foxQ2

Overview
NamefoxQ2 (AFP48374.1)
Smed IDSMED30032892
Length (bp)1291
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of foxQ2 (SMED30032892) t-SNE clustered cells

Violin plots show distribution of expression levels for foxQ2 (SMED30032892) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032892

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032892h1SMcG0021168 SmedASXL_000937SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032892h1SMcG0021168 SmedASXL_001531SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032892h1SMcG0021168 dd_Smed_v4_50245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032892h1SMcG0021168 dd_Smed_v4_50245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032892h1SMcG0021168 dd_Smed_v4_50245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032892h1SMcG0021168 dd_Smed_v6_50245_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of foxQ2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 104.375 bits (259), Expect = 4.798e-24
Identity = 50/87 (57.47%), Postives = 61/87 (70.11%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED 
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of foxQ2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 103.99 bits (258), Expect = 2.828e-23
Identity = 50/87 (57.47%), Postives = 61/87 (70.11%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED 
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of foxQ2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 103.99 bits (258), Expect = 3.011e-23
Identity = 50/87 (57.47%), Postives = 61/87 (70.11%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED 
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of foxQ2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 103.99 bits (258), Expect = 3.011e-23
Identity = 50/87 (57.47%), Postives = 61/87 (70.11%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED 
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of foxQ2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 103.99 bits (258), Expect = 3.011e-23
Identity = 50/87 (57.47%), Postives = 61/87 (70.11%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED 
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of foxQ2 vs. Ensembl Celegans
Match: fkh-10 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:O17593])

HSP 1 Score: 155.606 bits (392), Expect = 3.253e-45
Identity = 64/94 (68.09%), Postives = 81/94 (86.17%), Query Frame = 2
Query:  368 TTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            T    PKP +SYIGLI+MAILS+ +KKMVL+++Y+WI + Y YF++RG GWRNSIRHNLSLNDCFVK GR++NGKGHYW +HPA ++DF+RGDF
Sbjct:   36 TECQQPKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAANGKGHYWAVHPACVKDFERGDF 129          
BLAST of foxQ2 vs. Ensembl Celegans
Match: fkh-10 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:O17593])

HSP 1 Score: 155.606 bits (392), Expect = 3.253e-45
Identity = 64/94 (68.09%), Postives = 81/94 (86.17%), Query Frame = 2
Query:  368 TTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            T    PKP +SYIGLI+MAILS+ +KKMVL+++Y+WI + Y YF++RG GWRNSIRHNLSLNDCFVK GR++NGKGHYW +HPA ++DF+RGDF
Sbjct:   36 TECQQPKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAANGKGHYWAVHPACVKDFERGDF 129          
BLAST of foxQ2 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 104.375 bits (259), Expect = 9.259e-25
Identity = 50/91 (54.95%), Postives = 66/91 (72.53%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED-FKRGDF 649
            KP YSYI LI+M+IL++ EKK+ LS+I ++I + + Y++ + P W+NSIRHNLSLNDCFVKV R     GKG+YW + P N ED F  G F
Sbjct:  127 KPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDP-NCEDMFDNGSF 216          
BLAST of foxQ2 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 97.4413 bits (241), Expect = 6.060e-22
Identity = 53/134 (39.55%), Postives = 74/134 (55.22%), Query Frame = 2
Query:  257 SVMPVGPQNNPFSQNSMISLQPL-LKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            S +   P +  +S  S    Q L ++ F  V     +  T    KP YSYI LI+MAI  +  +++ LS+IY WI D + Y+Q     W+NSIRH+LS NDCFVKV RS +  GKG +W +H      F+ G +
Sbjct:   97 STVAASPADRSYSGVSGGQGQELTIQEFETVTEKIRRHGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCY 230          
BLAST of foxQ2 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 97.8265 bits (242), Expect = 8.454e-22
Identity = 51/122 (41.80%), Postives = 70/122 (57.38%), Query Frame = 2
Query:  257 SVMPVGPQNNPFSQNSMISLQPL-LKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIH 613
            S +   P +  +S  S    Q L ++ F  V     +  T    KP YSYI LI+MAI  +  +++ LS+IY WI D + Y+Q     W+NSIRH+LS NDCFVKV RS +  GKG +W +H
Sbjct:  192 STVAASPADRSYSGVSGGQGQELTIQEFETVTEKIRRHGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLH 313          
BLAST of foxQ2 vs. Ensembl Fly
Match: fd102C (gene:FBgn0039937 transcript:FBtr0089251)

HSP 1 Score: 166.392 bits (420), Expect = 2.363e-45
Identity = 79/106 (74.53%), Postives = 98/106 (92.45%), Query Frame = 2
Query:  377 DDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFXXXXXXXXXXXALGL 694
            ++PKP +SYIGLI+MAILS+ + K+VLSDIYQ+I D+Y YF++RGPGWRNSIRHNLSLNDCF+K GRS+NGKGHYW IHPAN+EDF++GDFRRR+AQRKVR+ +GL
Sbjct:  126 EEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSANGKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGL 231          
BLAST of foxQ2 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0339246)

HSP 1 Score: 100.138 bits (248), Expect = 7.001e-23
Identity = 45/90 (50.00%), Postives = 60/90 (66.67%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            KP YSYI L +MAI S+ EK + LSDIY++I D + Y++     W+NS+RHNLS NDCF+KV R  +  GKG YW +HP   + F+ G  
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSL 102          
BLAST of foxQ2 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0084770)

