNDKPDFVRLFVDNGVNLGEFLTYGRLQELYCS-VSEKSLLFDLLLKKHQEKQMLLASARTPGPPYMEPVDRRPRFTLHEVSKVLKDFLHDSCKGFYQKLPAERVGKGRLFHSQKDLPDLDQHCENPWRDLFLWAVLQNRQKMANYFWAMGPEAVAAALAGCKILKEMAHLESEAESARSMKE--AKYEQFALDLFSECYSNSEDRAYALLVRKTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTS----ISKLVLSFFCPPLIWTNLIKFS-------DEILQSRGGGEQFAELDSLDTEKALLLSDDDPDDSEAAGDPADQSCSQAWSQFLLRRWKRFWSAPVTVFLGNVLMYFAFLVLFTYVLLLDFRPPPPDGPSIAEIILY-FWVFTLVLEEIRQSFFTDEDMNILKKCKLYVEDNWNKCDMVAISLFVVGVSCRMME------------------------NTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMM-KDVFFFLFFLSVWLIAYGVATQALLHPNDPRLDWV-FRRVLYR----PYLHIFGQIPLEEIDAAKMQPDNCTMDLQDIITGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQGNTDIFWKFQRYNLIVEYHSRPALAPPFIIISHL-----SQILLSLCKKSESKIEHLERELPAGLDQKLMTWETVQKENYLARLERRHLESSEERLKSTSSKVQSLLQIVGGIKDQEKRMASMEAEV 1149          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Cavefish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 243.047 bits (619), Expect = 3.041e-64
Identity = 296/1188 (24.92%), Postives = 526/1188 (44.28%), Query Frame = 3
Query:  825 QCECGQNVADHHSVFEKYDFVDTENVEK----------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVS--KLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFT------------------------------------EGKKWKTEDLIPLATK-------------------SISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN----KRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRP-------------------------------------------YRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTN---VISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFK---SLFYLPESEIVEYKKK---LKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSI-------NFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFV 3944
            +C CGQ V  H  +         E  +                 PT+ +G IEF G   +    Y+R+S ++K +    L++  W++  P+L+IS++G   +F+    +K +  KG++K+A    T  WI T G+ T +I  +G A++D + +    ++    I PW I    E L  +D   T P  Y  +S+  +K    + +HSH+I  D   T     + +  R   E  +S  K+N  L       + VPL  +++ G  + + ++  SL +    P V+  GSG  ++II    ++  E++       E ++ + L  +        ++ ++  +M+ E ++ R LI ++ +      +++  IL++LL     S   PD     QL +A++ NR D+A+ +IF                                     +G++ K +   P  T                    ++  ++V FVKL +E G  +   +T+  LE LY   +     L  ++         KK N     +++L DIG VL++L+G  Y   Y    F+  +++   LKRP                                           + EL +W++L  R +MA  LW   +E++A AL A  L ++M + ++   ++ D   DLD  +K+F   A  ++++ +K + +     L  +L  +  ST L++A       FIAH   Q LL  +W G L    KS    + +I+G+I P  I  +++F+    + Y    E  E K K    K+ +       + S+K D    K   KR          KK+Y FYNAP  KF +    YL++++ + ++ L    +K  +  +L  +I +I + ++L +E+ RQ   S        I  +L D WNI D+++                         S+F +  ++ +  + + + + +Y   I  + +R+L  F +N  LGP ++MI  M+  D+  F+VI+L VL+S+G+   +I        + +  N+    + MI  E+F      L+  + I+   GEN   +  +   + P + G WL P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  IY V
Sbjct:    6 RCSCGQLVTQHAPIPPSATSKGGEEGQSEPAAERWSVLKHTQLLPTDAYGTIEFQGGGHANKAMYIRVSYDSKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT--TGAWIFTGGVSTGVIRHVGDALKDHS-SKSRGRVCAIGIAPWGIVENKEDLIGRDV--TRP--YQTMSNPLSKLSVLNSSHSHFILAD-NGTHGKYGAEVRLRRQLEKHISLQKINTRLG------QGVPLVCLILEGGPNVITIVLESLREEPPVPVVVCDGSGRASDII-SFAHKYTEED---GLVNEGVRDQLLVTLQKTFNYNRNQAQQIYLMVMECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNASA--PD-----QLSLALAWNRVDIARSQIFVHGQHWPSAGSLPAASIPQDRPKSPTRGSKSKAARAKKGRRGKPKPEPPEETDPRKLELLNWVNSLEQAMMDALVLDRVDFVKLLIENGVNIHHFLTIPRLEELYNTRLGPTNTLHFVVRD------VKKGNLPPDYQITLIDIGLVLEFLMGGAYRCNYTRKSFRTLYNNLYGLKRPKALKLLGMEDDDPRPKGKKKKKKKEEEIDIDVDDPEVSRFQYPFHELMVWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHESSQSELVDDISQDLDNNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELQNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGCL-RMGKSNG--LKVILGIIFPPAI-LLLDFRIGDDMSYHTSKETEETKDKEDDTKSNKDGVVNMDATSKKGDEEDSKKKNKR------VPIGKKIYYFYNAPFTKFWFNTIAYLVYLMLYNYIIL----VKMERWPSLQEWI-VISYIITLGLEKVRQILMSEPGKLKQKINVWLEDYWNITDLVA------------------------ISMFLLGLLLRLQNSYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADS-IDLYA-MEINPPCGENMYDE--DGKKLPPCIPGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPLIIFSHIYIV 1118          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 209.92 bits (533), Expect = 2.970e-54
Identity = 178/752 (23.67%), Postives = 341/752 (45.35%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKES-LIQCECGQNVADHHS----------VFEKYDFVDTENVEKPTNFFGEIEFSGL-YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHA---IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYG---ENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFE-----KVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMK------EKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLR----LIGFK------------------KNNKRVSLYDI--------GGVXX----------XXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFK 2807
            W+P+ I +  C + +   +S   +C+CG   A H S          V  ++D       E PT+ FGE+EF+G   +   ++R+S +T      S++   W +  P+L++S+ G          ++D+L++G++ +A  + T  WI+T G+   +   +G+A+RD   A     ++++    + PW +    + L   + QG+ PA Y  I + +  S   D N+  ++ VD           + +R    N ++ + ++++N +         ++P+  +L+SG    LK +  SL K   P +++ GSG  A++I EL+ ++       + + +  S  E+  +   K I+ + +      E+ V     I +NR LI ++  ++++P++ D  +L +L+                +L +A++ NR D+AK ++F    +W+ E L    T ++  NK  FV++F+E G  + + +T + LE+LY + +S+ +    +L + LR    L+                      N + +SLY++        GG+ +              +      LN    +          P+  LFIW++L  R EMA   W +  ES+ +AL A  +LR +  L N    K  + E A+ FET A      C++ +   +   LIR    +G  T L+MA   ++  F +H   Q LL  +W G ++  T+    +   ++    P +   ++NF+
Sbjct:   24 WVPKIIKKKVCTTFLEDSQSNGDRCQCGSERAAHSSSATGDFFGSAVVSQWD-TAVHTSEYPTDAFGEVEFAGAGRRHSHFLRLSCDTPASLVYSIMTVHWGLPPPNLVVSVMGGGGREKVKSWVRDVLRQGLVLAA--QSTGAWIMTGGLKEGVGHCVGEAVRDHVAAASSPSQSKVVAIGVAPWGLVANRQQLV--NAQGSFPARY-YIQNTSHDSCYLDNNYQAFLLVD--------DGSVGHRGGETNFITNMEDYISNQRTGIWGSGNIEIPVLCMLISGEASVLKRMDMSL-KKATPWLVLDGSGPAADMISELLDDLSPAASPADGDVRDSSTAELRNRT--KEIIKKHFPAEKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMSSDASEYT-EELKLAVAWNRVDIAKSELFNGDIQWQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQS-LSDSSLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELSLYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFWEMAGESVLSALCACKMLRELCKLENETETKLSIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVWKLVASFLMP---PLIYTNLINFR 753          

HSP 2 Score: 95.1301 bits (235), Expect = 4.830e-19
Identity = 98/362 (27.07%), Postives = 169/362 (46.69%), Query Frame = 3
Query: 3114 IYILLIFWTVSLLIEEARQAF-----GSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVL----RGENNLRQCANNNLM-------CPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSI 4151
            I  LL FW  +L+ EE RQ+F     G   S+  Y+ D+WN  D+ +   F +G               L+  +F  +           F + +      +FT+R++  F+IN +LGP I+++  M+  D+  F+  L   L++YG+   ++ +   P         +   +F   Y  ++G + +D +    RG+   + C NN  +       CP     WL  I+ +VY++++NVL+LNLL+A+FS T+  +Q  S  +W  +RY L+ +  SRP +APP IIF  ++    R I  KV   +           K  +L  WE ++    + +   QSK  R+  T  + R  A + ++
Sbjct:  891 IEYLLYFWVFTLVCEEFRQSFFVGNTGLCQSMSLYIQDMWNKFDLTAIMLFCVG---------------LVCRMFPWS---------YEFGRSVLCVDYMVFTLRLIHIFAINKQLGPKIIIVGKMV-KDVFFFLFFLGVWLMAYGVANQALLYSYDPRPYW-----VFRRVFYRPYLHIYGQIPLDEIDAYRRGD---KPCTNNVTLIHEGAEPCPQSEANWLVLILLSVYLLVTNVLLLNLLIAMFSYTFSKVQEHSDVHWKFQRYNLIVEYHSRPCLAPPFIIFSHLHLFIKRSIR-KVPSTKIKHFMLELRGRKASRLNTWEAVQKEILLST---QSKKVRDSDTERLKRTSAKVDNV 1215          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 213.386 bits (542), Expect = 2.789e-56
Identity = 212/779 (27.21%), Postives = 348/779 (44.67%), Query Frame = 3
Query: 1923 YQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIG-------------------FKKNNKRVSLYDIGGVXXXXXXXXXXXXXXN---------PEFQETWSS----------------NLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMI-PFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAF------GSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIF-----LFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNL-----MCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQK-QPFKISYSSLPYKEKQLIQWERMRANDYIRS 4073
            +QL +A++ NR D+A  +IFT+ +KW+T DL  +   ++ EN+  F+ LFVE G  L + +T   LE+LY     NG   + +L+  LR I                      K     SLY I  +++ LLGD    LY N         P  + T S+                 L    P R+LFIW++L  R E+A   W+  K+ +AAAL A+ LL++M    +      D+   A ++E  A G+++EC+K++    +  LIRQL  +G +T L MA   N+  F +H   Q LL  +W G +    K+   I+ +I     P +I   I+ F+ + Y                       C+ +  ++  T  I     F   + +YF  ++ F    ++ F                        +Y+ +   W   +L  W +SL++EE RQ F      G   +   Y+ DIWN IDIL+    LL T G+I  L                P      N +  S F  G S+      +F +R++  F++N  LGP I++++ M+  D+  F+ +L   +V+YG+    I       L       I   +    Y  +FG     V     +   C NN +      CP +   WL  ++  +Y++ +N+L+LNLL+A+F+ T++++Q ++   W  +RY+L+ +  SRP +APPLI+F  +Y    R I  K   K + FK  +S    +E++ + WE +    Y+ S
Sbjct:  372 HQLRLALAWNRVDIATSEIFTDDRKWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLY-----NGAPASSLLHILLRRISEGEKSPADPHRRWISTLPMAPKRMNHFSLYHISLLIRELLGDSTSMLYGNKMSRFSKLSPSSKNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLLKAMVQEEDDSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIF----PLLIYTRIITFRWVLY--------------------AHTCTPTRWRNFWTAPIT---VFWANVVSYFIFLWLFAYVIIMDF------------------------QYTPD---WPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRYIKDIWNRIDILA---LLLFTIGVICRL---------------IP------NSINESTFQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMV-KDIFFFLFLLGVWVVAYGVATQGILI-----LNEQRLDWIFRGVVYQPYLLIFGQFPTRVDSTTFDTTSCTNNGINTSQPRCPVLGVDWLTILLTCLYLLFANILLLNLLIAMFNYTFQLVQDNTDTIWKFQRYELVNEYHSRPSLAPPLIVFSHLYLFVRRFILKKPQHKHEDFKKGFSE--SEEREFLAWESIMRESYVAS 1059          

