Survival of motor neuron-related-splicing factor 30

Overview
NameSurvival of motor neuron-related-splicing factor 30
Smed IDSMED30032895
Length (bp)583
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Survival of motor neuron-related-splicing factor 30 (SMED30032895) t-SNE clustered cells

Violin plots show distribution of expression levels for Survival of motor neuron-related-splicing factor 30 (SMED30032895) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Survival of motor neuron-related-splicing factor 30 (SMED30032895) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Survival of motor neuron-related-splicing factor 30 (SMED30032895) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032895

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032895h1SMcG0009821 SmedASXL_011852SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032895h1SMcG0009821 SmedASXL_011852SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30032895h1SMcG0009821 dd_Smed_v4_5356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032895h1SMcG0009821 dd_Smed_v4_5356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032895h1SMcG0009821 dd_Smed_v4_5356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Fly
Match: CG17454 (gene:FBgn0039977 transcript:FBtr0299868)

HSP 1 Score: 51.6026 bits (122), Expect = 6.042e-8
Identity = 36/142 (25.35%), Postives = 61/142 (42.96%), Query Frame = 1
Query:   34 EDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI-------------EEP-----------------------------IWKIGDGCQALW-QDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKM 330
            +DL  Y+    ++  AL  DP+N+EL++ + +++E++TL +++              EP                             IWK GD CQA W +D  YY+A I D    G   V FD + +++   +  LR + 
Sbjct:    3 DDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQLEEQNKSSYVEPSSTKRDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQAKWKEDRQYYDATIEDISSTGEVNVIFDAYQNRSTTHVNELRERT 144          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Fly
Match: CG17454 (gene:FBgn0039977 transcript:FBtr0333911)

HSP 1 Score: 48.521 bits (114), Expect = 6.475e-7
Identity = 33/127 (25.98%), Postives = 54/127 (42.52%), Query Frame = 1
Query:   79 ALSIDPDNQELIEQKQNIEELLTLAKEI-------------EEP-----------------------------IWKIGDGCQALW-QDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKM 330
            AL  DP+N+EL++ + +++E++TL +++              EP                             IWK GD CQA W +D  YY+A I D    G   V FD + +++   +  LR + 
Sbjct:    5 ALQTDPENEELLKLRSDLDEVITLTRDLIQTQLEEQNKSSYVEPSSTKRDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQAKWKEDRQYYDATIEDISSTGEVNVIFDAYQNRSTTHVNELRERT 131          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Zebrafish
Match: smndc1 (survival motor neuron domain containing 1 [Source:NCBI gene;Acc:572679])

HSP 1 Score: 52.7582 bits (125), Expect = 3.758e-8
Identity = 51/196 (26.02%), Postives = 99/196 (50.51%), Query Frame = 1
Query:   31 MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI--EEPI-----------------WKIGDGCQALW-QDNNYYNAVI--IDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKL-----GXXXXXXXXXXXXEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQMKK 537
            M+ L+ Y+    ++  ALSIDPDN++L++ +++++E++ L K++   +P                  W++GD C A W QD   Y A I  ID   +GT  + F  + +  +  L  L+ K++E ++     G    +++ Q  +  Y     K  Q +V+ ++E++   E ++  W+ F +K   K K+  Q+K+
Sbjct:    6 MKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTSQPAEGTTSTKSSETVAPSHSWRVGDHCMATWSQDGQVYEAEIEEIDNE-NGTAAITFAGYGNAEVMPLHMLK-KVEEGRIRDEIDGKPKSKKELQAEQREYK---KKKAQKKVQRMKELEQEREDQKSKWQQFNNKAYSKNKK-GQVKR 195          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Zebrafish
Match: smndc1 (survival motor neuron domain containing 1 [Source:NCBI gene;Acc:572679])

HSP 1 Score: 52.7582 bits (125), Expect = 3.758e-8
Identity = 51/196 (26.02%), Postives = 99/196 (50.51%), Query Frame = 1
Query:   31 MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI--EEPI-----------------WKIGDGCQALW-QDNNYYNAVI--IDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKL-----GXXXXXXXXXXXXEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQMKK 537
            M+ L+ Y+    ++  ALSIDPDN++L++ +++++E++ L K++   +P                  W++GD C A W QD   Y A I  ID   +GT  + F  + +  +  L  L+ K++E ++     G    +++ Q  +  Y     K  Q +V+ ++E++   E ++  W+ F +K   K K+  Q+K+
Sbjct:    6 MKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTSQPAEGTTSTKSSETVAPSHSWRVGDHCMATWSQDGQVYEAEIEEIDNE-NGTAAITFAGYGNAEVMPLHMLK-KVEEGRIRDEIDGKPKSKKELQAEQREYK---KKKAQKKVQRMKELEQEREDQKSKWQQFNNKAYSKNKK-GQVKR 195          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Zebrafish
Match: smndc1 (survival motor neuron domain containing 1 [Source:NCBI gene;Acc:572679])