HSP 1 Score: 100.138 bits (248), Expect = 7.001e-23
Identity = 45/90 (50.00%), Postives = 60/90 (66.67%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            KP YSYI L +MAI S+ EK + LSDIY++I D + Y++     W+NS+RHNLS NDCF+KV R  +  GKG YW +HP   + F+ G  
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSL 102          
BLAST of foxQ2 vs. Ensembl Fly
Match: fd96Cb (gene:FBgn0004898 transcript:FBtr0084771)

HSP 1 Score: 95.9005 bits (237), Expect = 4.303e-22
Identity = 42/97 (43.30%), Postives = 63/97 (64.95%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGR--SSNGKGHYWGIHPANIEDFKRGDF 649
            K +  D KP YSYI L +MAI+ + ++ + LS+IY++I D + +++     W+NS+RHNLS NDCF+KV R  +  GKG YW +HP   + F+ G  
Sbjct:    6 KMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSL 102          
BLAST of foxQ2 vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 97.0561 bits (240), Expect = 2.203e-21
Identity = 46/90 (51.11%), Postives = 60/90 (66.67%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            KP YSYI LI+MAI +  +KK+ L+ IYQ+I + + Y++    GW+NSIRHNLSLN+CFVKV R     GKG YW + P +   F  G F
Sbjct:   70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSF 159          
BLAST of foxQ2 vs. Ensembl Zebrafish
Match: foxq2 (forkhead box Q2 [Source:ZFIN;Acc:ZDB-GENE-050208-663])

HSP 1 Score: 144.05 bits (362), Expect = 1.047e-39
Identity = 61/95 (64.21%), Postives = 74/95 (77.89%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            K+   D KP  SYI LISMAIL + EKK++L DIYQWI DHY YF+++   WRNS+RHNLSLN+CF+K GRS NGKGH+W IHPAN +DF  GD+
Sbjct:   99 KSEGTDEKPAQSYIALISMAILDSDEKKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNECFIKAGRSDNGKGHFWAIHPANFQDFSNGDY 193          
BLAST of foxQ2 vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 103.219 bits (256), Expect = 2.754e-23
Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED 631
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED
Sbjct:   60 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKED 145          
BLAST of foxQ2 vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 103.219 bits (256), Expect = 2.881e-23
Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED 631
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED
Sbjct:   60 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKED 145          
BLAST of foxQ2 vs. Ensembl Zebrafish
Match: foxb1b (forkhead box B1b [Source:ZFIN;Acc:ZDB-GENE-990415-77])

HSP 1 Score: 99.7525 bits (247), Expect = 3.330e-23
Identity = 45/97 (46.39%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            + T  D KP YSYI L +MAI S  EK + LS+IY++I D + Y++     W+NS+RHNLS NDCF+K+ R  +  GKG +W +HP+  + F+ G F
Sbjct:    6 RNTYSDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSF 102          
BLAST of foxQ2 vs. Ensembl Zebrafish
Match: foxb1b (forkhead box B1b [Source:ZFIN;Acc:ZDB-GENE-990415-77])

HSP 1 Score: 99.7525 bits (247), Expect = 3.330e-23
Identity = 45/97 (46.39%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            + T  D KP YSYI L +MAI S  EK + LS+IY++I D + Y++     W+NS+RHNLS NDCF+K+ R  +  GKG +W +HP+  + F+ G F
Sbjct:    6 RNTYSDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSF 102          
BLAST of foxQ2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 103.99 bits (258), Expect = 2.227e-23
Identity = 50/90 (55.56%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED  + 
Sbjct:   78 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQA 167          
BLAST of foxQ2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 103.99 bits (258), Expect = 2.342e-23
Identity = 50/90 (55.56%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED  + 
Sbjct:   61 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQA 150          
BLAST of foxQ2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 103.99 bits (258), Expect = 2.521e-23
Identity = 50/90 (55.56%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED  + 
Sbjct:   61 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQA 150          
BLAST of foxQ2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 103.99 bits (258), Expect = 2.565e-23
Identity = 50/90 (55.56%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED  + 
Sbjct:   78 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQA 167          
BLAST of foxQ2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 103.99 bits (258), Expect = 2.743e-23
Identity = 50/90 (55.56%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED  + 
Sbjct:   78 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQA 167          
BLAST of foxQ2 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 103.605 bits (257), Expect = 2.728e-23
Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED 631
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKED 161          
BLAST of foxQ2 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 103.605 bits (257), Expect = 2.737e-23
Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED 631
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKED 161          
BLAST of foxQ2 vs. Ensembl Mouse
Match: Foxa3 (forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477])

HSP 1 Score: 100.523 bits (249), Expect = 4.970e-23
Identity = 47/90 (52.22%), Postives = 61/90 (67.78%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            KP YSYI LI+MAI     K + LS+IYQWI D + Y++     W+NSIRH+LS NDCFVKV RS +  GKG YW +HP++   F+ G +
Sbjct:  119 KPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCY 208          
BLAST of foxQ2 vs. Ensembl Mouse
Match: Foxb1 (forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549])

HSP 1 Score: 99.7525 bits (247), Expect = 6.846e-23
Identity = 45/97 (46.39%), Postives = 65/97 (67.01%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            + T  D KP YSYI L +MAI S+ EK + LS+IY++I D + Y++     W+NS+RHNLS NDCF+K+ R  +  GKG +W +HP+  + F+ G F
Sbjct:    6 RNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSF 102          
BLAST of foxQ2 vs. Ensembl Mouse
Match: Foxd4 (forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467])