HSP 2 Score: 102.064 bits (253), Expect = 6.721e-22
Identity = 70/241 (29.05%), Postives = 119/241 (49.38%), Query Frame = 3
Query:  741 KKKLNLWIPQNI----CQFECYSIIPRKESLIQCECGQNVADHHS--------VFEKYDFVDTENVEKPTNFFGEIEFSGL-YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGH---AIKDILKKGILKSAGNRETFV---WIITDGIFTNLIEVIGKAIRDFTDAYG--ENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVD 1400
            ++ +  WI QNI    C +   S      +   CEC    ++H +        + +K++        +PTN FG+I+F+GL  +   +VR+  +T+      L+++ W +  P+L+IS+ G     H    ++ I + G+ K+A  R T +   WIIT G +  +++ +G+++RDF  A G  E ++    I  W I +  E+L   D QG  PAEY    +   +    D NHSH+I VD
Sbjct:    1 QEAVKAWISQNIKMKVCCWYIESSTAGGAARRVCECRHPRSEHANTALLKPTLLGQKWEPAK-HTANEPTNAFGDIQFTGLGQRLGKFVRVGNDTEPSVLFKLMMEHWHLDVPNLLISVTGGAKNFHLKPQLRTIFRHGLNKTA--RSTGIQGAWIITGGSYAGVMKYVGESVRDFALASGSKEGKIVAIGIATWGIIHNKEHLI--DAQGKFPAEYPMDEAGQGRLSCLDNNHSHFILVD 236          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 184.496 bits (467), Expect = 2.264e-47
Identity = 239/1026 (23.29%), Postives = 436/1026 (42.50%), Query Frame = 3
Query:  963 YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVS--KLNEFLANTKMNFEKVPLCGILVSGNRDDL-KLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLI----PLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLY---TADISNGTKLARILNQGLRLIGFKKN-NKRV----SLYDIGGVXXXXXX-----XXXXXXXXNPEFQETWSSNLP----LKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSM----KNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWT-------VSLLIEEARQAFG--------SGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINF-EVKP------NLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQ 3872
            Y R+S +++ +    L++ +W++  P L+IS++G   +FE H  +K +  KG++K+A    T  WI T G+ T ++  +G A+++   +   +++    I PW +      L  +D     P  Y  +S+  +K    +  HSH+I VD   T     +    R   E  ++  K++       M  + VP+ G++  G  + +  +L   L +   P V+ +G+G  A+I+  L      KN     +    +      ++  + E     E      +            +     P+      L    +    +    D LN+     A++ +R D+AK  +F  G+ W          P+   ++  ++V FVKL +E G  + K +T+  LE LY   +  ++N  K   + N     +G     N  V     L  +GG    +            +        T   + P       P+ EL  W++L  R  MA   W   +ES+A AL A  L RS+    K    V    ++L +++ +F   A  ++++ F+++       L  +L  +   T L++A       F+AH   Q LL  +W G L+    S      +I+ ++ P  I  ++ +KS   + ++P+SE      +L      S     ES  K+     I R    +       +++Y+FY+AP++KF +    Y+ F++ FT++ L    ++   +   W  IL +F +       VS    E R+A G        +   IK +L+  WNI D          + GI+              LF +   +    +LL  +K +Y   +  + VR+L  F++N  +GP I+MI  M+ N +   ++I+  VL+S+G+   +I F E  P      N+    + MI  E+    Y      + + VL    N+ +   ++   P   G ++ P + AVY+ +  ++M+NLL+A F+N Y   ++ S + W   RY 
Sbjct:    1 YARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAA--LTTGAWIFTGGVNTGVVNHVGNALKEHA-SRSSHKICTIGIAPWGVIENRGDLVGQDSHVVSP--YQTLSNPLSKLNLLNSLHSHFILVD-DGTVGKYGAEAQLRRELEKHIALQKIHTLACRAGMG-QGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFL-----HKNTDDTGWAHTHRHGQAMHLLQTLLECMRRKELVGTRARVRTHTHTCTHGSAAISGGPSVETLIALHRTGAAAGTNFSSADQLNL-----ALAWDRVDIAKNHVFVYGQHWMALMWARWRRPM-LDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTVSGPLTNPPKRPLLANSRSPPVGLNCTLNPPVIGNLLLMILGGTCSAIQAVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSW---FKVILSILMPPSI-LMLEYKSKAEMSHIPQSE------ELHQMGNGSAADGGESGHKEEEGIWI-RPSGLSLS-----RRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVK--LQQLPSVQEWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLDGYWNIND----------SLGIL--------------LFFVAVALRSQSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMAN-MFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEV----YAPEIDGICVAVLAACENIMKNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYH 961          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 182.185 bits (461), Expect = 1.220e-46
Identity = 238/1072 (22.20%), Postives = 448/1072 (41.79%), Query Frame = 3
Query:  963 YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDL-KLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATK----SISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKR-----------------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAK------DFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKK-----LKNKQKISTRQCSESEKKDSNTKKIPRKRN---------FTFQLKTYF---------------------------------KKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGS-----GISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINF-EVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQ 3872
            Y R+S +++ +    L++ +W++  P L+IS++G   +FE H  +K +  KG++K+A    T  WI T G+ T ++  +G A+++   +   +++    I PW +      L  +D     P  Y  +S+  +K    +  HSH+I VD   T     +    R   E  ++     +A      + VP+ G++  G  + +  +L   L +   P V+ +G+G  A+I+  L     +         + +  E +  I         +    +  + E +  + LI ++     + +++D  IL++LL       K  +  +  QL +A++ +R D+AK  +F  G+ W          +    ++  ++V FVKL +E G  + K +T+  LE LY     +     RIL   L        + +++L D+G V+++L+G  +  +Y    F+  + +     R                                   P+ EL  W++L  R  MA   W   +ES+A AL A  L RS+         ++D  +W +       F   A  ++++ F+++       L  +L  +   T L++A       F+AH   Q LL  +W G L+    S          VI   ++P           P   ++EYK K     +   +++      E E + + T+ IP +R           +F ++                                    +++Y+FY+AP++KF +    Y+ F++ FT++ L    ++   +   W  IL +F +    IE  R+ F S     G  IK +L+  WNI D          + GI+              LF +   +    +LL  +K +Y   +  + VR+L  F++N  +GP I+MI  M+       ++I+  VL+S+G+   +I F E  P+  ++        +    Y+ +FG +    +  +NN      ++   P   G ++ P + AVY+ +  ++M+NLL+A F+N Y   ++ S + W   RY 
Sbjct:    2 YARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAA--LTTGAWIFTGGVNTGVVNHVGNALKEHA-SRSSHKICTIGIAPWGVIENRGDLVGQDSHVVSP--YQTLSNPLSKLNLLNSLHSHFILVD-DGTVGKYGAEAQLRRELEKHIAT----VACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFL----HKNTDDTGELCDGLHDEIVGTIKKTFNFSHGQAMHLLQTLLECMRRKELITVFHTGSEDHSDVDLAILTALL-------KGTNFSSADQLNLALAWDRVDIAKNHVFVYGQHWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQMSNLRIL---LHRFSHLPPDYKITLIDVGLVIEFLMGGAFRSMYTRKRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAK--QSREDELKWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSW-------FKVILSILMP-----------PSILMLEYKSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVK--LQQLPSVQEWFVILYLFMSA---IERVREIFMSEPGKFGQKIKVWLDGYWNIND----------SLGIL--------------LFFVAVALRSQSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQC-MLMIIMAIVLLSFGVARQAILFKEADPSWYLAR------NIVFQPYWMIFGEVYAPEI--DNN-----TDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYH 986          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.863e-8
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 3
Query:  360 LDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAV-CSNVETCIILTSDGNYDLQLQDENEKSPL----QYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECY 794
            L+    LH A      R++ +LL  ++   ++++T+ G+TP+H+SA +G+   V  LL  GA+ N  + +G  ALH A      E    L  +G   +  +   E++PL    + GK+E    + +++ + D    N + P ++   E +
Sbjct:   13 LNGFTPLHIACKKNRIRVMELLL--KYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNG-AQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGH 159          

HSP 2 Score: 53.1434 bits (126), Expect = 6.007e-7
Identity = 40/137 (29.20%), Postives = 60/137 (43.80%), Query Frame = 3
Query:  378 LHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCIILTSDGNYDLQLQDENEKSPL----QYGKMEDKPFIAKYLETLDKKKLNLWIPQNI 776
            LH AA    T +VR LL +     VD+  +E  TPLHI+A +G    V+ LL H A+ +     G   LH A     E    +  +    L +  +   +PL    +YGKME    + +   + D    N   P ++
Sbjct:   85 LHMAARAGQTEVVRSLLRNGAQ--VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHV 219          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 3.482e-8
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 3
Query:  360 LDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAV-CSNVETCIILTSDGNYDLQLQDENEKSPL----QYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECY 794
            L+    LH A      R++ +LL  ++   ++++T+ G+TP+H+SA +G+   V  LL  GA+ N  + +G  ALH A      E    L  +G   +  +   E++PL    + GK+E    + +++ + D    N + P ++   E +
Sbjct:  103 LNGFTPLHIACKKNRIRVMELLL--KYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNG-AQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGH 249          