HSP 1 Score: 52.7582 bits (125), Expect = 3.758e-8
Identity = 51/196 (26.02%), Postives = 99/196 (50.51%), Query Frame = 1
Query:   31 MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI--EEPI-----------------WKIGDGCQALW-QDNNYYNAVI--IDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKL-----GXXXXXXXXXXXXEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQMKK 537
            M+ L+ Y+    ++  ALSIDPDN++L++ +++++E++ L K++   +P                  W++GD C A W QD   Y A I  ID   +GT  + F  + +  +  L  L+ K++E ++     G    +++ Q  +  Y     K  Q +V+ ++E++   E ++  W+ F +K   K K+  Q+K+
Sbjct:    6 MKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTSQPAEGTTSTKSSETVAPSHSWRVGDHCMATWSQDGQVYEAEIEEIDNE-NGTAAITFAGYGNAEVMPLHMLK-KVEEGRIRDEIDGKPKSKKELQAEQREYK---KKKAQKKVQRMKELEQEREDQKSKWQQFNNKAYSKNKK-GQVKR 195          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. UniProt/SwissProt
Match: sp|Q7ZV80|SPF30_DANRE (Survival of motor neuron-related-splicing factor 30 OS=Danio rerio OX=7955 GN=smndc1 PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.837e-7
Identity = 51/196 (26.02%), Postives = 99/196 (50.51%), Query Frame = 1
Query:   31 MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI--EEPI-----------------WKIGDGCQALW-QDNNYYNAVI--IDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKL-----GXXXXXXXXXXXXEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQMKK 537
            M+ L+ Y+    ++  ALSIDPDN++L++ +++++E++ L K++   +P                  W++GD C A W QD   Y A I  ID   +GT  + F  + +  +  L  L+ K++E ++     G    +++ Q  +  Y     K  Q +V+ ++E++   E ++  W+ F +K   K K+  Q+K+
Sbjct:    6 MKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTSQPAEGTTSTKSSETVAPSHSWRVGDHCMATWSQDGQVYEAEIEEIDNE-NGTAAITFAGYGNAEVMPLHMLK-KVEEGRIRDEIDGKPKSKKELQAEQREYK---KKKAQKKVQRMKELEQEREDQKSKWQQFNNKAYSKNKK-GQVKR 195          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. TrEMBL
Match: D5JG58 (Survival motor neuron-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=SMN PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 8.161e-27
Identity = 69/149 (46.31%), Postives = 101/149 (67.79%), Query Frame = 1
Query:   67 EIIKALSIDPDNQELIEQKQNIEELLTL------AKEIEEPI-WKIGDGCQALWQ-DNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKLGXXXXXXXXXXXXEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTF 489
            ++  +LS+DP+NQEL+E K ++EE + L      AK+ E  + W  GD CQA+W  D +YYNAVI D + DGTC+V+F+++ DK ICDL SL+ K+ +EK+ NK+RQRKR KNK  + E ++K    +     E+++  EAER+ WKTF
Sbjct:    5 QVTVSLSLDPENQELLELKNHLEEAIALCDDIKNAKQNESALKWNKGDECQAMWMGDKHYYNAVIEDIYADGTCQVRFNKYTDKQICDLSSLKMKLADEKMSNKVRQRKRHKNKMGFEEYKAKRLYEKKMFDDEINSKVEAERQVWKTF 153          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. TrEMBL
Match: A0A267GMS7 (Tudor domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034475g1 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 8.950e-13
Identity = 62/198 (31.31%), Postives = 95/198 (47.98%), Query Frame = 1
Query:   34 EDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTL-----------AKEIEEPI-WKIGDGCQALW-QDNNYYNAVIIDTFIDGTCKVQF-----DRHNDKAICDLKSLRPKMDEEKLGX------------XXXXXXXXXXXEAYMEGRSKIKQA-------RVELLQEVDAMCEAERKSWKTFKSKLQKKEK 516