HSP 1 Score: 100.908 bits (250), Expect = 8.861e-23
Identity = 49/97 (50.52%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  368 TTQDDP---KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            TT D P   KP YSYI LI+MAIL +  K++ LS I  +I   + Y++ + P W+NSIRHNLSLNDCFVK+ R     GKG+YW + PA+ + F  G
Sbjct:   94 TTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNG 190          
BLAST of foxQ2 vs. UniProt/SwissProt
Match: sp|Q63251|FOXD1_RAT (Forkhead box protein D1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd1 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.605e-23
Identity = 44/88 (50.00%), Postives = 62/88 (70.45%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            KP YSYI LI+MAIL + +K++ LS+I ++I   + Y++ + P W+NSIRHNLSLNDCFVK+ R     GKG+YW + P + + F  G
Sbjct:    3 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 90          
BLAST of foxQ2 vs. UniProt/SwissProt
Match: sp|Q63245|FOXD3_RAT (Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.741e-23
Identity = 45/88 (51.14%), Postives = 62/88 (70.45%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            KP YSYI LI+MAIL + +KK+ LS I ++I + + Y++ + P W+NSIRHNLSLNDCFVK+ R     GKG+YW + P + + F  G
Sbjct:    3 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNG 90          
BLAST of foxQ2 vs. UniProt/SwissProt
Match: sp|Q63249|FOXD4_RAT (Forkhead box protein D4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd4 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.165e-23
Identity = 45/88 (51.14%), Postives = 60/88 (68.18%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            KP YSYI LI+MAIL +  K++ LS I  +I   + Y++ + P W+NSIRHNLSLNDCFVK+ R     GKG+YW + PA+ + F  G
Sbjct:    3 KPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNG 90          
BLAST of foxQ2 vs. UniProt/SwissProt
Match: sp|Q9UPW0|FOXJ3_HUMAN (Forkhead box protein J3 OS=Homo sapiens OX=9606 GN=FOXJ3 PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 1.446e-22
Identity = 50/87 (57.47%), Postives = 61/87 (70.11%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED 
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of foxQ2 vs. UniProt/SwissProt
Match: sp|Q8BUR3|FOXJ3_MOUSE (Forkhead box protein J3 OS=Mus musculus OX=10090 GN=Foxj3 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.908e-22
Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED 631
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED
Sbjct:   76 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKED 161          
BLAST of foxQ2 vs. TrEMBL
Match: J7FNB1 (FoxQ2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 350/350 (100.00%), Postives = 350/350 (100.00%), Query Frame = 2
Query:  158 MENSFITKSTQXXXXXXXXXXXXXKMIQSSMPISVMPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFXXXXXXXXXXXALGLXXXXXXXXXXXXXXXXXKAFDWPITAHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQT 1207
            MENSFITKSTQNNFFSINNSNVISKMIQSSMPISVMPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFRRRRAQRKVRRALGLTCPDEDDTPSPSPTHSPKAFDWPITAHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQT
Sbjct:    1 MENSFITKSTQNNFFSINNSNVISKMIQSSMPISVMPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFRRRRAQRKVRRALGLTCPDEDDTPSPSPTHSPKAFDWPITAHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQT 350          
BLAST of foxQ2 vs. TrEMBL
Match: A0A0R3SVF9 (Fork-head domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9557 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.523e-50
Identity = 89/111 (80.18%), Postives = 108/111 (97.30%), Query Frame = 2
Query:  362 KKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFXXXXXXXXXXXALGL 694
            ++TT+++PKPN+SYIGLI+ AILS+K+++MVLS+IY+WIQ +Y+YF++RGPGWRNSIRHNLSLNDCF+KVGRSSNGKGHYWGIHPAN+EDF RGDFRRRRAQRKVRRALGL
Sbjct:   81 QRTTEEEPKPNFSYIGLIAKAILSSKDRRMVLSEIYEWIQVNYAYFRSRGPGWRNSIRHNLSLNDCFIKVGRSSNGKGHYWGIHPANVEDFCRGDFRRRRAQRKVRRALGL 191          
BLAST of foxQ2 vs. TrEMBL
Match: A0A183ISH5 (Fork-head domain-containing protein OS=Soboliphyme baturini OX=241478 GN=SBAD_LOCUS6572 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.938e-49
Identity = 92/150 (61.33%), Postives = 106/150 (70.67%), Query Frame = 2
Query:  239 QSSMPISVMPVGPQN----NPFSQNSMISLQPLL--------KAFHPVVGD-FCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            Q  M +  +P G Q      P   N  IS  P L        KAF   V D    +  Q++PKP +SYIGLI+MAILS++EKKMVL DIYQWI DHYSYF++RGPGWRNSIRHNLSLNDCF+K GRS+NGKGHYW IHPANIEDFK+GDF
Sbjct:   24 QQLMSLERLPFGAQGPALTTPSGMNFAISAYPTLDPITAATVKAFGFGVFDPRNSRFVQEEPKPQHSYIGLIAMAILSSEEKKMVLCDIYQWILDHYSYFRSRGPGWRNSIRHNLSLNDCFIKAGRSANGKGHYWAIHPANIEDFKKGDF 173          
BLAST of foxQ2 vs. TrEMBL
Match: A0A564YA67 (Fork-head domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4645 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.355e-48
Identity = 89/111 (80.18%), Postives = 108/111 (97.30%), Query Frame = 2
Query:  362 KKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFXXXXXXXXXXXALGL 694
            ++TT+++PKPN+SYIGLI+ AILS+K+++MVLS+IY+WIQ +Y+YF++RGPGWRNSIRHNLSLNDCF+KVGRSSNGKGHYWGIHPAN+EDF RGDFRRRRAQRKVRRALGL
Sbjct:   81 QRTTEEEPKPNFSYIGLIAKAILSSKDRRMVLSEIYEWIQVNYAYFRSRGPGWRNSIRHNLSLNDCFIKVGRSSNGKGHYWGIHPANVEDFCRGDFRRRRAQRKVRRALGL 191          
BLAST of foxQ2 vs. TrEMBL
Match: W5XK16 (Foxq2 (Fragment) OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.461e-48
Identity = 88/125 (70.40%), Postives = 106/125 (84.80%), Query Frame = 2
Query:  320 PLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFXXXXXXXXXXXALGL 694
            PL   F     D   +  Q++PKP  SYIGLI+MAILS K++K+VLSDIYQWI D+YSYF+TRGPGWRNSIRHNLSLNDCF+K GRS+NGKGHYW IHPAN++DFK+GDFRRR+AQR+VR+A+GL
Sbjct:   92 PLSHPFFAAKYDPRARFVQEEPKPQQSYIGLIAMAILSHKDRKLVLSDIYQWILDNYSYFRTRGPGWRNSIRHNLSLNDCFIKAGRSANGKGHYWAIHPANVDDFKKGDFRRRKAQRRVRKAMGL 216          
BLAST of foxQ2 vs. Ensembl Cavefish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 100.523 bits (249), Expect = 2.384e-24
Identity = 50/110 (45.45%), Postives = 67/110 (60.91%), Query Frame = 2
Query:  326 LKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            L    P +G       +   KP YSYI LI+MAI S  E++  LS IYQ+I D++ ++     GW+NSIRHNLSLNDCFVKV R     GKG YW + P  ++ F+ G++
Sbjct:   50 LGGVFPALG-LASARREPPQKPPYSYIALIAMAIKSAPEERATLSGIYQFIMDNFPFYHDNKQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPKCLDMFENGNY 158          
BLAST of foxQ2 vs. Ensembl Cavefish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 98.2117 bits (243), Expect = 1.727e-23
Identity = 47/94 (50.00%), Postives = 64/94 (68.09%), Query Frame = 2
Query:  374 QDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            +D  KP YSYI LI+MAI S+ EK++ L+ IYQ+I + + +++    GW+NSIRHNLSLN+CFVKV R     GKG YW + P +   F+ G F
Sbjct:   68 KDAVKPPYSYIALITMAIQSSAEKRVTLNGIYQFIMERFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSF 161          
BLAST of foxQ2 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 103.605 bits (257), Expect = 1.878e-23
Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED 631
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED
Sbjct:   70 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKED 155          
BLAST of foxQ2 vs. Ensembl Cavefish
Match: ENSAMXT00000003861.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000133.1:1175856:1177001:-1 gene:ENSAMXG00000003780.2 transcript:ENSAMXT00000003861.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 1.923e-23
Identity = 44/97 (45.36%), Postives = 63/97 (64.95%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            + T  + KP YSYI L +MAI S  EK + LSDIY++I + + Y++     W+NS+RHNLS NDCF+K+ R  +  GKG +W +HP   + F+ G F
Sbjct:    6 RNTYSEQKPPYSYISLTAMAIQSCPEKMLPLSDIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPRCGDMFENGSF 102          
BLAST of foxQ2 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 103.605 bits (257), Expect = 2.258e-23
Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIED 631
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I     ED
Sbjct:   60 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKED 145          
BLAST of foxQ2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002898.1 (pep scaffold:Pmarinus_7.0:GL479751:2384:3805:1 gene:ENSPMAG00000002651.1 transcript:ENSPMAT00000002898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.738e-31
Identity = 52/92 (56.52%), Postives = 70/92 (76.09%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYF--QTR--GPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            KP  SY  LI+ AILS++++++ LS IY WI++ Y ++  Q R    GWRNS+RHNLSLN+CFVKVGR  +GKG+YWGIH  ++E F+RGDF
Sbjct:   56 KPRLSYTALIANAILSSRDRRLNLSSIYSWIEERYPFYGRQDRRAARGWRNSVRHNLSLNECFVKVGRCEDGKGNYWGIHEHHVEAFERGDF 147          
BLAST of foxQ2 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 99.3673 bits (246), Expect = 1.130e-25
Identity = 47/90 (52.22%), Postives = 63/90 (70.00%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKV--GRSSNGKGHYWGIHPANIEDFKRGDF 649
            KP +SYI LI MAI S+  K++ LS+IYQ++Q  + +F+    GW+NS+RHNLSLN+CFVK+  G    GKGHYW I PA+   F+ G F
Sbjct:    5 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSF 94          
BLAST of foxQ2 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 100.138 bits (248), Expect = 1.198e-25
Identity = 47/90 (52.22%), Postives = 63/90 (70.00%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKV--GRSSNGKGHYWGIHPANIEDFKRGDF 649
            KP +SYI LI MAI S+  K++ LS+IYQ++Q  + +F+    GW+NS+RHNLSLN+CFVK+  G    GKGHYW I PA+   F+ G F
Sbjct:    6 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSF 95          
BLAST of foxQ2 vs. Ensembl Sea Lamprey
Match: foxl2b (forkhead box L2b [Source:ZFIN;Acc:ZDB-GENE-170803-1])