HSP 2 Score: 53.1434 bits (126), Expect = 7.570e-7
Identity = 40/137 (29.20%), Postives = 60/137 (43.80%), Query Frame = 3
Query:  378 LHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCIILTSDGNYDLQLQDENEKSPL----QYGKMEDKPFIAKYLETLDKKKLNLWIPQNI 776
            LH AA    T +VR LL +     VD+  +E  TPLHI+A +G    V+ LL H A+ +     G   LH A     E    +  +    L +  +   +PL    +YGKME    + +   + D    N   P ++
Sbjct:  175 LHMAARAGQTEVVRSLLRNGAQ--VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHV 309          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 51.9878 bits (123), Expect = 8.881e-7
Identity = 33/120 (27.50%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  360 LDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSN------VETCIILTSDGNYDLQLQDENEKSPLQYGKME 701
            +D  + LH+A +     + + LL    N P  +    G T LH +A  G+ Y V  LL HGA+  L D++G   +H++V S+           ++ ++ N D+  +D N ++PL +   +
Sbjct:   82 IDELSGLHWACINNRFSVAKFLLLRGAN-PNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQ 200          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 403.29 bits (1035), Expect = 6.571e-116
Identity = 405/1574 (25.73%), Postives = 725/1574 (46.06%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADH-HSVFEKYDFVDTENV-----EKPTNFFGEIEFSGL--YKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYG---SDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYG-ENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXX--XXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXX-------------------XXXXXXXXXXNPEFQETWSSNL----PLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFT------------------FQLKTYFKKMYD---------------------FYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLW----IYILLIFWTVSLLIEEARQ-AFGSGISIKE----YLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSL---PYKEKQLIQWERMRANDYIR--------SFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDI-IEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKL------WKSKFVDHLICRFVPIFTAEQPVEFIED---------------DSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGT--TNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDV 5108
            WI +N  + EC   +P+   + +C+CG+    H     E     +  NV     + PTN +GEI+F G    K  PY+RMS +T      +L++ +W +  P+L+IS+ G   S      ++++ ++G++K+A  + T  WIIT G  T +++ +G+A+++    +G + Q+    I  W I ++   L S+   G +PA Y+   +   +    D NHSH+  VD   TE      I  R   E  + K+    + ++     VP+  +++ G  + +  ++  L+K   P V+I GSG  A+++G       ++N   ++   ++  +Y   +  ++ E+  +   ++   MI++++E+  +I +YS++     ++D  IL +LL  + +S        + QL +A++ NR D+AK  IFTE ++W TE L      ++ ++K  F +LF++ G  + + +++++L  LY A++   T +  +L + +     K+  K + +  +G V++ L                          +  N +  +   +N+    PL  PY ++F+W++L  R E+A++LW   +E +AAAL A+ LL+ M +     N I+D   DL + A+ FE +A GV++ECF EN   ++  L+R+LD+Y R T LE+A    S  FIAH SCQ LL  +W GT+   T+    ++ L + V+   +I F+ + +      E E   ++K L  K   S++  S  EK D+    + R +                     FQL+ Y  ++ +                     FY+AP  KF   +  YL FI  + ++ L  +  ++     L       I+L FW  ++LIEE RQ A      IK+    Y +D WN +DI S + F++    II+        S +F+                 S+ +    I  F VR LQ FS+N  LGP +VMI+ M+  DL  FI+IL    ++YGI L ++ F        +   + +  +    Y+Q++G L +D ++GE    +      + PD  G WL P++ A+YMV +N+L+LNLL+AIF+ T+E +Q  S + W  +RY L+++  SRP  APPL++   I  +F R +        P + S   +   P + +Q+  WE   A  YI         + +E+ ++  ++   I ++    + S+ G +    +  N +     E     E RL +M++ +  N  ++  IL  L    P+  +  +  +  L+   A+         ++ Y  PG   K   +      W+  F D+    +        PV   +D               D   + N V         +G+P+NP       G+ LL  +G N     +++RWK           K +L+ + I     N   +P  +V+      Q L +    E + +   + +++++ +      E+ F+     +  ++Y+GY+ D RN+DN+W+ET A N H +    F    L     DD+  + W  V
Sbjct:   35 WIARNFSRRECIRFVPKSHDVSRCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDFEGYGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAA--KTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDLISEK-NGKYPALYSMEPTPGHQGAMLDPNHSHFFLVD-DGTEGKYGVEIGMRSRIEEAIMKVKTD-SRSEAGSIGVPVVLLVLEGGPNTVATMY-ELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTIN-VIDPQYEDEVRAKVVEVFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKANRSS-------PVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLY-AEVPGNTTIKPLLQKEMG----KRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIFPIIYFVPDEQHERQAAERE---HQKSLNQK---SSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFP-RFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIA---IILRF---FTNSRIFTA----------------SRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMM-QDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGE----KPKEFGEVDPD--GRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHI-LIFIRWVWRMCRCGHPPRGSTMKIGLSPAEMEQMDNWEFQAAEMYIHQQQQKNSGTLEERVRALGDRVDCINSQLNRVLDSMSGTRAHALTDGNGL-----EGGHDSEGRLARMEVELSSNSESLQKILALLQQQPPVKGQAAVPIQLTLLHYKAR---------SSPY--PGSTAKRFAVQDNMVDWQVPFPDYKPVNYTAPVVLANPVWADKDLMAMSPRPELPYNQMDHTCNVNRVSYNGTYVVKDGLPLNPMGRTGMQGRGLLGRFGPNHAADPVVTRWKRTSAGVMLQGGKKVLEFVAIQRKDNNQWAIPGGMVEPGQLVTQALKAEFGEEAMAK---LNVSQEEKERIAKQIERLFQ-----QGQEIYKGYVDDPRNTDNAWMETVAVNFHDDKGDLFGDITLQA--GDDAAAVRWQRV 1526          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 142.51 bits (358), Expect = 5.445e-34
Identity = 115/430 (26.74%), Postives = 206/430 (47.91%), Query Frame = 3
Query:  894 ENVEKPTNFFGEIEFSGLYKSK--PYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSD---FEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTD-AYGE------NQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKM--NFEKVPLCGILVSGNRDDLKLLHGSLVK-NGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYL--KMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLY 2132
              V  PT+ FGE+EF G  +     Y+R++ +T  E    LL  +W +  P L+IS+ G          IK +L++G+LK+A  + T  W+IT G  T ++  +G+A++  T  + GE      +Q++   I  W I +  E L +   +      Y   SS  ++    D NHSH+I VD   T+      I +R + EN        +A+ KM   F  VP+  +++ G  + ++ +  S+ +    P VI +GSG  A+I+      +   N +     ++++   L  K+  +      ++       + + +  R  + I+ V++    E+DK IL +LL    + ++        QL +A+  +R D+AK +IFTE +KW+   L     +++  ++V FV L ++ G  +   +TV+ LE LY
Sbjct:   11 HTVTLPTDAFGELEFQGAGQPSRAKYIRLAHDTDPELVLRLLCGEWALDLPKLLISVTGGAKNFILSPKIKRVLREGLLKAA--QTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVE---VVPYQMTSSMQSRGACLDNNHSHFILVD-NGTDGEYGGEISFRASLEN-------LIASKKMAQKFHGVPVVLLVLEGGPNTIRTVLESVSRCPAVPVVIAEGSGRAADILAFAHRFIAPSNGEMSGVADVVEHRQLLHKIEKSFAECSPEDRLSIYQNVLKCVAKREFVTIFCVDDGG-LEVDKAILRALLKSQHSQLED-------QLSLALVWDRADIAKTEIFTEDQKWEVPMLETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELY 419          

HSP 2 Score: 124.405 bits (311), Expect = 2.161e-28
Identity = 138/508 (27.17%), Postives = 244/508 (48.03%), Query Frame = 3
Query: 2457 SMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKS---LFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDS----------NTKKIPRKRNFTFQLK--TYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGI-IMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINF-EVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCP--DVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLII 3923
            S K      S +D LD  +++F   A G+++EC+K N    +  LI    Y+G  T L +A      +F+AH  CQ+ L  +W G L       N  + +++G++ P +I F + F+S   +  +P ++         +      R+   ++  D           N K    +     +++     K++  FYNAP+ KF   +  YL+F++ F+ + L    +    +   W+ I  +F   SL  EE RQ                 +I++ + SFF    +   +  L D     L F    +   + ++   LR    +Y   I L+ +R+L  FS++  LGP +VMI  M T D+  F+VI++  L++YG+   +I F   KP+  +      + ++F   YFQ++G L I+ +   +N R+ A +    P  D +G  L  +I A Y++++N+L+LNLL+AIF+NT+  +Q++S Q W  +R+ L+ +   RP + PP I+
Sbjct:  576 SAKEAAADASCRDMLD--SREFYDIALGLLDECYKANDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALK---TGYNGSLKVLLGILFPPLI-FALEFRSREEMQRVPTTDDDSADDLPPDFDPYHHREPGSAQYNDGYLGDGVAFVKNRKSSGNEEEPIVEIRLLGLGKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILI--ELPPVPSIEEWVLIGFVF---SLCAEEVRQV---------------RVINVWNFSFFESSDWASNVWNLCDGFAMVLFF----LAVGLRLNPGTLRIGHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRM-TIDMMYFLVIMVVFLLAYGVAQQAILFPHEKPSWEL------ITKIFFRPYFQVYGELFIEDVDYSSNSRETAFST---PKFDEYGGRLVTVIMAFYLLVANILLLNLLIAIFNNTFSEVQANSNQIWKFQRFSLVMEYRQRPRLVPPFIL 1043          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Nematostella
Match: EDO31558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXK7])

HSP 1 Score: 61.6178 bits (148), Expect = 6.322e-10
Identity = 51/210 (24.29%), Postives = 92/210 (43.81%), Query Frame = 3
Query: 4497 TAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIY----KSILQVLGIGT--TNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDV 5108
            T + P+ F + D   + +      + E  N +P+NP       G+ LL  WG N     +++RWK   +D++ +      K IL+ + I    T    +P  +V         L      E +     +E+++++ D       + F++ +N     +Y GY+ D RN+DN+W+ET A N H E    F +    +   DD+  + W  +
Sbjct:   60 TVDPPLLFNKLDKAYNVDRTSYTGMYEIKNNVPLNPFGRTGLEGRGLLGRWGPNHAADPVVTRWK---RDNKGNKVLQGGKPILEFVAIKRKDTGEWAIPGGMVDPGDTVSITLKKEFGEEAMNS---MEVSQEEKDKLHAQLTECFKTGHN-----IYSGYVDDPRNTDNAWMETHAVNYHDESGNTFNQ--FRLQAGDDAGAVAWTPI 256          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Nematostella
Match: EDO47659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT8])

HSP 1 Score: 56.6102 bits (135), Expect = 2.425e-8
Identity = 56/211 (26.54%), Postives = 88/211 (41.71%), Query Frame = 3
Query: 4446 WKSKFVDHLICRFVPIFTAEQP-------VEF--IEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSS-----SKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNN--SKYDKVYEGYLKDFRNSDNSWIETSAFNIHLE 5030
            W+  F  +    +     A QP       +EF  I+DD  + ++ +   DL +   G+P NP      IG+ LL  WG N     +++RWK       N      L + G        L F+ +Q +   E  +          + + ++  F E      +      EK    L+   S+  +VY+GY+ D RN+DN+WIET A N H E
Sbjct:   27 WQMPFPGYFPDTYSDPSVAAQPPWADIDLLEFNSIDDDGVDRRSHMGVYDLFD---GLPRNPMGRTGLIGRGLLGRWGPNHAADPIVTRWK------RNPDTGQPLVLAGKRV-----LEFVAIQRSDTKEWAIPGGMMEVGDTISKTLKKEFFEEALCSLEESEEEREKMEAKLHTFFSQGIEVYKGYVDDPRNTDNAWIETVALNFHDE 223          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Nematostella
Match: EDO43577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY53])