            ++L  Y+    ++  AL +D DN EL+  K  ++E++ L           A E+ E   WK+GD C ALW +D  YY AVI +   DGTC V F     D H ++  C +  L+P  D  K G               +    Q  K+   E R+K  +A       R E  +E++A+ E E+KSW++F  K+QK+ +
Sbjct:    7 QNLLNYKLQLQQVKAALELDKDNAELLALKTELDEIIGLTLQLLGRDPSEAVEVGEAFGWKVGDHCSALWARDRLYYPAVITEVRRDGTCFVSFAHLPSDSHAEQ--CQVSLLKPLADGAKSGADAHGSESGAASLTAQGSNAQAAKKRRREERTKALEAKMRKVAKRAEREKEMEAVVEREKKSWQSFSKKIQKQGR 202          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. TrEMBL
Match: A0A183QQH7 (Tudor domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.311e-12
Identity = 52/171 (30.41%), Postives = 89/171 (52.05%), Query Frame = 1
Query:   37 DLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI-------EEPIWKIGDGCQALW-QDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKLGXXXXXXXXXXXXEAYMEGRSKIKQARVELLQ---EVDAMCEAERKSWKTFKSKLQKKEK 516
            DL  ++    ++  AL +DP+N+EL++ K+++EE++ L+ E+        E  W +GD C A+  +D  YY A I++   D +C V FD ++   +C L  L+P      +  K +   + +  E     + KIK+ R  LLQ   E+++ CE E+  W  F  K+ K  K
Sbjct:    8 DLLNHKLQLQQVEAALELDPENEELLQLKRDLEEVIKLSLELLGRTSDTPEVSWNVGDQCMAMCSRDKLYYRATILEFLGDVSCVVNFDMYDTTDVCQLCHLKPVTTVTPIVKKKKHDIKNRAIE-----KKKIKKQR--LLQREVEIESFCEKEKNRWLNFSKKMIKTGK 171          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. TrEMBL
Match: G4VPV2 (Putative survival motor neuron protein OS=Schistosoma mansoni OX=6183 GN=Smp_064830 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.447e-12
Identity = 52/171 (30.41%), Postives = 89/171 (52.05%), Query Frame = 1
Query:   37 DLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI-------EEPIWKIGDGCQALW-QDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKLGXXXXXXXXXXXXEAYMEGRSKIKQARVELLQ---EVDAMCEAERKSWKTFKSKLQKKEK 516
            DL  ++    ++  AL +DP+N+EL++ K+++EE++ L+ E+        E  W +GD C A+  +D  YY A I++   D +C V FD ++   +C L  L+P      +  K +   + +  E     + KIK+ R  LLQ   E+++ CE E+  W  F  K+ K  K
Sbjct:    8 DLLNHKLQLQQVEAALELDPENEELLQLKRDLEEVIKLSLELLGRTSDTPEVSWNVGDQCMAMCSRDKLYYRATILEFLGDVSCVVNFDMYDTTDVCQLCHLKPVTTVTPIVKKKKHDIKNRAIE-----KKKIKKQR--LLQREVEIESFCEKEKNRWLNFSKKMIKTGK 171          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. TrEMBL
Match: A0A267F5N8 (Tudor domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019470g1 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.156e-12
Identity = 63/202 (31.19%), Postives = 96/202 (47.52%), Query Frame = 1
Query:   34 EDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTL-----------AKEIEEPI-WKIGDGCQALW-QDNNYYNAVIIDTFIDGTCKVQF-----DRHNDKAICDLKSLRPKMDEEKLGX------------XXXXXXXXXXXEAYMEGRSKIKQA-------RVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQ 528
            ++L  Y+    ++  AL +D DN EL+  K  ++E++ L           A E+ E   WK+GD C ALW +D  YY AVI +   DGTC V F       H ++  C +  L+P  D  K G               +    Q  K+   E R+K  +A       R E  +E++A+ E E+KSW++F  K+ KK+ RI +
Sbjct:    7 QNLLNYKLQLQQVEAALELDKDNAELLALKTELDEIIGLTLQLLGRDPSEAVEVGEAFGWKVGDHCSALWARDRQYYPAVITEVRRDGTCFVSFAHLPSGSHAEQ--CQVSLLKPLADGAKPGADVHGSESGAASLTAQGSNAQAAKKRRREERTKALEAKMRKVAKRAEREKEMEAVVEQEKKSWQSFSKKI-KKQGRIGK 205          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Cavefish
Match: smndc1 (survival motor neuron domain containing 1 [Source:NCBI gene;Acc:103046212])