HSP 1 Score: 97.8265 bits (242), Expect = 6.198e-25
Identity = 46/96 (47.92%), Postives = 67/96 (69.79%), Query Frame = 2
Query:  374 QDDP--KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNG--KGHYWGIHPANIEDFKRGDF 649
            + DP  KP YSY+ LI+MAI  + +K++ LS IYQ+I   + +++    GW+NSIRHNLSLN+CFVKV R   G  KG+YW + PA  + F++G++
Sbjct:   16 KTDPSQKPPYSYVALIAMAIRESSDKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFVKVPREGGGERKGNYWTLDPACEDMFEKGNY 111          
BLAST of foxQ2 vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 97.4413 bits (241), Expect = 2.729e-24
Identity = 48/97 (49.48%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRGDF 649
            +  +D  KP YSYI LI+MAI S  +KK+ L+ IYQ+I D + +++    GW+NSIRHNLSLN+CFVKV R     GKG YW + P +   F+ G F
Sbjct:   70 QAPKDLVKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFENGSF 166          
BLAST of foxQ2 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 103.219 bits (256), Expect = 3.285e-24
Identity = 48/118 (40.68%), Postives = 72/118 (61.02%), Query Frame = 2
Query:  299 NSMISLQPLLKAFHP--VVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGD 646
            N  ++L+ +L++     + G+  KK       P YSY  LI +AIL ++E K+ LS IY WI  H+ Y++ +   W+NSIRHNLSLND F+K  +S +GKGH+W + P     F +G+
Sbjct:   85 NGNLTLEEILQSLERRRINGELAKK-------PPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCDGKGHFWEVRPGAETKFFKGE 195          
BLAST of foxQ2 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 84.3445 bits (207), Expect = 6.865e-18
Identity = 51/133 (38.35%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  251 PISVMPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDD---PKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            P +  P GP N   + N + S +      +P   DF    + D+    KP +SY  +I+ AILS+ E  + L+DIY++I  +Y+Y++    GW+NSIRHNLSLN  F KV R  N  GKG  W I  +  ++F
Sbjct:  294 PQAASPQGPPNTIIAANFVDSYKS--SNAYPQALDFTSDLSHDENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEF 424          
BLAST of foxQ2 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 74.3294 bits (181), Expect = 6.668e-15
Identity = 38/85 (44.71%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDF 634
            KP  SY  +I+ AILST E  + L+DIY++I D+Y++++     W+NS+RHNLSLN  F KV + +   GKG  W I      DF
Sbjct:  303 KPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDF 387          
BLAST of foxQ2 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 63.929 bits (154), Expect = 2.055e-11
Identity = 34/86 (39.53%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILS-TKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKR 640
            KP  SY  +++  I   +  K M LS+IY  I++ + Y++    GW++S+RHNLSLN  F KV  S  GKG  WG+    I + +R
Sbjct:  461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKV--SKEGKGWLWGLDEEYIAERER 544          
BLAST of foxQ2 vs. Ensembl Nematostella
Match: EDO45043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU95])