HSP 1 Score: 54.299 bits (129), Expect = 5.478e-7
Identity = 31/104 (29.81%), Postives = 61/104 (58.65%), Query Frame = 3
Query:  372 NLLHYAALYRATRIVRVLLSSQFNYPV---DSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCII-LTSDGNYDLQLQDENE 671
            +L+HYAA+Y   +I+ +L+   F+  V   ++++ +G+TPLH++A  G   ++  L+++ A+ + +D  G   +HYA   N   C++ L       +QLQ ++E
Sbjct:  461 SLIHYAAMYNRPQIITMLMVMGFDINVRRFNNISSQGVTPLHLAARCGALESLACLISYKADVSSIDSHGWSPVHYAAYFNHVDCLLHLIHKDTKLVQLQSKDE 564          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 288.886 bits (738), Expect = 1.240e-78
Identity = 371/1544 (24.03%), Postives = 659/1544 (42.68%), Query Frame = 3
Query:  738 DKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHH-SVFEKYDFV-DTEN-----VEKPTNFFGEIEFSGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS----DFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYG-ENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGE------------LVYEMKEK--NRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKII-TVELLENLY------------------TADI--SNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRE---------LFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQ------AFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNL-----MCP-------DVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQK-QPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKLWKSKFVDHLICR----------FVPI----------FTAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIP--INPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQH 5075
            ++  L+ W+ QNI + EC ++  +  S   C+CG +   H+    +  DFV +T N     ++ PTN FGEI+F GL ++   Y R+S  T  E    LL +QW +  P+L+IS+ G     + + H ++++  +G++K A  + T  WIIT G    +++ +G+A+RD++ +   + Q+    +  W + +  E L ++  +G  PA Y    +   +    D+NH+H++ VD   T       I+ R   E  +S       ++ +    +P+  +++ G    L  +  ++ KNG P VI +G+G +A++I +            L++++ EK   ++ K F E+   E+ K I   +                     HL+ I+ V E++  ++D  IL +LL    +S          QL +A++ NR D+AK +IFTE   W + DL      ++  NK  FV L +E G  L K +   E L NLY                   AD+  SN   L  + ++   L+G    N    +Y                     +   + S N    RP  E         +F+W++L    ++A++ W   ++SI AAL A  +L+ +    +   + +++   A  +E  A GV  EC+  + E     L+   +++G +T L +A      +F+A    Q  +  VW G L       N I+ ++   IC    P I  +         E+ + + K +   K   R    +    S     P K        + + ++   Y +P +KF + I  Y  F+  F  + +  +H   S        +LL  W  SL+ EE RQ       FG  I  K Y+ D+WNI+D+LS                  ++  LL   F +T        L    K +      +F +R++  F+I+  LGP I+++R M+  DL  F+ +L   +V+YG+    I       L    F   +YE +L     +FGN   ++   + +L  C+ N        CP        V+  WL   +  VY++ +N+L+LNLL+AIF+ T++ +Q ++ + W  +RY+L+++  SRP   PP IIF  +  +   +   K   K +  K    ++     +L+ WE +  + Y+ S  ++  + R+   LI++     + SI    +  E + + ++             L+++  +EE VN    +L+       + + +K + K E         E +S L N                K KF  H+ CR            P+          F++ QP  +  +D           D I+  +G     NP       G+  L  +G N  + L+++RWK        D  +S L+ L I  ++  +  F +     +C+ +L  + K   +  + +  IN K ++ K                 K+ + Y+ D RN+DN+W+ET+  NIHL+   +    I   ++H
Sbjct:   26 ERCALSCWMKQNINKKEC-ALFQKGPSEEICKCGYSKEAHNVEAIKPEDFVGETWNKHRHVLDVPTNAFGEIQFDGLQQTTAKYARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLKPH-LRNMFHRGLIKVA--QTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALINE--EGCFPALYMTDKTSQGRLSCLDKNHTHFLLVD-DGTHGHYGVEIELRTCLEKCISGKQLGKKDSSVT---IPVVCVVLEGGPGTLNTIFNAM-KNGTPCVIFEGTGRIADVIAQVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIVRMS------------------HLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLG----NATRHIYP--------PYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVD----NHILRVL---ICMLFFPLI--YTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQS-LGSAPDKP------LSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVPE-----LLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLS------------------ILLFLLGLAFRLTS------ELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMM-KDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWI-FRGAIYEPYLI----IFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRSIWLCKSHCKSKDLKDQTEAM-----ELLSWEALMKDRYLLSVKQE--TSRSTDRLILDTA-QKVTSISERLEREEESVSAVV-------------LKRLTRLEEQVNQSAIMLQW------IMDSLKSTAKEEKPDTSNAADESSSCLRNESAS------------KDKF--HVNCRQYYYPSSKVTRFPVPDEKVPWQVSFSSYQPSCYTSEDGN---------DCIDGQDGADKFRNPGGRTGVRGRGALSHFGPNLHLDLVLTRWK--------DGERSALEYLAICDSS--QSIFTLPSGPVDCDDHLPENLK-TTLGNELYRTINAKVSEGK-----------------KLPKCYVDDSRNTDNAWVETTVLNIHLDRTSQVMVDINPQVRH 1399          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 271.937 bits (694), Expect = 2.350e-73
Identity = 301/1202 (25.04%), Postives = 529/1202 (44.01%), Query Frame = 3
Query:  738 DKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHH-SVFEKYDFV-DTEN-----VEKPTNFFGEIEFSGLYKSKP-YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS----DFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYG-ENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGE------------LVYEMKEK--NRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKII-TVELLENLY------------------TADI--SNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRE---------LFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQ------AFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNL-----MCP-------DVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQK-QPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTL 4115
            ++  L+ W+ QNI + EC ++  +  S   C+CG +   H+    +  DFV +T N     ++ PTN FGEI+F GL ++   Y R+S  T  E    LL +QW +  P+L+IS+ G     + + H ++++  +G++K A  + T  WIIT G    +++ +G+A+RD++ +   + Q+    +  W + +  E L ++  +G  PA Y    +   +    D+NH+H++ VD   T       I+ R   E  +S         K +   +P+  +++ G    L  +  ++ KNG P VI +G+G +A++I +            L++++ EK   ++ K F E+   E+ K I   +                     HL+ I+ V E++  ++D  IL +LL    +S          QL +A++ NR D+AK +IFTE   W + DL      ++  NK  FV L +E G  L K +   E L NLY                   AD+  SN   L  + ++   L+G    N    +Y                     +   + S N    RP  E         +F+W++L    ++A++ W   ++SI AAL A  +L+ +    +   + +++   A  +E  A GV  EC+  + E     L+   +++G +T L +A      +F+A    Q  +  VW G L       N I+ ++   IC    P I  +         E+ + + K +   K   R    +    S     P K        + + ++   Y +P +KF + I  Y  F+  F  + +  +H   S        +LL  W  SL+ EE RQ       FG  I  K Y+ D+WNI+D+LS                  ++  LL   F +T        L    K +      +F +R++  F+I+  LGP I+++R M+  DL  F+ +L   +V+YG+    I       L    F   +YE +L     +FGN   ++   + +L  C+ N        CP        V+  WL   +  VY++ +N+L+LNLL+AIF+ T++ +Q ++ + W  +RY+L+++  SRP   PP IIF  +  +   +   K   K +  K    ++     +L+ WE +  + Y+ S  +++    ++  L
Sbjct:   26 ERCALSCWMKQNINKKEC-ALFQKGPSEEICKCGYSKEAHNVEAIKPEDFVGETWNKHRHVLDVPTNAFGEIQFDGLQQTTAKYARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLKPH-LRNMFHRGLIKVA--QTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALINE--EGCFPALYMTDKTSQGRLSCLDKNHTHFLLVD-DGTHGHYGVEIELRTCLEKCISGKQ---LGKKDSSVTIPVVCVVLEGGPGTLNTIFNAM-KNGTPCVIFEGTGRIADVIAQVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIVRMS------------------HLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLG----NATRHIYP--------PYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVD----NHILRVL---ICMLFFPLI--YTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQS-LGSAPDKP------LSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVPE-----LLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLS------------------ILLFLLGLAFRLTS------ELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMM-KDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWI-FRGAIYEPYLI----IFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRSIWLCKSHCKSKDLKDQTEAM-----ELLSWEALMKDRYLLSVKQETSRSTDRLIL 1130          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 268.47 bits (685), Expect = 4.790e-72
Identity = 294/1154 (25.48%), Postives = 530/1154 (45.93%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK--------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN----KRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-------NLPLKR---------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPF--IVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKK----------DSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  II   +   +C CG+ +  H  +         +  E+                    PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  KD     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         KK N     R+SL DIG V++YL+G  Y   Y    F+  + +       ++P++R                           P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  +++F   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I      N   + Y+P+ +    ++K + + +   ++  E + +          D++ KK   +     +L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    +  S     WI I  IF      IE+ R+   S        +K +L + WNI D+++    L+ + G+++ L +P             P +S       + + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I   + PN   S   M+   +F   Y+ ++G +   +ID   G+N          +     G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  I  V   L
Sbjct:   46 WIERAFSKRECVHIIVSAKDPHRCCCGRLIGQHVGLPPGISSSQNDKAERMAKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLVGKDV--VRP--YQTMSNPLSKLTVLNSLHSHFILAD-NGTTGKYGAEVRLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GIINESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNTLYHLVRD------VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQDQEAYLQEKEEEEPEKPVKEKEEEDMEFTAMLGKVATDTSRKKDVEEVQSRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQE--WIVIAYIFTNG---IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMA---ILIFSVGMVLRLQEP-------------PFMS-------YGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAI---LNPNEDPS--WMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHL 1133          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 263.077 bits (671), Expect = 2.461e-70
Identity = 296/1176 (25.17%), Postives = 529/1176 (44.98%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK--------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN----KRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR---------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPF--IVNFKSLFYLPESE------------IVEYKKKLKNKQKISTRQCSESE----------KKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNL---RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  II   +   +C CG+ +  H  +         +  E+                    PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  KD     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         KK N     R+SL DIG V++YL+G  Y   Y    F+  + +                 ++P++R                           P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  +++F   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I      N   + Y+P+ +                K+K +   + + R   E++            D++ KK   +     +L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    +  S     WI I  IF      IE+ R+   S        +K +L + WNI D+++    L+ + G+++ L +P             P +S       + + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I   + PN   S   M+   +F   Y+ ++G +   +ID   G+N          +     G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  I  V   L
Sbjct:   24 WIERAFSKRECVHIIVSAKDPHRCCCGRLIGQHVGLPPGISSSQNDKAERMAKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLVGKDV--VRP--YQTMSNPLSKLTVLNSLHSHFILAD-NGTTGKYGAEVRLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GIINESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNTLYHLVRD------VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQDQEAYLQEKEEEEPEKPVKEKEEEDMEFTVRSYCETQYNSVAMLGKVATDTSRKKDVEEVQSRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQE--WIVIAYIFTNG---IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMA---ILIFSVGMVLRLQEP-------------PFMS-------YGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAI---LNPNEDPS--WMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHL 1133          
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 257.684 bits (657), Expect = 1.075e-68
Identity = 303/1219 (24.86%), Postives = 537/1219 (44.05%), Query Frame = 3
Query:  759 WIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEK--------------------PTNFFGEIEFSGLYKSKP--YVRMSINTKFETTASLLIDQWKITKPSLIISIYGS--DFEGHA-IKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGK-PTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN----KRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSS-----------------NLPLKR---------------------------PYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLT---NVISD-KDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPF--IVNFKSLFYLPESE------------IVEYKKKLKNKQKISTRQCSESE----------KKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGIS-----IKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNL---RIDVLRG--------------ENNLR--------------QCANNNLMC--------------PDV-WGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARL 3956
            WI +   + EC  II   +   +C CG+ +  H  +         +  E+                    PT+ FG IEF G   S    YVR+S +TK +    L+  +W++  P L+IS++G   +FE    +K +  KG++K+A    T  WI T G+ T +I  +G A++D   +    ++    I PW I    E L  KD     P  Y  +S+  +K    +  HSH+I  D   T     + +  R   E  +S L +   NT++  + VP+  ++V G  + + ++   L      P V+  GSG  ++I+    ++  E+        E ++ + L  I         + +   I++ E ++ + LI ++ +      ++D  IL++LL     S   PD     QL +A++ NR D+A+ +IF  G++W    L      ++  ++V FVKL +E G  + + +T+  LE LY         L  ++         KK N     R+SL DIG V++YL+G  Y   Y    F+  + +                 ++P++R                           P+ EL +W++L  R +MA   W   +E++A AL A  L ++M +     +++ D   +L+  +++F   A  ++++ +K++ +     L  +L  +  +T L++A       FIAH   Q LL  +W G L       N  + +I+G++ P  I      N   + Y+P+ +                K+K +   + + R   E++            D++ KK   +     +L    +K+Y+FYNAP++KF +    Y+ +++ F ++ L    +  S     WI I  IF      IE+ R+   S        +K +L + WNI D+++    L+ + G+++ L +P             P +S       + + +Y  +I  + +R+L  F +N  LGP ++MI  M+  D+  F++I+L VL+S+G+   +I   + PN   S   M+   +F   Y+ ++G +   +ID +                EN+LR              QC+ N   C              P    G W+ P I A Y++++N+L++NLL+A+F+NT+  ++S S Q W  +RYQL+     RP + PPLIIF  I  V   L
Sbjct:   24 WIERAFSKRECVHIIVSAKDPHRCCCGRLIGQHVGLPPGISSSQNDKAERMAKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT--TGAWIFTGGVNTGVIRHVGDALKDHA-SKSRGKICTIGIAPWGIVENQEDLVGKDV--VRP--YQTMSNPLSKLTVLNSLHSHFILAD-NGTTGKYGAEVRLRRQLEKHIS-LQKI--NTRIG-QGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILA-FGHKYSEEG---GIINESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA--PD-----QLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNTLYHLVRD------VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRL---RMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQDQEAYLQEKEEEEPEKPVKEKEEEDMEFTVRSYCETQYNSVAMLGKVATDTSRKKDVEEVQSRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQE--WIVIAYIFTNG---IEKMREILMSEPGKLLQKVKVWLQEYWNITDLMA---ILIFSVGMVLRLQEP-------------PFMS-------YGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAI---LNPNEDPS--WMLARNIFFMPYWMIYGEVFADQIDHMHSRKFQQRLIEKVWLVENSLRTHGPWRSNGPSRFPQCSQNPTPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHL 1176          
BLAST of Transient receptor potential cation channel,putative vs. Planmine SMEST
Match: SMESG000041546.1 (SMESG000041546.1)