HSP 1 Score: 51.9878 bits (123), Expect = 4.433e-8
Identity = 31/116 (26.72%), Postives = 58/116 (50.00%), Query Frame = 1
Query:   40 LTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI-------------------EEPIWKIGDGCQALW-QDNNYYNAVIIDTFI-DGTCKVQFDRHNDKAICDLKSLRP 324
            L+ Y+    ++  ALS D DN++L++ +++++E++ L K++                   E+  W++GD C A+W  D   Y A I +  + +GT  V F  + +  +  L  LRP
Sbjct:    9 LSSYRAQLQQVEAALSTDTDNEDLLKLQKDLQEVIELTKDLLTNQPAEGVANASSADAAPEKTTWRVGDNCMAVWNHDGQSYEAEIEEIDVENGTAAVTFLGYGNAEVIPLHMLRP 124          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Cavefish
Match: smndc1 (survival motor neuron domain containing 1 [Source:NCBI gene;Acc:103046212])

HSP 1 Score: 51.9878 bits (123), Expect = 5.325e-8
Identity = 31/116 (26.72%), Postives = 58/116 (50.00%), Query Frame = 1
Query:   40 LTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI-------------------EEPIWKIGDGCQALW-QDNNYYNAVIIDTFI-DGTCKVQFDRHNDKAICDLKSLRP 324
            L+ Y+    ++  ALS D DN++L++ +++++E++ L K++                   E+  W++GD C A+W  D   Y A I +  + +GT  V F  + +  +  L  LRP
Sbjct:   26 LSSYRAQLQQVEAALSTDTDNEDLLKLQKDLQEVIELTKDLLTNQPAEGVANASSADAAPEKTTWRVGDNCMAVWNHDGQSYEAEIEEIDVENGTAAVTFLGYGNAEVIPLHMLRP 141          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Sea Lamprey
Match: smndc1 (survival motor neuron domain containing 1 [Source:NCBI gene;Acc:572679])

HSP 1 Score: 56.9954 bits (136), Expect = 1.694e-10
Identity = 33/124 (26.61%), Postives = 63/124 (50.81%), Query Frame = 1
Query:   40 LTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEI--------------------EEPIWKIGDGCQALW-QDNNYYNAVIIDTFID-GTCKVQFDRHNDKAICDLKSLRPKMDEEKL 345
            L+ Y+    ++  AL+ DP+NQ+L++ K++++E++ L +++                    + P W +GD C A W +D  +Y A I +  +D GT  V F  + +  +  + SL+P   E +L
Sbjct:    9 LSNYKVQLQQVEAALTADPNNQDLLKLKKDLQEVIDLTQDLLTTQTSESSASAAEREPGRSQAPPWAVGDHCLATWNEDGQWYEAEIEEVNVDGGTVAVTFAGYGNTEVVPMHSLKPVEQERQL 132          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Nematostella
Match: EDO39770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S946])

HSP 1 Score: 66.6254 bits (161), Expect = 1.088e-13
Identity = 43/110 (39.09%), Postives = 60/110 (54.55%), Query Frame = 1
Query:   37 DLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLA------------KEIEEPIWKIGDGCQALW-QDNNYYNAVIIDTFID--GTCKVQFDRHNDKAICDLKSLR 321
            +LT Y+    ++  AL+ DPDN+EL++ KQ++EE++ L              E+    WK+G  CQA+W QD NYY A  ID   D   TC V FD  N + I  L SL+
Sbjct:   10 NLTQYRAQLSQVDAALTTDPDNEELLKLKQDLEEVINLTLDLLKVNVKVPEAELPNAKWKVGHRCQAVWTQDGNYYPAT-IDLISDDLSTCTVTFDYGNTE-IVKLDSLK 117          
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Planmine SMEST
Match: SMESG000050984.1 (SMESG000050984.1)