HSP 1 Score: 135.576 bits (340), Expect = 4.511e-39
Identity = 60/88 (68.18%), Postives = 73/88 (82.95%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            KP+ SYIGLI  AI+S  +KK+VLSDIY +I  HY YF+ +G GWRNSIRHNLSLN+CFVKVGRSSNGKGH+W I+P N EDF +G++
Sbjct:    1 KPSQSYIGLIGKAIMSVPQKKLVLSDIYNYILTHYPYFRNKGAGWRNSIRHNLSLNECFVKVGRSSNGKGHFWAINPENYEDFSKGEY 88          
BLAST of foxQ2 vs. Ensembl Nematostella
Match: EDO34609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNU6])

HSP 1 Score: 134.42 bits (337), Expect = 9.634e-39
Identity = 58/88 (65.91%), Postives = 71/88 (80.68%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            KP +SYI LI+MAILS   KKM+L DIYQ+I D++ Y++ +   WRNSIRHNLSLN+CF+K GRS NGKG+YW IHPAN+EDF  GDF
Sbjct:    2 KPAHSYIALIAMAILSNSSKKMILGDIYQYISDNFPYYRNKDKSWRNSIRHNLSLNECFIKAGRSENGKGNYWAIHPANLEDFANGDF 89          
BLAST of foxQ2 vs. Ensembl Nematostella
Match: EDO38502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW5])

HSP 1 Score: 130.183 bits (326), Expect = 5.526e-37
Identity = 59/88 (67.05%), Postives = 70/88 (79.55%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            KPN SYI LIS AILS+ E+K++LSDIY +I   Y YF+T+G GWRNSIRHNLSLN+CFVK GRS NGKGH+W I     +DF+RGDF
Sbjct:    1 KPNQSYISLISEAILSSPEQKLILSDIYNFILTRYPYFRTKGTGWRNSIRHNLSLNECFVKAGRSPNGKGHFWAIDATYFDDFRRGDF 88          
BLAST of foxQ2 vs. Ensembl Nematostella
Match: EDO38254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDF7])

HSP 1 Score: 107.071 bits (266), Expect = 1.778e-28
Identity = 45/85 (52.94%), Postives = 64/85 (75.29%), Query Frame = 2
Query:  398 SYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYF-QTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            +++ +I+ +ILS   K+M LS IY +I  +Y +F + +GPGWRNS+RHNLS NDCFVK  R+ NGKGHYW IHP ++ +F +G+F
Sbjct:    1 TFVAVIAQSILSVPTKRMTLSSIYSFIAKNYPHFDKEKGPGWRNSVRHNLSSNDCFVKASRAENGKGHYWMIHPKDLPEFSKGNF 85          
BLAST of foxQ2 vs. Ensembl Nematostella
Match: EDO43985 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX78])

HSP 1 Score: 106.686 bits (265), Expect = 2.613e-28
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 2
Query:  398 SYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYF-QTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            +++ +I+ AILS   ++M LS IY +I   Y +F + +GPGWRNS+RHNLS NDCFVK  R+ NGKGHYW IHP ++ +F +G+F
Sbjct:    1 TFVAVIAQAILSVPTRRMTLSCIYSFIAKTYPHFDKEKGPGWRNSVRHNLSSNDCFVKASRAENGKGHYWMIHPKDLPEFSKGNF 85          
BLAST of foxQ2 vs. Ensembl Medaka
Match: foxq2 (forkhead box protein D1 [Source:NCBI gene;Acc:100301625])