HSP 1 Score: 3241.83 bits (8404), Expect = 0.000e+0
Identity = 1700/1711 (99.36%), Postives = 1704/1711 (99.59%), Query Frame = 3
Query:   51 MSTKNKVYPTETNDEFETRILSPNSMIMQVFDSSSTVXXXXXXXXXXXXXXXNRQLEKILKSVEKWDLKEFLSIYEFENLSPDSLFDYKLEETLKVSSNFLSYLDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCIILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKLWKSKFVDHLICRFVPIFTAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDVDKSHWTNPSNIILLSFLSNFHGFEF 5183
            MSTKNKVYPTETNDEFETRILSPNSMIMQVFDSSSTVKNEEKEEQIKKNS SNRQLEKILKSVEKWDLKEFLSIYEFENLSPDSLFDYKLEETLKVSSNFLSYLDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCIILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSK TKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTEIWEISDEYEEEVIMIQEIIENRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVLKYLLGDLYYPLYLNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSYTIFFYLIFILYFTFLNLTAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPL KSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAVYMVLSNVLMLNLLVAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSF+ERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPG+VKKT+KLWKSKF DHLICRFVPIFTAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIP NPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGI TTNHIELPFIIVQHN ECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSW+ETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDVDKSHWTNPSNIILLSFLSNFHGFEF
Sbjct:    1 MSTKNKVYPTETNDEFETRILSPNSMIMQVFDSSSTVKNEEKEEQIKKNSHSNRQLEKILKSVEKWDLKEFLSIYEFENLSPDSLFDYKLEETLKVSSNFLSYLDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCIILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKDTKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTEIWEISDEYEEEVIMIQEIIENRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVLKYLLGDLYYPLYLNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSYTIFFYLIFILYFTFLNLTAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLAKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAVYMVLSNVLMLNLLVAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFSERISIVEFRLQKMDIIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLENTDYLPPGVVKKTIKLWKSKFADHLICRFVPIFTAEQPVEFIEDDSKESQNEVLTEDLIEFPNGIPRNPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIYKSILQVLGIRTTNHIELPFIIVQHNAECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWLETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDVDKSHWTNPSNIILLSFLSNFHGFEF 1711          
BLAST of Transient receptor potential cation channel,putative vs. Planmine SMEST
Match: SMESG000041545.1 (SMESG000041545.1)

HSP 1 Score: 1817.74 bits (4707), Expect = 0.000e+0
Identity = 971/1667 (58.25%), Postives = 1246/1667 (74.75%), Query Frame = 3
Query:  222 KILKSVEKWDLKEFLSIYEFENLSPDSLFDYKLEETLK--VSSNFLSYLDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCIILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVDIPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXNRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNNKRVSLYDIGGVXXXXXXXXXXXXXXNPEFQETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNF---TFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFARLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLG-PNLPLNNEIKISKKN-ELMIEPAKKIEVTSMLENTDYLPPGIVKKTLKLWKSKFVDHLICRFVPIFTAE--QPVEFIEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIY----KSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDVDKSHWTNPSNIILLSFLSNFHGFEF 5183
            +I+K++E W+ KE LS+  F+ ++   +F+  L ETL   +S NF   L++CN LHYAAL+RAT+ ++  LS +F++ ++S+TKEG+T LHISA+VGDFYTV+ LL +GAN N LD+K R ALHYAV SN+ETCI+LT D N D Q +DE E SPL+Y K+ +   I  Y+E L  K+   W+PQ+ CQ EC  I P+K +L QCECGQN+ DH+SVF++YD    E VE PTN +G+IEFS LYKS+PY+R S  T+F+    LLIDQWKI  PSLIIS YGS+FEGHAIK+ILKKGILKSAGN  TFVWIIT+GI +NLI+VI +A+RDFTDAYGE+Q+Y  +ITPW   N +++LCS++YQG H  E+     +   +   DQNHSHY+FVDIPR ++  +S+I +RL FEN VS L+ +L   K    KVP+CGIL+SG R+DL+LLHGSLVKN KP+VIIK SGG+AN+I  L+ E+ EKNRKK++ EE+M KE LK +MTE+W ++ E+EEE+I+I+EIIENRHLIEI+S++E+  NELDK ILSSLLSQD+N     + LNI QL ++ISINRHDVA+EKIFTEGKKWKTEDL+PLA+K +S+NKV F+K+F+EKGFFL KIITVE LE LYT+D+ NG K  RIL+Q LRL  FKK+N RVSLYDIG VLKY+LGD Y+PLYL   FQ T + NL L RPYRELFIWSLLT RME+A+LLWTLE ESIAAALFAANLLR M NLT+VISD++DLD+WA  FE KAEGVVEECFKENPE+TR+NL+R L+YYG +TYLE+AADGNSIKFIAHRSCQELLDFVWR TLD TTKS  FI YL +G+ CP ++P++V +K  FY P +E    K +  N+ + ++    E +      + I   + F   +F LK YFKK++DFY  PVIKFSYTIFFY+IF+ YF F+NLTA+H++  K S +W YILLI WTVSL +EE RQAFGSGIS K Y++D+WNIIDILS  FF+ GTF I MT+ DP+VK +LFSLFDITPM++IS+ L RFSKFMYGFS+F+F+VRILQYFSIN+ +GPIIVMI+NML+NDLGPF+ IL+TVL+SYGILL SINFEVK  LT+S+  ++LYEMF T YFQLFG+LRI++LR E+   QC  + LMCPDVWG+WLGP++ A+YMV+SN LMLN+L+AIFSNTYEIIQSS+TQYWT+ERY LMRQSSSRPPVAPPL+I WQIYFVFA L + K+ Q  PFK SY  +P+KEKQLIQWE +RA DY+RS D+ SK+ R +TTL+VNRG  +IGS G MKKD E+ + EI ++  E++  VE RLQ+++ I+ NVN I D+LR L    L  N++ +I K N ++  +P  K+       ++    P +  K  KLW  + V+H+I RFVPI        VEFI ++  + Q +   +D       IP+NPH+TLNKIGK LLPFWGVN+CIH++ISRWK   +D   +I     K +LQVLGI      E+PF  V+HN+ C    CS   L+ II+ Y  E + K  D K+ + E +  +LN +   +++ G++ DFRN+DNSWIET+AFNIH   N EF+   + +L+H   E + W+DV K +W+NPS + LL  LS +H  +F
Sbjct:   56 EIIKAIENWNAKEILSVNSFKQINEYEVFNVNLLETLNFNLSPNFWKSLNDCNYLHYAALFRATQTIQAFLSDKFSFQINSVTKEGVTALHISASVGDFYTVQYLLANGANINSLDKKSRSALHYAVFSNIETCILLTKDENKDYQHKDEEENSPLEYAKLSNNSQIIDYVEHLVNKESTFWVPQHFCQLECERITPKKANLTQCECGQNIYDHYSVFDRYDLYGKEFVEIPTNCYGDIEFSNLYKSRPYIRFSKKTEFKFLFQLLIDQWKIENPSLIISAYGSEFEGHAIKEILKKGILKSAGNEGTFVWIITNGISSNLIQVISEAVRDFTDAYGEDQIYAISITPWGACNFSDFLCSRNYQGNHLGEFQGNVLEKFHTDVLDQNHSHYLFVDIPREDNQNESYIKFRLEFENAVSDLHSYLETDKRTATKVPICGILISGTREDLRLLHGSLVKNCKPSVIIKDSGGVANLISFLLDEISEKNRKKRTIEEVMNKEKLKSLMTEVWNVTSEFEEEIILIKEIIENRHLIEIFSLKEDMKNELDKKILSSLLSQDQNQDDAFNQLNIPQLNISISINRHDVAREKIFTEGKKWKTEDLMPLASKCVSDNKVEFIKIFIEKGFFLAKIITVEYLEYLYTSDVFNGYKSLRILHQVLRLTKFKKSNNRVSLYDIGAVLKYMLGDFYFPLYLKSSFQSTLNENLELTRPYRELFIWSLLTQRMELAELLWTLETESIAAALFAANLLRCMINLTDVISDREDLDKWAGIFENKAEGVVEECFKENPEYTRENLVRVLEYYGETTYLELAADGNSIKFIAHRSCQELLDFVWRNTLDSTTKSFQFIYYLFLGMTCPLILPWVVQYKQKFYQPINE--NDKGETLNENEKNSMLIGEIDDSTLFERNINSPKTFKFSSFHLKMYFKKIFDFYATPVIKFSYTIFFYVIFVFYFAFMNLTAFHVQNLKTSYVWTYILLIIWTVSLGLEEIRQAFGSGISFKAYISDLWNIIDILSQFFFIFGTFAIGMTMCDPIVKYILFSLFDITPMLAISITLFRFSKFMYGFSLFMFSVRILQYFSINIHMGPIIVMIQNMLSNDLGPFMAILMTVLISYGILLWSINFEVKDELTVSDLPIVLYEMFRTIYFQLFGDLRIEILRNESQYTQCTTSQLMCPDVWGIWLGPVLTAIYMVISNALMLNVLIAIFSNTYEIIQSSATQYWTMERYNLMRQSSSRPPVAPPLLIIWQIYFVFATLFSFKIEQTNPFKTSYGDVPFKEKQLIQWEHLRAIDYMRSQDDVSKNSRKQTTLVVNRGAPSIGSFGSMKKDLETLRTEIRENVKEKLVFVESRLQRLEAIDINVNAILDLLRNLDFTQLFENSKEEIRKDNSKISTDPVAKV-------SSSITQPDMSGKISKLWHCEIVNHVILRFVPIICLHSLSKVEFISENDNDEQPQNWLKDNANKSVMIPVNPHQTLNKIGKQLLPFWGVNNCIHIIISRWK---RDVRGNIIKLFNKPVLQVLGITQKTFTEIPFFFVRHNSSCLLESCSMDLLKGIIKHYINERSAKNTDRKS-MKENDISALNAATVYEIFRGFIYDFRNTDNSWIETAAFNIHQIYNCEFSNEFIKVLEHHQLEKMMWIDVIKENWSNPSCVTLLGELSKYHNSDF 1709          
BLAST of Transient receptor potential cation channel,putative vs. Planmine SMEST
Match: SMESG000078720.1 (SMESG000078720.1)