HSP 1 Score: 323.553 bits (828), Expect = 1.237e-114
Identity = 172/172 (100.00%), Postives = 172/172 (100.00%), Query Frame = 1
Query:   31 MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEIEEPIWKIGDGCQALWQDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKLGXXXXXXXXXXXXEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQMKKETK 546
            MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEIEEPIWKIGDGCQALWQDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKLGNKIRQRKRQKNKEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQMKKETK
Sbjct:    1 MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEIEEPIWKIGDGCQALWQDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKMDEEKLGNKIRQRKRQKNKEAYMEGRSKIKQARVELLQEVDAMCEAERKSWKTFKSKLQKKEKRIAQMKKETK 172          
The following BLAST results are available for this feature:
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG174546.042e-825.35gene:FBgn0039977 transcript:FBtr0299868[more]
CG174546.475e-725.98gene:FBgn0039977 transcript:FBtr0333911[more]
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smndc13.758e-826.02survival motor neuron domain containing 1 [Source:... [more]
smndc13.758e-826.02survival motor neuron domain containing 1 [Source:... [more]
smndc13.758e-826.02survival motor neuron domain containing 1 [Source:... [more]
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q7ZV80|SPF30_DANRE2.837e-726.02Survival of motor neuron-related-splicing factor 3... [more]
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG588.161e-2746.31Survival motor neuron-like protein (Fragment) OS=D... [more]
A0A267GMS78.950e-1331.31Tudor domain-containing protein OS=Macrostomum lig... [more]
A0A183QQH74.311e-1230.41Tudor domain-containing protein OS=Schistosoma rod... [more]
G4VPV24.447e-1230.41Putative survival motor neuron protein OS=Schistos... [more]
A0A267F5N86.156e-1231.19Tudor domain-containing protein OS=Macrostomum lig... [more]
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smndc14.433e-826.72survival motor neuron domain containing 1 [Source:... [more]
smndc15.325e-826.72survival motor neuron domain containing 1 [Source:... [more]
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smndc11.694e-1026.61survival motor neuron domain containing 1 [Source:... [more]
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO397701.088e-1339.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Survival of motor neuron-related-splicing factor 30 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000050984.11.237e-114100.00SMESG000050984.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032895 ID=SMED30032895|Name=Survival of motor neuron-related-splicing factor 30|organism=Schmidtea mediterranea sexual|type=transcript|length=583bp
ATTTTGTAAGTTTTAATATTTCTAAATCAAATGGAAGATTTGACCTATTA
TCAAAATGTGTTCGATGAAATAATAAAAGCCTTATCAATAGACCCAGATA
ATCAAGAATTAATTGAACAAAAGCAAAATATAGAAGAACTCTTAACATTA
GCAAAAGAGATTGAGGAGCCAATATGGAAAATCGGCGATGGATGTCAAGC
GTTATGGCAAGATAACAACTATTACAACGCAGTTATTATAGATACATTTA
TTGATGGAACTTGTAAAGTTCAATTCGATAGACATAATGATAAGGCTATT
TGTGATTTAAAGTCTCTTAGACCTAAAATGGATGAAGAAAAATTAGGCAA
TAAAATCAGACAAAGAAAAAGACAGAAAAACAAAGAAGCTTATATGGAAG
GTCGTTCCAAAATCAAACAAGCCAGAGTTGAACTGTTGCAAGAAGTCGAT
GCAATGTGCGAAGCTGAACGGAAAAGCTGGAAAACATTTAAGTCTAAATT
ACAGAAAAAAGAAAAAAGAATAGCACAAATGAAAAAAGAAACAAAATAAG
TTTGAATTCTCTTATTTTATATTAAATATATTT
back to top

protein sequence of SMED30032895-orf-1

>SMED30032895-orf-1 ID=SMED30032895-orf-1|Name=SMED30032895-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=173bp
MEDLTYYQNVFDEIIKALSIDPDNQELIEQKQNIEELLTLAKEIEEPIWK
IGDGCQALWQDNNYYNAVIIDTFIDGTCKVQFDRHNDKAICDLKSLRPKM
DEEKLGNKIRQRKRQKNKEAYMEGRSKIKQARVELLQEVDAMCEAERKSW
KTFKSKLQKKEKRIAQMKKETK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR002999Tudor
IPR010304Survival_motor_neuron
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 150..170
NoneNo IPR availableCOILSCoilCoilcoord: 24..44
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 41..101
e-value: 1.8E-8
score: 35.9
NoneNo IPR availablePANTHERPTHR13681:SF26SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30coord: 49..164
NoneNo IPR availablePANTHERPTHR13681FAMILY NOT NAMEDcoord: 49..164
NoneNo IPR availableCDDcd04508TUDORcoord: 52..98
e-value: 5.74635E-7
score: 42.5851
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 48..100
IPR002999Tudor domainSMARTSM00333TUDOR_7coord: 47..104
e-value: 0.003
score: 26.8
IPR010304Survival motor neuronPFAMPF06003SMNcoord: 48..121
e-value: 4.4E-6
score: 26.1