HSP 1 Score: 144.436 bits (363), Expect = 1.077e-39
Identity = 60/88 (68.18%), Postives = 73/88 (82.95%), Query Frame = 2
Query:  386 KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDF 649
            KPN SYI LIS AILS+KEKK++L DIYQWI DHY YF+++   WRNS+RHNLSLN+CF+K GRS NGKGH+W IHP N +DF +GD+
Sbjct:  115 KPNQSYIALISRAILSSKEKKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNECFIKAGRSDNGKGHFWAIHPGNYQDFSKGDY 202          
BLAST of foxQ2 vs. Ensembl Medaka
Match: ENSORLT00000004708.2 (forkhead box protein D1-like [Source:NCBI gene;Acc:101160044])

HSP 1 Score: 101.679 bits (252), Expect = 5.880e-24
Identity = 48/99 (48.48%), Postives = 65/99 (65.66%), Query Frame = 2
Query:  371 TQDDP------KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
             QD P      KP YSYI LI+MAIL + +KK+ L +I ++I   + Y+Q R P W+NSIRHNLSLNDCF+K+ R     GKG+YW + P + + F+ G
Sbjct:   44 AQDAPGRRGASKPPYSYIALITMAILQSPKKKLTLGEICEFISQRFVYYQERFPAWQNSIRHNLSLNDCFIKMPREPGNPGKGNYWTLDPMSADMFENG 142          
BLAST of foxQ2 vs. Ensembl Medaka
Match: ENSORLT00000031716.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 98.9821 bits (245), Expect = 7.743e-24
Identity = 46/79 (58.23%), Postives = 57/79 (72.15%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGI 610
            D KP YSY  LI+ AI  +  K+M LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I
Sbjct:   74 DGKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 152          
BLAST of foxQ2 vs. Ensembl Medaka
Match: FOXJ3 (forkhead box protein J3 [Source:NCBI gene;Acc:101158100])

HSP 1 Score: 103.99 bits (258), Expect = 1.400e-23
Identity = 48/79 (60.76%), Postives = 59/79 (74.68%), Query Frame = 2
Query:  380 DPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGI 610
            D KP YSY  LI+ AI S+ +KKM LS+IYQWI D++ Y++  G GW+NSIRHNLSLN CF+KV RS +  GKG YW I
Sbjct:   60 DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVARSKDDPGKGSYWAI 138          
BLAST of foxQ2 vs. Ensembl Medaka
Match: foxl2 (forkhead box L2 [Source:NCBI gene;Acc:100125429])

HSP 1 Score: 100.908 bits (250), Expect = 1.624e-23
Identity = 47/100 (47.00%), Postives = 69/100 (69.00%), Query Frame = 2
Query:  362 KKTTQDDP--KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNG--KGHYWGIHPANIEDFKRGDF 649
            K + + DP  KP YSY+ LI+MAI  + EK++ LS IYQ+I   + +++    GW+NSIRHNLSLN+CF+KV R   G  KG+YW + PA  + F++G++
Sbjct:   37 KVSEKPDPSQKPPYSYVALIAMAIRESSEKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY 136          
BLAST of foxQ2 vs. Planmine SMEST
Match: SMESG000062929.1 (SMESG000062929.1)

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 352/354 (99.44%), Postives = 353/354 (99.72%), Query Frame = 2
Query:  158 MENSFITKSTQXXXXXXXXXXXXXKMIQSSMPISVMPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFXXXXXXXXXXXALGLXXXXXXXXXXXXXXXXXKAFDWPITAHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQTDQFK 1219
            MENSFITKSTQNNFFSINNSNVISKMIQSSMPISV+PVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFRRRRAQRKVRRALGLTCPDEDDTPSPSPTHSPKAFDWPIT HNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQTDQFK
Sbjct:    1 MENSFITKSTQNNFFSINNSNVISKMIQSSMPISVLPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFRRRRAQRKVRRALGLTCPDEDDTPSPSPTHSPKAFDWPITGHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQTDQFK 354          
BLAST of foxQ2 vs. Planmine SMEST
Match: SMESG000062929.1 (SMESG000062929.1)

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 327/329 (99.39%), Postives = 328/329 (99.70%), Query Frame = 2
Query:  233 MIQSSMPISVMPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFXXXXXXXXXXXALGLXXXXXXXXXXXXXXXXXKAFDWPITAHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQTDQFK 1219
            MIQSSMPISV+PVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFRRRRAQRKVRRALGLTCPDEDDTPSPSPTHSPKAFDWPIT HNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQTDQFK
Sbjct:    1 MIQSSMPISVLPVGPQNNPFSQNSMISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWGIHPANIEDFKRGDFRRRRAQRKVRRALGLTCPDEDDTPSPSPTHSPKAFDWPITGHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHNIEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLNILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQTDQFK 329          
BLAST of foxQ2 vs. Planmine SMEST
Match: SMESG000065690.1 (SMESG000065690.1)

HSP 1 Score: 102.834 bits (255), Expect = 6.304e-26
Identity = 49/97 (50.52%), Postives = 68/97 (70.10%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRS--SNGKGHYWGIHPANIEDFKRGDF 649
            K+     KP YSYI LI+M+IL +KEK++ L++I  +I  ++ Y++ R P W+NSIRHNLSLNDCFVK  R   S+GKG+YW + PA +  F+ G F
Sbjct:    2 KSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSF 98          
BLAST of foxQ2 vs. Planmine SMEST
Match: SMESG000021761.1 (SMESG000021761.1)