HSP 1 Score: 323.939 bits (829), Expect = 3.681e-89
Identity = 229/710 (32.25%), Postives = 388/710 (54.65%), Query Frame = 3
Query: 2322 LPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLP----ESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLT-------MSEF------SMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNL-MCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFA----RLIT---IKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTL----IVNRGPAAIGSIGGM--------KKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNL----PLNNEI 4328
            + L+RP REL IWSLL  +++MA+L W +EKE IA AL A+ LL S+ N ++  +DK+D   ++K FE++AEGV+ EC+ E+ +  +  + ++L YYG+S+ + +AA G SIKF+AH  CQ+ L   W G L     +M  +  + +G+I PF+IP I+++K    +P    +S+  +  + +    K      + S    SNT    + + F  +LK YFK++  FY +PVI+F Y    YL F+L F+   L  + +++     +   I+L FW  +LL+EE +QA  SGIS   Y +D WN +D  + + F++   G I+ L          S  +    + ++ +L   S+   G S+F F VR++  FS ++ LGP ++MIR M++NDL PF++IL   ++ YG+   +  + +    T        S+F      SMI+  + +  Y+ +FG   +D L+G +    C++ +L   P      L P+   ++++L+NVL+ NLL+A+F+ TYE I+SSS  YW  +RYQ++ +  ++ P+ PP II W  Y +++    +L T    K     PF I++S    KE++L++WE M+A DY+R  +E ++  R         +V RG  + G+            K DF S   EI     +R   V+ +L K++ +E  + +  + ++++G +L     +NNE+
Sbjct: 1006 ISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFK-RLK-YFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEF-----VCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVI---GFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIM-TILMKSYYPMFGEFGLDSLQGIS--PSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNEL 1702          

HSP 2 Score: 239.965 bits (611), Expect = 3.390e-63
Identity = 193/666 (28.98%), Postives = 323/666 (48.50%), Query Frame = 3
Query:  366 NCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNV-ETCIILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQC-ECGQNVADH-----------------------------HSVFEKYDFV------------DTENVEK----PTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEG-HAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKAT----------KSQKFDQNHSHYIFVDIP-RTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFE-----KVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKS--FEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXN-----RHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISN 2150
            N   LH AA Y    IV +LL    NY + +  ++  + LH++    +   V  LL      N  D+ G   +H A   N+ E  ++L  D N   +  D   +   +  +   K  IA +L    K K + W P NI  F C    P   + + C  C  N+  H                             H  FE    +            D E + K    PTN FGEIEF+GL +S  +VR+  +T      ++L  +W++  P+L+ISI+G DFE    +K I+KKG+ K+A       WIIT+G+   ++++ G+A+RD+TDAYG N+M    I PW++  + + L +  YQGT+PA Y       T          K +  D NHS++   D P  +++  +  + +R  FE+ +S    F  +   ++E     +VP+CG++V G+   L+ +  S+++N  P V+ +GS G A+++   +   ++ + ++ S  FE +  +  L+ I+ E     +   ++       ++       +L+ ++ +EE+   +LD  I+SSLL+   + +   + LN+ QL + +++NR D+AKEKIF E KKWK  DL      ++  ++  FVKLF+E+GF L + +TV +LE LYT  + N
Sbjct:   73 NATGLHLAAYYGWHYIVDLLLVHSANYKLQTECEK--SALHLACKQPNPLVVSILLETDLPVNKPDKYGITPIHSASEQNLTEVILLLQKDAN--PRSTDCAGRDAYERARAARKEEIAFFLGNFYKNKDSYWFPLNIQIFVCG--FPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAA--ESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSIS----FWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSAASDLTQ-NQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKN 723          

HSP 3 Score: 53.5286 bits (127), Expect = 1.999e-6
Identity = 33/121 (27.27%), Postives = 58/121 (47.93%), Query Frame = 3
Query: 4494 FTAEQPVEF------IEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIY---KSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSS 4829
            F A+ PV +       ++ +K  +  +L +  ++     P NP       G+ LLP WG N  I +L +RW     +  + I+   K ++Q + +   N   +P+ +V HN+ CE N CS+
Sbjct: 1865 FDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWN--RTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSN 1983          
BLAST of Transient receptor potential cation channel,putative vs. Planmine SMEST
Match: SMESG000078720.1 (SMESG000078720.1)

HSP 1 Score: 323.939 bits (829), Expect = 3.871e-89
Identity = 229/710 (32.25%), Postives = 388/710 (54.65%), Query Frame = 3
Query: 2322 LPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLP----ESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLT-------MSEF------SMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNL-MCPDVWGVWLGPIIAAXXXXXXXXXXXXXXXAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFA----RLIT---IKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTL----IVNRGPAAIGSIGGM--------KKDFESTKNEILQSFTERISIVEFRLQKMDIIEENVNTIYDILRKLGPNL----PLNNEI 4328
            + L+RP REL IWSLL  +++MA+L W +EKE IA AL A+ LL S+ N ++  +DK+D   ++K FE++AEGV+ EC+ E+ +  +  + ++L YYG+S+ + +AA G SIKF+AH  CQ+ L   W G L     +M  +  + +G+I PF+IP I+++K    +P    +S+  +  + +    K      + S    SNT    + + F  +LK YFK++  FY +PVI+F Y    YL F+L F+   L  + +++     +   I+L FW  +LL+EE +QA  SGIS   Y +D WN +D  + + F++   G I+ L          S  +    + ++ +L   S+   G S+F F VR++  FS ++ LGP ++MIR M++NDL PF++IL   ++ YG+   +  + +    T        S+F      SMI+  + +  Y+ +FG   +D L+G +    C++ +L   P      L P+   ++++L+NVL+ NLL+A+F+ TYE I+SSS  YW  +RYQ++ +  ++ P+ PP II W  Y +++    +L T    K     PF I++S    KE++L++WE M+A DY+R  +E ++  R         +V RG  + G+            K DF S   EI     +R   V+ +L K++ +E  + +  + ++++G +L     +NNE+
Sbjct: 1006 ISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFK-RLK-YFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEF-----VCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVI---GFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIM-TILMKSYYPMFGEFGLDSLQGIS--PSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNEL 1702          

HSP 2 Score: 239.58 bits (610), Expect = 3.906e-63
Identity = 193/666 (28.98%), Postives = 323/666 (48.50%), Query Frame = 3
Query:  366 NCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNV-ETCIILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQC-ECGQNVADH-----------------------------HSVFEKYDFV------------DTENVEK----PTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEG-HAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKAT----------KSQKFDQNHSHYIFVDIP-RTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFE-----KVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKS--FEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXN-----RHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISN 2150
            N   LH AA Y    IV +LL    NY + +  ++  + LH++    +   V  LL      N  D+ G   +H A   N+ E  ++L  D N   +  D   +   +  +   K  IA +L    K K + W P NI  F C    P   + + C  C  N+  H                             H  FE    +            D E + K    PTN FGEIEF+GL +S  +VR+  +T      ++L  +W++  P+L+ISI+G DFE    +K I+KKG+ K+A       WIIT+G+   ++++ G+A+RD+TDAYG N+M    I PW++  + + L +  YQGT+PA Y       T          K +  D NHS++   D P  +++  +  + +R  FE+ +S    F  +   ++E     +VP+CG++V G+   L+ +  S+++N  P V+ +GS G A+++   +   ++ + ++ S  FE +  +  L+ I+ E     +   ++       ++       +L+ ++ +EE+   +LD  I+SSLL+   + +   + LN+ QL + +++NR D+AKEKIF E KKWK  DL      ++  ++  FVKLF+E+GF L + +TV +LE LYT  + N
Sbjct:   73 NATGLHLAAYYGWHYIVDLLLVHSANYKLQTECEK--SALHLACKQPNPLVVSILLETDLPVNKPDKYGITPIHSASEQNLTEVILLLQKDAN--PRSTDCAGRDAYERARAARKEEIAFFLGNFYKNKDSYWFPLNIQIFVCG--FPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAA--ESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSIS----FWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSAASDLTQ-NQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKN 723          

HSP 3 Score: 85.5001 bits (210), Expect = 3.829e-16
Identity = 66/245 (26.94%), Postives = 112/245 (45.71%), Query Frame = 3
Query: 4494 FTAEQPVEF------IEDDSKESQNEVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIY---KSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYD------------KVYEGYLKDFRNSDNSWIETSAFNIHLEDNLEFTKPILHMLQHDDS-ETLCWVDVDKSHWTNPSNIILLSFLS 5162
            F A+ PV +       ++ +K  +  +L +  ++     P NP       G+ LLP WG N  I +L +RW     +  + I+   K ++Q + +   N   +P+ +V HN+ CE N CS               NK      TFL+++   S +  KY+            ++++G+L D  N+DN+W+ET   N H  D   FT  IL +    +S ET+ W+D+  S     S+ ++L  +S
Sbjct: 1864 FDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWN--RTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECS---------------NKTAI---TFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILKIFVEINSPETVKWMDLAHSVNLRTSHDMILKTIS 2088          
BLAST of Transient receptor potential cation channel,putative vs. Planmine SMEST
Match: SMESG000078720.1 (SMESG000078720.1)