HSP 1 Score: 100.138 bits (248), Expect = 3.355e-24
Identity = 47/95 (49.47%), Postives = 65/95 (68.42%), Query Frame = 2
Query:  365 KTTQDDPKPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSN--GKGHYWGIHPANIEDFKRG 643
            +  ++  KP YSYI LI+MAI S+  KK+ LS+I  +I   +SY++ R P W+NSIRHNLSLNDCF+K+ R SN  GKG++W + P +   F  G
Sbjct:   20 EVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 114          
BLAST of foxQ2 vs. Planmine SMEST
Match: SMESG000028135.1 (SMESG000028135.1)

HSP 1 Score: 98.9821 bits (245), Expect = 6.843e-24
Identity = 48/94 (51.06%), Postives = 62/94 (65.96%), Query Frame = 2
Query:  371 TQDDP-KPNYSYIGLISMAILSTKEKKMVLSDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGR--SSNGKGHYWGIHPANIEDFKRG 643
            T D P KP YSYI LIS+AI S+  +K  L+ IY WI+ H++YF+     W+NSIRH LS NDCF+K+ R    +GKG YW IHP   + F+ G
Sbjct:   62 TNDKPVKPPYSYITLISIAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDHFQFG 155          
The following BLAST results are available for this feature:
BLAST of foxQ2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ34.798e-2457.47forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ32.828e-2357.47forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ33.011e-2357.47forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ33.011e-2357.47forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ33.011e-2357.47forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
back to top
BLAST of foxQ2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-103.253e-4568.09ForKHead transcription factor family [Source:UniP... [more]
fkh-103.253e-4568.09ForKHead transcription factor family [Source:UniP... [more]
unc-1309.259e-2554.95pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
pha-46.060e-2239.55Defective pharyngeal development protein 4 [Sourc... [more]
pha-48.454e-2241.80Defective pharyngeal development protein 4 [Sourc... [more]
back to top
BLAST of foxQ2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd102C2.363e-4574.53gene:FBgn0039937 transcript:FBtr0089251[more]
fd96Ca7.001e-2350.00gene:FBgn0004897 transcript:FBtr0339246[more]
fd96Ca7.001e-2350.00gene:FBgn0004897 transcript:FBtr0084770[more]
fd96Cb4.303e-2243.30gene:FBgn0004898 transcript:FBtr0084771[more]
croc2.203e-2151.11gene:FBgn0014143 transcript:FBtr0078395[more]
back to top
BLAST of foxQ2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxq21.047e-3964.21forkhead box Q2 [Source:ZFIN;Acc:ZDB-GENE-050208-6... [more]
foxj32.754e-2358.14forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxj32.881e-2358.14forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxb1b3.330e-2346.39forkhead box B1b [Source:ZFIN;Acc:ZDB-GENE-990415-... [more]
foxb1b3.330e-2346.39forkhead box B1b [Source:ZFIN;Acc:ZDB-GENE-990415-... [more]
back to top
BLAST of foxQ2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndel12.227e-2355.56nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel12.342e-2355.56nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel12.521e-2355.56nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel12.565e-2355.56nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel12.743e-2355.56nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
back to top
BLAST of foxQ2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxj32.728e-2358.14forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj32.737e-2358.14forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxa34.970e-2352.22forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477... [more]
Foxb16.846e-2346.39forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549... [more]
Foxd48.861e-2350.52forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467... [more]
back to top
BLAST of foxQ2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63251|FOXD1_RAT1.605e-2350.00Forkhead box protein D1 (Fragment) OS=Rattus norve... [more]
sp|Q63245|FOXD3_RAT1.741e-2351.14Forkhead box protein D3 (Fragment) OS=Rattus norve... [more]
sp|Q63249|FOXD4_RAT7.165e-2351.14Forkhead box protein D4 (Fragment) OS=Rattus norve... [more]
sp|Q9UPW0|FOXJ3_HUMAN1.446e-2257.47Forkhead box protein J3 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8BUR3|FOXJ3_MOUSE1.908e-2258.14Forkhead box protein J3 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of foxQ2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J7FNB10.000e+0100.00FoxQ2 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A0R3SVF92.523e-5080.18Fork-head domain-containing protein OS=Hymenolepis... [more]
A0A183ISH52.938e-4961.33Fork-head domain-containing protein OS=Soboliphyme... [more]
A0A564YA671.355e-4880.18Fork-head domain-containing protein OS=Hymenolepis... [more]
W5XK161.461e-4870.40Foxq2 (Fragment) OS=Platynereis dumerilii OX=6359 ... [more]
back to top
BLAST of foxQ2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxl12.384e-2445.45forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
foxc1b1.727e-2350.00forkhead box C1b [Source:NCBI gene;Acc:79375][more]
foxj31.878e-2358.14forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
ENSAMXT00000003861.21.923e-2345.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
foxj32.258e-2358.14forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
back to top
BLAST of foxQ2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002898.11.738e-3156.52pep scaffold:Pmarinus_7.0:GL479751:2384:3805:1 gen... [more]
foxf2a1.130e-2552.22forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxf2a1.198e-2552.22forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxl2b6.198e-2547.92forkhead box L2b [Source:ZFIN;Acc:ZDB-GENE-170803-... [more]
FOXC22.729e-2449.48forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
back to top
BLAST of foxQ2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM13.285e-2440.68Forkhead transcription factor; drives S-phase acti... [more]
FKH26.865e-1838.35Forkhead family transcription factor; rate-limitin... [more]
FKH16.668e-1544.71Forkhead family transcription factor; rate-limitin... [more]
FHL12.055e-1139.53Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of foxQ2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450434.511e-3968.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346099.634e-3965.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385025.526e-3767.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382541.778e-2852.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439852.613e-2852.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of foxQ2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxq21.077e-3968.18forkhead box protein D1 [Source:NCBI gene;Acc:1003... [more]
ENSORLT00000004708.25.880e-2448.48forkhead box protein D1-like [Source:NCBI gene;Acc... [more]
ENSORLT00000031716.17.743e-2458.23forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
FOXJ31.400e-2360.76forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
foxl21.624e-2347.00forkhead box L2 [Source:NCBI gene;Acc:100125429][more]
back to top
BLAST of foxQ2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062929.10.000e+099.44SMESG000062929.1[more]
SMESG000062929.10.000e+099.39SMESG000062929.1[more]
SMESG000065690.16.304e-2650.52SMESG000065690.1[more]
SMESG000021761.13.355e-2449.47SMESG000021761.1[more]
SMESG000028135.16.843e-2451.06SMESG000028135.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032892
GenBankAFP48374.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032892 ID=SMED30032892|Name=foxQ2|organism=Schmidtea mediterranea sexual|type=transcript|length=1291bp
CACACACATATACAAGTGCGACCTACCGGTTTCAGCTGAGTGATAAAAAT
TTGAGAAAACAGTGTGAAGTGCATTTGTTTTCATAGATAAATTGACTTTG
TTTCTTTTAATTGTCCGTTTGAAAAATAAAAATATAAACTGTTTTTCAAA
TTCTCGCATGGAAAATTCTTTTATCACGAAATCAACGCAAAATAATTTCT
TTTCAATCAACAATTCCAATGTCATTTCAAAGATGATCCAGTCCTCAATG
CCTATTTCGGTTATGCCAGTTGGACCACAGAACAATCCATTCTCTCAAAA
CTCAATGATTTCTCTTCAACCATTACTAAAAGCCTTTCATCCGGTGGTCG
GGGATTTCTGTAAGAAAACAACACAAGATGATCCGAAACCGAACTATAGT
TATATTGGTCTCATTTCAATGGCAATTTTGAGTACGAAAGAAAAGAAAAT
GGTTTTATCCGATATTTATCAATGGATCCAAGATCATTATTCATACTTTC
AAACGAGAGGACCTGGTTGGAGAAATAGCATCCGACACAATCTTTCTTTA
AATGATTGTTTTGTCAAAGTTGGTAGATCATCCAATGGAAAAGGTCACTA
TTGGGGAATCCACCCTGCTAATATTGAAGATTTCAAACGAGGTGATTTTC
GTAGAAGAAGAGCACAAAGGAAAGTACGGCGAGCTTTAGGGTTGACTTGT
CCAGATGAAGACGATACTCCATCTCCATCTCCAACACATTCGCCAAAAGC
ATTTGATTGGCCAATAACTGCGCACAATGAAACACCGAATTTCCAGATTT
CTGATAATTCCATTCATAAAATGAATTCTATTATTCACAACAAAACCGAA
AATGACATTCCACTAATTTCCAATTCCGGATACAATCCGTATTTCTGGCC
GCATAACATTGAAGATGAGGACAAGTTAAAATTAATCAAATCAAGTCAAA
ATTCTAGAACATTTGACATAGAAAATATTCTCAACCCAGTAACAAAAAAA
GTTCAGTTGAAAGAAGTGTTTTATAATCAGTTTTTTTCACATTTAAACTT
CCTAAATATCCTCAATGGAATACGTTTTGCCCGACAGTTGCCATCCACTT
TTTTCAGAGAGAATCAAGTTCACCAATTTCTTGAATTCAAACACCGAGCC
ATTGCAAATAGATCAGTAAATTTAATGTTGAAAAGTGTAACAAATATTGA
ACAAACTGATCAGTTTAAATAATATTATGTAAATATTTAATTTTTGCGAT
TTATTTTAATTTATTTGTTATTATTTCACTGAAAATATGCC
back to top