HSP 1 Score: 236.884 bits (603), Expect = 8.544e-63
Identity = 202/701 (28.82%), Postives = 336/701 (47.93%), Query Frame = 3
Query:  366 NCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAAVGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNV-ETCIILTSDGNYDLQLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSIIPRKESLIQC-ECGQNVADH-----------------------------HSVFEKYDFV------------DTENVEK----PTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEG-HAIKDILKKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKAT----------KSQKFDQNHSHYIFVDIP-RTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFE-----KVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKS--FEEIMQKEYLKMIMTXXXXXXXXXXXXXXXXXXXXXN-----RHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN---KRVSLYDIGGV 2246
            N   LH AA Y    IV +LL    NY + +  ++  + LH++    +   V  LL      N  D+ G   +H A   N+ E  ++L  D N   +  D   +   +  +   K  IA +L    K K + W P NI  F C    P   + + C  C  N+  H                             H  FE    +            D E + K    PTN FGEIEF+GL +S  +VR+  +T      ++L  +W++  P+L+ISI+G DFE    +K I+KKG+ K+A       WIIT+G+   ++++ G+A+RD+TDAYG N+M    I PW++  + + L +  YQGT+PA Y       T          K +  D NHS++   D P  +++  +  + +R  FE+ +S    F  +   ++E     +VP+CG++V G+   L+ +  S+++N  P V+ +GS G A+++   +   ++ + ++ S  FE +  +  L+ I+ E     +   ++       ++       +L+ ++ +EE+   +LD  I+SSLL+   + +   + LN+ QL + +++NR D+AKEKIF E KKWK  DL      ++  ++  FVKLF+E+GF L + +TV +LE LYT  + N      I +   RL    K +   K V L ++G V
Sbjct:   73 NATGLHLAAYYGWHYIVDLLLVHSANYKLQTECEK--SALHLACKQPNPLVVSILLETDLPVNKPDKYGITPIHSASEQNLTEVILLLQKDAN--PRSTDCAGRDAYERARAARKEEIAFFLGNFYKNKDSYWFPLNIQIFVCG--FPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAA--ESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSIS----FWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSAASDLTQ-NQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFH---RLWDNHKTHRLVKNVKLREVGKV 755          

HSP 2 Score: 165.236 bits (417), Expect = 1.361e-40
Identity = 104/287 (36.24%), Postives = 169/287 (58.89%), Query Frame = 3
Query: 2322 LPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLP----ESEIVEYKKKLKNKQKISTRQCSESEKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSXXXXXXXXXXXXXXXXXXXAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQ 3170
            + L+RP REL IWSLL  +++MA+L W +EKE IA AL A+ LL S+ N ++  +DK+D   ++K FE++AEGV+ EC+ E+ +  +  + ++L YYG+S+ + +AA G SIKF+AH  CQ+ L   W G L     +M  +  + +G+I PF+IP I+++K    +P    +S+  +  + +    K      + S    SNT    + + F  +LK YFK++  FY +PVI+F Y    YL F+L F+   L  + +++     +   I+L FW  +LL+EE +Q
Sbjct:  959 ISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFK-RLK-YFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEF-----VCEEIILTFWIGTLLLEEIKQ 1238          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM32.980e-7825.90transient receptor potential cation channel subfam... [more]
TRPM34.669e-7825.47transient receptor potential cation channel subfam... [more]
TRPM31.420e-7625.56transient receptor potential cation channel subfam... [more]
TRPM31.371e-7126.05transient receptor potential cation channel subfam... [more]
TRPM33.234e-7025.81transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-23.568e-5423.56Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gtl-13.112e-3024.70GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
gon-24.275e-2723.20Transient receptor potential channel [Source:UniP... [more]
gon-24.615e-2723.20Transient receptor potential channel [Source:UniP... [more]
gon-25.383e-2723.20Transient receptor potential channel [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm7.191e-6525.04gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm2.275e-6424.39gene:FBgn0265194 transcript:FBtr0339075[more]
Trpm3.737e-6324.59gene:FBgn0265194 transcript:FBtr0339077[more]
Trpm4.600e-6324.63gene:FBgn0265194 transcript:FBtr0339076[more]
Trpm6.944e-6324.59gene:FBgn0265194 transcript:FBtr0339074[more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm23.669e-8824.08transient receptor potential cation channel, subfa... [more]
hrc9.480e-8125.38histidine rich calcium binding protein [Source:ZFI... [more]
trpm4b.21.015e-7826.30transient receptor potential cation channel, subfa... [more]
trpm31.330e-6625.32transient receptor potential cation channel, subfa... [more]
trpm53.247e-6523.95transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM14.597e-7926.01transient receptor potential cation channel subfam... [more]
shc21.414e-7825.53SHC (Src homology 2 domain containing) transformin... [more]
shc21.047e-7725.97SHC (Src homology 2 domain containing) transformin... [more]
aldh3a21.696e-7725.62aldehyde dehydrogenase 3 family member A2 [Source:... [more]
aldh3a27.458e-7725.86aldehyde dehydrogenase 3 family member A2 [Source:... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm31.167e-7925.43transient receptor potential cation channel, subfa... [more]
Trpm33.354e-7925.82transient receptor potential cation channel, subfa... [more]
Trpm35.815e-7925.35transient receptor potential cation channel, subfa... [more]
Trpm31.405e-7825.85transient receptor potential cation channel, subfa... [more]
Trpm34.146e-7825.66transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7T1N0|TMP2L_NEMVE1.603e-11425.73Transient receptor potential cation channel subfam... [more]
sp|A0A0R4IMY7|TRPM2_DANRE2.770e-8724.08Transient receptor potential cation channel subfam... [more]
sp|Q9HCF6|TRPM3_HUMAN8.055e-7425.11Transient receptor potential cation channel subfam... [more]
sp|E9PTA2|TRPM2_RAT2.040e-7324.40Transient receptor potential cation channel subfam... [more]
sp|Q7TN37|TRPM4_MOUSE6.385e-7024.71Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A8IBU00.000e+059.10Transient receptor potential ion channel Ma DjTRPM... [more]
A0A267F4T80.000e+030.69ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267FQS80.000e+030.19ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GI710.000e+030.38ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267DJL10.000e+031.40ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrc3.931e-7724.94transient receptor potential cation channel subfam... [more]
trpm31.308e-6925.49transient receptor potential cation channel, subfa... [more]
trpm55.241e-6724.63transient receptor potential cation channel subfam... [more]
trpm1a3.041e-6424.92transient receptor potential cation channel, subfa... [more]
trpm4a2.970e-5423.67transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm22.789e-5627.21transient receptor potential cation channel, subfa... [more]
trpm72.264e-4723.29transient receptor potential cation channel, subfa... [more]
trpm71.220e-4622.20transient receptor potential cation channel, subfa... [more]
ENSPMAT00000007449.12.863e-826.00pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.13.482e-826.00pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
AKR28.881e-727.50Ankyrin repeat-containing protein; member of a fam... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO301356.571e-11625.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476585.445e-3426.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315586.322e-1024.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476592.425e-826.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435775.478e-729.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm21.240e-7824.03transient receptor potential cation channel subfam... [more]
trpm22.350e-7325.04transient receptor potential cation channel subfam... [more]
trpm34.790e-7225.48transient receptor potential cation channel subfam... [more]
trpm32.461e-7025.17transient receptor potential cation channel subfam... [more]
trpm31.075e-6824.86transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041546.10.000e+099.36SMESG000041546.1[more]
SMESG000041545.10.000e+058.25SMESG000041545.1[more]
SMESG000078720.13.681e-8932.25SMESG000078720.1[more]
SMESG000078720.13.871e-8932.25SMESG000078720.1[more]
SMESG000078720.18.544e-6328.82SMESG000078720.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032899 ID=SMED30032899|Name=Transient receptor potential cation channel,putative|organism=Schmidtea mediterranea sexual|type=transcript|length=5265bp
TTTAGAAAGATAATTAAAATATTTATCAAAGAATATTATTCAAATAAGAT
ATGTCAACAAAAAATAAAGTATATCCTACTGAAACCAATGACGAATTTGA
AACTAGAATCCTTTCACCTAATTCAATGATAATGCAAGTGTTTGACAGCA
GCTCAACCGTTAAAAATGAAGAGAAAGAAGAACAAATTAAAAAGAATAGT
CAATCAAATCGACAGTTAGAAAAGATCCTGAAATCAGTAGAAAAGTGGGA
CCTCAAAGAATTTCTATCAATTTATGAATTTGAAAATTTATCCCCGGACA
GTCTCTTCGATTACAAATTAGAGGAAACGTTGAAGGTGTCTTCGAATTTC
TTAAGCTACCTTGATAATTGCAACTTGCTTCACTATGCCGCTTTGTATAG
AGCAACTAGAATAGTCAGGGTACTTTTAAGTTCACAGTTTAACTACCCAG
TTGATTCAATGACCAAGGAAGGAATAACGCCACTTCACATTTCTGCAGCC
GTGGGAGATTTCTATACTGTCCGAGAACTTCTAACGCATGGAGCAAATAA
GAATTTGTTGGATCAAAAAGGAAGAATAGCTTTACATTATGCAGTATGTT
CCAATGTCGAGACTTGCATCATCCTCACAAGTGATGGGAATTATGATCTA
CAACTTCAAGATGAGAATGAAAAGTCACCACTGCAATACGGTAAAATGGA
AGACAAGCCATTTATTGCCAAGTATTTAGAAACATTAGATAAAAAGAAAC
TAAACCTATGGATACCTCAGAATATTTGCCAGTTTGAATGTTATTCCATC
ATTCCAAGAAAGGAAAGCCTTATTCAGTGCGAATGTGGGCAAAATGTTGC
CGATCATCATTCAGTTTTCGAAAAATATGATTTCGTTGACACGGAAAATG
TTGAAAAACCCACAAATTTCTTTGGCGAAATTGAGTTTTCCGGTCTTTAC
AAAAGCAAACCATATGTTCGAATGTCAATAAATACTAAATTTGAAACAAC
CGCCTCTCTTTTGATTGACCAGTGGAAAATTACAAAGCCTAGCCTGATAA
TAAGTATATATGGGAGTGATTTTGAAGGTCATGCAATTAAGGATATTTTG
AAAAAAGGAATTCTGAAATCTGCTGGCAATAGAGAAACATTTGTGTGGAT
AATTACTGACGGAATATTTACAAATTTAATTGAAGTAATAGGGAAAGCGA
TCCGTGATTTTACTGATGCATACGGCGAAAATCAGATGTATGGTTTTGCG
ATTACCCCATGGAGTATCCACAATGAAACGGAATATCTTTGTTCGAAAGA
TTATCAAGGAACCCATCCAGCTGAATATAATAAAATCAGTTCAAAAGCTA
CAAAAAGTCAAAAGTTTGACCAGAATCATTCTCATTACATCTTTGTCGAT
ATTCCAAGAACCGAAGATACTATGAAGTCTTTCATAGACTACAGACTGAC
ATTCGAAAATCAAGTATCAAAATTGAATGAGTTTTTAGCTAATACTAAAA
TGAATTTCGAAAAAGTTCCTCTTTGCGGAATTTTAGTCAGTGGAAATAGA
GATGATTTGAAACTGCTGCACGGGTCACTTGTAAAAAACGGGAAACCAAC
AGTAATAATCAAGGGGTCTGGAGGTCTTGCAAATATAATCGGGGAATTAG
TATATGAGATGAAAGAGAAGAATCGCAAAAAGAAATCTTTTGAAGAAATA
ATGCAAAAAGAATATTTAAAAATGATAATGACAGAAATTTGGGAAATTTC
AGATGAATACGAAGAGGAAGTCATTATGATTCAAGAAATAATCGAAAATC
GGCATTTAATTGAGATATATTCGGTCGAGGAAAATAATCCCAATGAATTA
GATAAAAATATTTTATCCTCCCTATTGAGCCAAGATGAAAATTCAGTGAA
ACATCCAGATCATTTAAATATTTATCAACTTGGAGTTGCAATATCTATTA
ACAGACATGATGTAGCCAAAGAAAAGATATTTACGGAGGGAAAAAAATGG
AAAACAGAAGACTTAATACCTTTGGCTACGAAATCCATCTCGGAAAATAA
AGTTGGCTTTGTGAAACTATTTGTAGAAAAAGGATTCTTTTTAGGGAAAA
TTATCACGGTGGAGCTATTGGAAAATTTGTACACTGCCGACATTTCGAAC
GGAACAAAATTGGCTCGAATTCTAAATCAAGGCTTGAGATTGATCGGATT
CAAGAAAAATAATAAAAGAGTAAGCCTTTATGACATAGGAGGAGTATTGA
AATATTTGCTTGGAGATTTATATTATCCTCTTTATTTAAACCCGGAATTT
CAGGAAACATGGAGTTCTAACTTACCGCTGAAACGACCATATAGAGAATT
GTTTATTTGGAGCTTGCTGACTCTGAGAATGGAGATGGCTCAACTTCTTT
GGACTTTAGAAAAGGAATCCATAGCTGCCGCTCTGTTTGCTGCTAATCTT
TTGAGGTCTATGAAAAATTTGACTAACGTTATTTCAGATAAGGATGATTT
AGACGAATGGGCAAAGGATTTTGAAACTAAAGCAGAAGGAGTAGTTGAAG
AATGCTTTAAAGAAAACCCTGAATTCACGAGAGATAATCTCATTCGACAA
CTTGATTACTATGGCCGGTCAACATATTTGGAAATGGCTGCTGATGGAAA
CTCTATAAAATTCATTGCCCACCGATCTTGTCAAGAACTGTTGGATTTTG
TTTGGCGAGGAACCTTAGACGACACAACAAAATCCATGAATTTCATAATG
TACTTGATTATTGGTGTTATTTGTCCGTTCATGATTCCTTTCATTGTCAA
CTTCAAGTCATTATTTTATCTACCAGAAAGCGAAATAGTGGAATATAAAA
AGAAATTGAAAAACAAGCAAAAGATTTCAACACGCCAGTGCTCTGAAAGT
GAAAAGAAAGATTCAAATACCAAAAAAATACCAAGGAAAAGGAATTTTAC
TTTCCAATTGAAAACGTACTTCAAAAAGATGTATGATTTCTACAACGCTC
CGGTGATCAAGTTTTCATACACAATCTTCTTTTATTTGATATTCATCTTG
TATTTCACCTTCCTCAATTTGACGGCATACCACATAAAATACTCGAAGAA
CTCCAATTTGTGGATTTATATACTTTTGATATTTTGGACGGTTTCTCTAC
TCATTGAGGAAGCCAGGCAAGCATTTGGATCTGGAATATCAATTAAAGAA
TATTTAAATGATATATGGAATATCATTGACATTCTGTCTCATTCGTTTTT
CTTGTTGGGAACATTCGGAATTATTATGACCCTATCCGACCCATTGGTTA
AGTCTTTACTCTTCTCTTTATTCGACATTACTCCAATGGTTTCAATCTCT
GTCAATTTACTAAGATTTTCCAAATTCATGTACGGATTCAGTATATTTTT
GTTTACGGTTCGCATTCTGCAATATTTCTCAATAAATGTCAAACTAGGAC
CGATCATTGTTATGATTCGTAACATGCTTACAAATGACCTCGGACCTTTT
ATCGTCATATTGTTGACAGTGCTGGTTTCCTATGGAATTTTACTGGGGTC
AATAAATTTTGAAGTTAAACCAAACCTTACGATGTCAGAATTTTCAATGA
TTTTATATGAAATGTTCCTCACTGGATACTTTCAGTTATTTGGTAATTTA
AGAATAGACGTTTTGCGTGGAGAAAATAATCTTCGTCAATGTGCTAATAA
CAACCTCATGTGTCCAGATGTTTGGGGGGTATGGCTTGGCCCAATAATAG
CAGCTGTATACATGGTGTTGTCCAATGTGCTGATGCTTAATTTGCTAGTA
GCCATATTCAGCAATACATACGAAATAATACAATCATCATCAACTCAATA
TTGGACATTGGAACGATATCAACTAATGAGGCAGTCTTCTAGTAGGCCTC
CAGTTGCTCCGCCATTAATAATTTTTTGGCAGATTTATTTTGTTTTTGCG
AGACTAATCACCATCAAAGTGGGACAAAAACAACCTTTCAAAATCTCTTA
TAGTTCACTACCGTACAAAGAAAAACAATTGATCCAATGGGAGCGCATGA
GAGCAAATGATTACATTAGGTCATTTGATGAACAATCCAAGTCAAAGAGA
AATAAAACTACTTTAATTGTTAACAGAGGCCCGGCGGCAATCGGATCCAT
TGGAGGAATGAAAAAAGATTTCGAATCAACTAAAAATGAAATACTACAAA
GTTTCACCGAACGAATTTCAATTGTAGAATTTCGGTTACAAAAAATGGAT
ATCATTGAAGAAAATGTGAATACAATTTATGATATACTTAGGAAACTAGG
ACCAAATTTACCTTTAAATAATGAAATCAAGATATCCAAGAAAAACGAAT
TAATGATAGAACCAGCCAAAAAAATCGAAGTGACATCAATGTTGGAAAAT
ACAGATTATTTACCTCCAGGGATTGTAAAGAAAACTTTAAAACTATGGAA
ATCAAAATTTGTTGACCATCTAATTTGCAGATTTGTCCCAATATTTACTG
CTGAGCAACCAGTCGAATTTATTGAAGACGACTCGAAGGAATCCCAGAAT
GAAGTTTTGACTGAAGATCTCATCGAATTTCCAAACGGAATTCCCATAAA
TCCACACGAAACTTTGAATAAAATTGGAAAGCCCTTGCTTCCGTTTTGGG
GAGTCAACAGTTGCATCCATTTGCTAATATCTCGATGGAAACCTTGGGAG
AAAGATGATGAAAACGACATCTACAAATCTATTCTTCAAGTTCTTGGAAT
AGGAACAACAAATCATATTGAATTGCCATTTATCATCGTTCAACACAATA
CTGAATGTGAGCAGAATTTGTGCTCATCTAGCAAATTAGAACAAATTATT
AGAGACTATTTCATTGAAATTAACAAGAAAAAAGCGGATAATAAAACATT
TTTAAATGAAAAAGAATTCGAAAGCTTGAACAACTCTAAATATGATAAAG
TCTATGAAGGCTATTTAAAGGATTTCAGGAACTCTGATAATTCATGGATA
GAAACTTCGGCTTTTAACATCCATTTAGAAGATAATTTAGAATTTACTAA
GCCCATATTACATATGCTGCAACATGATGATTCAGAAACCTTATGCTGGG
TCGATGTGGATAAATCCCACTGGACAAATCCAAGCAATATTATATTGTTA
TCCTTTCTCTCCAACTTCCATGGTTTCGAGTTTTAAAATTTCTTCATATC
TAATTTGTGCAAAAATCAGCAAATAAATTGAAGTTTTTATTTAAATTTAT
TCTATTTTCTGACGT
back to top

protein sequence of SMED30032899-orf-1

>SMED30032899-orf-1 ID=SMED30032899-orf-1|Name=SMED30032899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1712bp
MSTKNKVYPTETNDEFETRILSPNSMIMQVFDSSSTVKNEEKEEQIKKNS
QSNRQLEKILKSVEKWDLKEFLSIYEFENLSPDSLFDYKLEETLKVSSNF
LSYLDNCNLLHYAALYRATRIVRVLLSSQFNYPVDSMTKEGITPLHISAA
VGDFYTVRELLTHGANKNLLDQKGRIALHYAVCSNVETCIILTSDGNYDL
QLQDENEKSPLQYGKMEDKPFIAKYLETLDKKKLNLWIPQNICQFECYSI
IPRKESLIQCECGQNVADHHSVFEKYDFVDTENVEKPTNFFGEIEFSGLY
KSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDIL
KKGILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFA
ITPWSIHNETEYLCSKDYQGTHPAEYNKISSKATKSQKFDQNHSHYIFVD
IPRTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFEKVPLCGILVSGNR
DDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKSFEEI
MQKEYLKMIMTEIWEISDEYEEEVIMIQEIIENRHLIEIYSVEENNPNEL
DKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKW
KTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISN
GTKLARILNQGLRLIGFKKNNKRVSLYDIGGVLKYLLGDLYYPLYLNPEF
QETWSSNLPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANL
LRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQ
LDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIM
YLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSES
EKKDSNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSYTIFFYLIFIL
YFTFLNLTAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKE
YLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLVKSLLFSLFDITPMVSIS
VNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPF
IVILLTVLVSYGILLGSINFEVKPNLTMSEFSMILYEMFLTGYFQLFGNL
RIDVLRGENNLRQCANNNLMCPDVWGVWLGPIIAAVYMVLSNVLMLNLLV
AIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFA
RLITIKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKR
NKTTLIVNRGPAAIGSIGGMKKDFESTKNEILQSFTERISIVEFRLQKMD
IIEENVNTIYDILRKLGPNLPLNNEIKISKKNELMIEPAKKIEVTSMLEN
TDYLPPGIVKKTLKLWKSKFVDHLICRFVPIFTAEQPVEFIEDDSKESQN
EVLTEDLIEFPNGIPINPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWE
KDDENDIYKSILQVLGIGTTNHIELPFIIVQHNTECEQNLCSSSKLEQII
RDYFIEINKKKADNKTFLNEKEFESLNNSKYDKVYEGYLKDFRNSDNSWI
ETSAFNIHLEDNLEFTKPILHMLQHDDSETLCWVDVDKSHWTNPSNIILL
SFLSNFHGFEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR041491TRPM_SLOG
IPR002110Ankyrin_rpt
IPR015797NUDIX_hydrolase-like_dom_sf
IPR005821Ion_trans_dom
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016787hydrolase activity
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 39..59
NoneNo IPR availableGENE3DG3DSA:3.90.79.10coord: 1538..1711
e-value: 4.6E-15
score: 57.7
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 236..1397
NoneNo IPR availableTMHMMTMhelixcoord: 1055..1077
NoneNo IPR availableTMHMMTMhelixcoord: 1224..1246
NoneNo IPR availableTMHMMTMhelixcoord: 1182..1204
NoneNo IPR availableTMHMMTMhelixcoord: 983..1005
NoneNo IPR availableTMHMMTMhelixcoord: 1109..1128
NoneNo IPR availableTMHMMTMhelixcoord: 896..918
NoneNo IPR availableTMHMMTMhelixcoord: 1148..1170
NoneNo IPR availableTMHMMTMhelixcoord: 1020..1035
NoneNo IPR availableTMHMMTMhelixcoord: 1087..1104
NoneNo IPR availableTMHMMTMhelixcoord: 1283..1305
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 140..169
e-value: 2.2E-4
score: 30.6
coord: 173..202
e-value: 390.0
score: 8.1
coord: 105..134
e-value: 36.0
score: 13.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 140..172
score: 12.796
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 110..202
e-value: 3.4E-10
score: 40.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 105..226
score: 22.225
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 25..272
e-value: 2.7E-21
score: 78.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 105..228
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 304..573
e-value: 1.8E-33
score: 116.1
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 991..1263
e-value: 3.7E-13
score: 49.3