protein sequence of SMED30032892-orf-1

>SMED30032892-orf-1 ID=SMED30032892-orf-1|Name=SMED30032892-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MENSFITKSTQNNFFSINNSNVISKMIQSSMPISVMPVGPQNNPFSQNSM
ISLQPLLKAFHPVVGDFCKKTTQDDPKPNYSYIGLISMAILSTKEKKMVL
SDIYQWIQDHYSYFQTRGPGWRNSIRHNLSLNDCFVKVGRSSNGKGHYWG
IHPANIEDFKRGDFRRRRAQRKVRRALGLTCPDEDDTPSPSPTHSPKAFD
WPITAHNETPNFQISDNSIHKMNSIIHNKTENDIPLISNSGYNPYFWPHN
IEDEDKLKLIKSSQNSRTFDIENILNPVTKKVQLKEVFYNQFFSHLNFLN
ILNGIRFARQLPSTFFRENQVHQFLEFKHRAIANRSVNLMLKSVTNIEQT
DQFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000036eye
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 121..138
score: 79.14
coord: 77..90
score: 67.52
coord: 98..115
score: 36.73
IPR001766Fork head domainSMARTSM00339forkneu4coord: 75..163
e-value: 9.0E-48
score: 174.7
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 77..159
e-value: 7.6E-35
score: 119.0
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 77..169
score: 31.032
IPR001766Fork head domainCDDcd00059FHcoord: 77..152
e-value: 4.74867E-42
score: 139.226
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 65..170
e-value: 5.0E-39
score: 134.4
NoneNo IPR availablePANTHERPTHR11829:SF142FORKHEAD BOX Q2coord: 67..202
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 67..202
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 121..127
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 77..168